F342198

General Info

Members Datasets Scaffolds Average Seq Length
229 131 225 139

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0476807|Ga0373931_0476807_350_763
Length 137
Sequence MLVPSKTKYRKAQKGGKKITGFASSGNKLSFGSFGLKSLEAGKLNSKQIESARKVLSRYMKRAGKMWIMVFPHTPVTQKPAEVRMGSGKGNVEYYIAKIKPGRIIFEIDGVENEVAYNSLMKAAAKLPFKTKIINLI

Samples

Sample ID Description Type Environment
1 2643221591 Devosia sp. Root685 Isolate Unclassified
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
126 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
130 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
131 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0.87
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 0.87
Rhizosphere 75.55
Stem 0
Stem Tuber 0
Unclassified 19.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100026292 3300005355 Bacteria 4782
2 Ga0070673_100448145 3300005364 Bacteria 1161
3 Ga0070709_10009375 3300005434 Bacteria 5398
4 Ga0070709_10205854 3300005434 Bacteria 1396
5 Ga0070714_100004105 3300005435 Bacteria 10951
6 Ga0070714_100016218 3300005435 Bacteria 6009
7 Ga0070714_100357531 3300005435 Bacteria 1372
8 Ga0070713_100009715 3300005436 Bacteria 6909
9 Ga0070713_100692519 3300005436 Bacteria 972
10 Ga0070713_101238061 3300005436 Bacteria 723
11 Ga0070710_10027030 3300005437 Bacteria 3056
12 Ga0070710_10290004 3300005437 Bacteria 1065
13 Ga0070710_10959276 3300005437 Bacteria 621
14 Ga0070711_100094383 3300005439 Bacteria 2162
15 Ga0070706_100181318 3300005467 Bacteria 1966
16 Ga0070698_100039432 3300005471 Bacteria 4862
17 Ga0070698_100492142 3300005471 Bacteria 1164
18 Ga0070699_100212152 3300005518 Bacteria 1724
19 Ga0070672_100764305 3300005543 Bacteria 849
20 Ga0068852_101840366 3300005616 Bacteria 628
21 Ga0068866_10527483 3300005718 Bacteria 786
22 Ga0068860_101745661 3300005843 Bacteria 644
23 Ga0070717_10003780 3300006028 Bacteria 10877
24 Ga0070717_10372302 3300006028 Bacteria 1280
25 Ga0070717_10520824 3300006028 Bacteria 1076
26 Ga0070717_10625478 3300006028 Bacteria 977
27 Ga0070716_100438000 3300006173 Bacteria 949
28 Ga0070716_100440956 3300006173 Bacteria 947
29 Ga0070712_100018095 3300006175 Bacteria 4570
30 Ga0070712_100096219 3300006175 Bacteria 2179
31 Ga0070712_100823226 3300006175 Bacteria 797
32 Ga0070712_101253348 3300006175 Bacteria 646
33 Ga0075362_10259021 3300006177 Bacteria 857
34 Ga0075366_10491322 3300006195 Bacteria 758
35 Ga0075430_100551041 3300006846 Bacteria 951
36 Ga0075431_101207183 3300006847 Bacteria 719
37 Ga0075434_100463708 3300006871 Bacteria 1288
38 Ga0075434_101432332 3300006871 Bacteria 701
39 Ga0075436_100051091 3300006914 Bacteria 2853
40 Ga0099794_10536329 3300007265 Bacteria 617
41 Ga0099795_10028110 3300007788 Bacteria 1909
42 Ga0099795_10127017 3300007788 Bacteria 1025
43 Ga0114129_11510716 3300009147 Bacteria 825
44 Ga0105242_11177974 3300009176 Bacteria 784
45 Ga0105242_12290064 3300009176 Bacteria 586
46 Ga0105248_10723019 3300009177 Bacteria 1123
47 Ga0105249_11979895 3300009553 Bacteria 655
48 Ga0099796_10010062 3300010159 Bacteria 2585
49 Ga0105239_11293531 3300010375 Bacteria 841
50 Ga0157374_10709297 3300013296 Bacteria 1019
51 Ga0157380_10310935 3300014326 Bacteria 1456
52 Ga0182008_10805331 3300014497 Bacteria 546
53 Ga0184598_133872 3300019182 Bacteria 1283
54 Ga0213873_10048776 3300021358 Bacteria 1114
55 Ga0213873_10059466 3300021358 Bacteria 1031
56 Ga0213872_10011303 3300021361 Bacteria 4227
57 Ga0213872_10012804 3300021361 Bacteria 3938
58 Ga0213872_10298838 3300021361 Bacteria 669
59 Ga0213874_10004526 3300021377 Bacteria 3185
60 Ga0213876_10167820 3300021384 Bacteria 1168
61 Ga0213876_10400409 3300021384 Bacteria 730
62 Ga0213876_10668482 3300021384 Bacteria 553
63 Ga0213875_10000189 3300021388 Bacteria 63108
64 Ga0213875_10013683 3300021388 Bacteria 3977
65 Ga0213875_10109711 3300021388 Bacteria 1288
66 Ga0213875_10114841 3300021388 Bacteria 1258
67 Ga0213875_10123195 3300021388 Bacteria 1211
68 Ga0213875_10203843 3300021388 Bacteria 930
69 Ga0213871_10001349 3300021441 Bacteria 4063
70 Ga0213871_10021467 3300021441 Bacteria 1610
71 Ga0213871_10154173 3300021441 Bacteria 700
72 Ga0247553_100116 3300023672 Bacteria 2284
73 Ga0228598_1031083 3300024227 Bacteria 1051
74 Ga0207692_10004608 3300025898 Bacteria 5467
75 Ga0207692_10077761 3300025898 Bacteria 1766
76 Ga0207685_10073364 3300025905 Bacteria 1394
77 Ga0207699_10135603 3300025906 Bacteria 1611
78 Ga0207699_10233145 3300025906 Bacteria 1261
79 Ga0207699_10409908 3300025906 Bacteria 966
80 Ga0207684_10082801 3300025910 Bacteria 2733
81 Ga0207695_10255478 3300025913 Bacteria 1651
82 Ga0207693_10008823 3300025915 Bacteria 8239
83 Ga0207693_10021027 3300025915 Bacteria 5188
84 Ga0207693_10124956 3300025915 Bacteria 2021
85 Ga0207663_10355653 3300025916 Bacteria 1110
86 Ga0207663_10377461 3300025916 Bacteria 1079
87 Ga0207659_10279184 3300025926 Bacteria 1365
88 Ga0207700_10017186 3300025928 Bacteria 4826
89 Ga0207700_10897648 3300025928 Bacteria 793
90 Ga0207700_11480490 3300025928 Bacteria 603
91 Ga0207664_10012040 3300025929 Bacteria 6175
92 Ga0207664_10190811 3300025929 Bacteria 1764
93 Ga0207664_10648045 3300025929 Bacteria 949
94 Ga0207664_10960123 3300025929 Bacteria 766
95 Ga0207644_10520722 3300025931 Bacteria 982
96 Ga0207665_10129885 3300025939 Bacteria 1787
97 Ga0207665_11066227 3300025939 Bacteria 644
98 Ga0207711_10140909 3300025941 Bacteria 2169
99 Ga0207689_11262351 3300025942 Bacteria 621
100 Ga0207651_10572535 3300025960 Bacteria 984
101 Ga0209179_1020440 3300027512 Bacteria 1284
102 Ga0265327_10009609 3300031251 Bacteria 6946
103 Ga0307513_10832790 3300031456 Bacteria 629
104 Ga0373932_0025691 3300035112 Bacteria 1596
105 Ga0373936_0117181 3300035113 Bacteria 1135
106 Ga0373941_0119832 3300035115 Bacteria 937
107 Ga0373953_0019353 3300035117 Bacteria 2531
108 Ga0373954_0124119 3300035118 Bacteria 1254
109 Ga0373954_0331432 3300035118 Bacteria 751
110 Ga0373955_0142515 3300035172 Bacteria 1406
111 Ga0373961_0130609 3300035241 Bacteria 841
112 Ga0373931_0183996 3300035691 Bacteria 1239
113 Ga0373931_0476807 3300035691 Bacteria 801
114 Ga0373931_1166323 3300035691 Bacteria 526
115 Ga0373935_0538634 3300035692 Bacteria 850
116 Ga0373935_1041655 3300035692 Bacteria 608
117 Ga0373933_0005126 3300035724 Bacteria 7147
118 Ga0373933_0549888 3300035724 Bacteria 757
119 Ga0373947_0264093 3300035725 Bacteria 1141
120 Ga0373937_0010933 3300036401 Bacteria 7948
121 Ga0373937_0165556 3300036401 Bacteria 2073
122 Ga0395899_0176378 3300037312 Bacteria 1502
123 Ga0395900_0373327 3300037418 Bacteria 1395
124 Ga0395898_0003055 3300037466 Bacteria 18965
125 Ga0395898_1303015 3300037466 Bacteria 656
126 Ga0395905_0672089 3300037471 Bacteria 938
127 Ga0436364_0268578 3300037853 Bacteria 6831
128 Ga0436364_0323530 3300037853 Bacteria 702
129 Ga0436364_0391522 3300037853 Bacteria 31054
130 Ga0436364_0554982 3300037853 Bacteria 6536
131 Ga0436364_0583185 3300037853 Bacteria 6612
132 Ga0436364_0614422 3300037853 Bacteria 1580
133 Ga0436364_0711989 3300037853 Bacteria 625
134 Ga0436364_0880563 3300037853 Bacteria 743
135 Ga0436364_1004827 3300037853 Bacteria 2040
136 Ga0436364_1041531 3300037853 Bacteria 2655
137 Ga0436364_1376445 3300037853 Bacteria 646
138 Ga0436364_1397222 3300037853 Bacteria 505
139 Ga0436364_1477214 3300037853 Bacteria 6731
140 Ga0436364_1532933 3300037853 Bacteria 1984
141 Ga0395901_0269676 3300038443 Bacteria 1770
142 Ga0395901_1192330 3300038443 Bacteria 728
143 Ga0436365_0654572 3300039437 Bacteria 912
144 Ga0436365_0880647 3300039437 Bacteria 2551
145 Ga0436365_0902520 3300039437 Bacteria 661
146 Ga0436365_0908393 3300039437 Bacteria 1260
147 Ga0436365_1187830 3300039437 Bacteria 2285
148 Ga0436365_1270371 3300039437 Bacteria 1094
149 Ga0436365_1466178 3300039437 Bacteria 1066
150 Ga0436365_1674823 3300039437 Bacteria 1020
151 Ga0436365_1901960 3300039437 Bacteria 1264
152 Ga0436360_0043361 3300039438 Bacteria 506
153 Ga0436360_0085659 3300039438 Bacteria 547
154 Ga0436360_0097515 3300039438 Bacteria 2295
155 Ga0436360_0385669 3300039438 Bacteria 3946
156 Ga0436360_0923015 3300039438 Bacteria 4679
157 Ga0436360_1229176 3300039438 Bacteria 14016
158 Ga0436361_0029744 3300039447 Bacteria 872
159 Ga0436361_0183398 3300039447 Bacteria 1712
160 Ga0436361_0217399 3300039447 Bacteria 4375
161 Ga0436361_0286998 3300039447 Bacteria 895
162 Ga0436361_0613994 3300039447 Bacteria 1700
163 Ga0436361_0798781 3300039447 Bacteria 773
164 Ga0436361_1055966 3300039447 Bacteria 3338
165 Ga0436361_1169910 3300039447 Bacteria 727
166 Ga0436363_0123286 3300039450 Bacteria 1019
167 Ga0436363_0837239 3300039450 Bacteria 1824
168 Ga0436363_0845311 3300039450 Bacteria 653
169 Ga0436363_0861520 3300039450 Bacteria 2404
170 Ga0436363_0982058 3300039450 Bacteria 805
171 Ga0436363_1129608 3300039450 Bacteria 1054
172 Ga0436362_0007213 3300039453 Bacteria 2515
173 Ga0436362_0142063 3300039453 Bacteria 1044
174 Ga0436362_0345891 3300039453 Bacteria 2458
175 Ga0436362_0735607 3300039453 Bacteria 766
176 Ga0436362_0832964 3300039453 Bacteria 2955
177 Ga0436362_0948364 3300039453 Bacteria 1030
178 Ga0466966_0011142 3300044684 Bacteria 5966
179 Ga0466963_0066798 3300044694 Bacteria 2413
180 Ga0466960_0661823 3300044901 Bacteria 624
181 Ga0466958_0121648 3300045836 Bacteria 1634
182 Ga0466967_1510463 3300045976 Bacteria 669
183 Ga0495580_0364349 3300046472 Bacteria 978
184 Ga0495664_0417649 3300046477 Bacteria 805
185 Ga0495608_0831612 3300046511 Bacteria 544
186 Ga0495652_0604934 3300046529 Bacteria 747
187 Ga0495667_0292370 3300046559 Bacteria 1033
188 Ga0495667_0982326 3300046559 Bacteria 515
189 Ga0495623_0620982 3300046679 Bacteria 560
190 Ga0495604_0821783 3300047317 Bacteria 584
191 Ga0495680_0564638 3300047322 Bacteria 765
192 Ga0495602_0383587 3300048088 Bacteria 1006
193 Ga0496109_1642900 3300048912 Bacteria 577
194 Ga0496112_0869364 3300048915 Bacteria 824
195 Ga0496126_1104556 3300048929 Bacteria 589
196 Ga0501034_0099673 3300049571 Bacteria 2900
197 Ga0501034_0307949 3300049571 Bacteria 1519
198 Ga0501038_0241573 3300049574 Bacteria 1434
199 Ga0501046_0357131 3300049580 Bacteria 1060
200 Ga0501047_0002319 3300049581 Bacteria 18206
201 Ga0501047_0581501 3300049581 Bacteria 943
202 Ga0501048_0326572 3300049582 Bacteria 1093
203 Ga0501069_0459487 3300049585 Bacteria 757
204 Ga0501070_0039565 3300049586 Bacteria 3933
205 Ga0501070_0108827 3300049586 Bacteria 2290
206 Ga0501072_0156964 3300049588 Bacteria 1814
207 Ga0501073_1021079 3300049589 Bacteria 569
208 Ga0501080_0201688 3300049742 Bacteria 1826
209 Ga0501083_0875752 3300049744 Bacteria 584
210 nmdc:mga03683_286202_c1 3300050489 Bacteria 771
211 nmdc:mga06r32_2050142_c1 3300050510 Bacteria 505
212 nmdc:mga0n895_631491_c1 3300050512 Bacteria 1071
213 nmdc:mga08x19_48189_c1 3300050514 Bacteria 2729
214 Ga0495601_0691198 3300053077 Bacteria 651
215 Ga0495595_0131944 3300053084 Bacteria 1222
216 Ga0495619_0101015 3300053085 Bacteria 1963
217 Ga0500642_0030817 3300053130 Bacteria 2235
218 Ga0500568_0020361 3300053139 Bacteria 2870
219 Ga0500600_0062575 3300053149 Bacteria 2069
220 Ga0500616_0306395 3300053153 Bacteria 658
221 Ga0500637_0001391 3300053178 Bacteria 10285
222 Ga0500576_205408 3300053725 Bacteria 664
223 Ga0501084_0205343 3300054114 Bacteria 1663
224 Ga0501082_0073164 3300060353 Bacteria 2952
225 Ga0501082_0748387 3300060353 Bacteria 855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221591 2643963613 133
2 iso_pu_bacteria 8048746797 8048749960 133
3 iso_pu_bacteria 641228493 641337355 134
4 iso_pu_bacteria 643348555 643392481 134
5 3300035691 Ga0373931_0476807 Ga0373931_0476807_350_763 135
6 3300005543 Ga0070672_100764305 Ga0070672_1007643052 137
7 3300005616 Ga0068852_101840366 Ga0068852_1018403661 137
8 3300005718 Ga0068866_10527483 Ga0068866_105274833 137
9 3300006847 Ga0075431_101207183 Ga0075431_1012071832 137
10 3300006871 Ga0075434_100463708 Ga0075434_1004637082 137
11 3300006914 Ga0075436_100051091 Ga0075436_1000510912 137
12 3300009176 Ga0105242_11177974 Ga0105242_111779742 137
13 3300025942 Ga0207689_11262351 Ga0207689_112623511 137
14 3300031456 Ga0307513_10832790 Ga0307513_108327902 137
15 3300037466 Ga0395898_1303015 Ga0395898_1303015_76_489 137
16 3300037471 Ga0395905_0672089 Ga0395905_0672089_465_878 137
17 3300038443 Ga0395901_1192330 Ga0395901_1192330_145_558 137
18 3300039437 Ga0436365_1466178 Ga0436365_1466178_538_951 137
19 3300044901 Ga0466960_0661823 Ga0466960_0661823_195_608 137
20 3300048912 Ga0496109_1642900 Ga0496109_1642900_48_461 137
21 3300048915 Ga0496112_0869364 Ga0496112_0869364_71_484 137
22 3300049571 Ga0501034_0099673 Ga0501034_0099673_1717_2130 137
23 3300049588 Ga0501072_0156964 Ga0501072_0156964_149_562 137
24 3300049589 Ga0501073_1021079 Ga0501073_1021079_62_475 137
25 3300049742 Ga0501080_0201688 Ga0501080_0201688_566_979 137
26 3300049744 Ga0501083_0875752 Ga0501083_0875752_131_544 137
27 3300050510 nmdc:mga06r32_2050142_c1 nmdc:mga06r32_2050142_c1_25_438 137
28 3300050512 nmdc:mga0n895_631491_c1 nmdc:mga0n895_631491_c1_336_749 137
29 3300050514 nmdc:mga08x19_48189_c1 nmdc:mga08x19_48189_c1_2051_2464 137
30 3300053139 Ga0500568_0020361 Ga0500568_0020361_965_1378 137
31 3300053149 Ga0500600_0062575 Ga0500600_0062575_189_605 137
32 3300053153 Ga0500616_0306395 Ga0500616_0306395_30_443 137
33 3300053178 Ga0500637_0001391 Ga0500637_0001391_7595_8011 137
34 3300060353 Ga0501082_0748387 Ga0501082_0748387_387_800 137
35 3300005843 Ga0068860_101745661 Ga0068860_1017456611 138
36 3300006028 Ga0070717_10625478 Ga0070717_106254783 138
37 3300009177 Ga0105248_10723019 Ga0105248_107230191 138
38 3300009553 Ga0105249_11979895 Ga0105249_119798951 138
39 3300010375 Ga0105239_11293531 Ga0105239_112935313 138
40 3300014326 Ga0157380_10310935 Ga0157380_103109352 138
41 3300014497 Ga0182008_10805331 Ga0182008_108053311 138
42 3300021358 Ga0213873_10048776 Ga0213873_100487762 138
43 3300021361 Ga0213872_10011303 Ga0213872_100113035 138
44 3300021361 Ga0213872_10012804 Ga0213872_100128041 138
45 3300021384 Ga0213876_10167820 Ga0213876_101678202 138
46 3300021384 Ga0213876_10400409 Ga0213876_104004092 138
47 3300021388 Ga0213875_10013683 Ga0213875_100136839 138
48 3300021388 Ga0213875_10109711 Ga0213875_101097113 138
49 3300021388 Ga0213875_10114841 Ga0213875_101148412 138
50 3300021388 Ga0213875_10123195 Ga0213875_101231951 138
51 3300021388 Ga0213875_10203843 Ga0213875_102038433 138
52 3300021441 Ga0213871_10021467 Ga0213871_100214672 138
53 3300021441 Ga0213871_10154173 Ga0213871_101541732 138
54 3300025913 Ga0207695_10255478 Ga0207695_102554783 138
55 3300035118 Ga0373954_0331432 Ga0373954_0331432_314_730 138
56 3300035724 Ga0373933_0549888 Ga0373933_0549888_226_642 138
57 3300036401 Ga0373937_0165556 Ga0373937_0165556_1606_2022 138
58 3300037853 Ga0436364_0268578 Ga0436364_0268578_32_448 138
59 3300037853 Ga0436364_0554982 Ga0436364_0554982_2873_3289 138
60 3300037853 Ga0436364_0583185 Ga0436364_0583185_3402_3818 138
61 3300037853 Ga0436364_0711989 Ga0436364_0711989_134_550 138
62 3300037853 Ga0436364_1004827 Ga0436364_1004827_76_492 138
63 3300037853 Ga0436364_1041531 Ga0436364_1041531_1878_2294 138
64 3300037853 Ga0436364_1397222 Ga0436364_1397222_35_451 138
65 3300039437 Ga0436365_0654572 Ga0436365_0654572_101_517 138
66 3300039437 Ga0436365_0908393 Ga0436365_0908393_246_662 138
67 3300039437 Ga0436365_1187830 Ga0436365_1187830_15_431 138
68 3300039437 Ga0436365_1901960 Ga0436365_1901960_577_993 138
69 3300039438 Ga0436360_0085659 Ga0436360_0085659_57_473 138
70 3300039438 Ga0436360_0097515 Ga0436360_0097515_1241_1660 138
71 3300039438 Ga0436360_1229176 Ga0436360_1229176_845_1261 138
72 3300039447 Ga0436361_0217399 Ga0436361_0217399_314_733 138
73 3300039450 Ga0436363_0861520 Ga0436363_0861520_961_1377 138
74 3300039453 Ga0436362_0345891 Ga0436362_0345891_969_1385 138
75 3300044684 Ga0466966_0011142 Ga0466966_0011142_1317_1736 138
76 3300044694 Ga0466963_0066798 Ga0466963_0066798_416_835 138
77 3300045836 Ga0466958_0121648 Ga0466958_0121648_400_819 138
78 3300046477 Ga0495664_0417649 Ga0495664_0417649_249_665 138
79 3300046529 Ga0495652_0604934 Ga0495652_0604934_45_461 138
80 3300048088 Ga0495602_0383587 Ga0495602_0383587_26_442 138
81 3300048929 Ga0496126_1104556 Ga0496126_1104556_70_486 138
82 3300053130 Ga0500642_0030817 Ga0500642_0030817_840_1256 138
83 3300005435 Ga0070714_100016218 Ga0070714_1000162185 139
84 3300006177 Ga0075362_10259021 Ga0075362_102590212 139
85 3300006195 Ga0075366_10491322 Ga0075366_104913222 139
86 3300025929 Ga0207664_10012040 Ga0207664_1001204010 139
87 3300025941 Ga0207711_10140909 Ga0207711_101409091 139
88 3300035112 Ga0373932_0025691 Ga0373932_0025691_627_1046 139
89 3300035115 Ga0373941_0119832 Ga0373941_0119832_360_779 139
90 3300037312 Ga0395899_0176378 Ga0395899_0176378_810_1229 139
91 3300037418 Ga0395900_0373327 Ga0395900_0373327_185_604 139
92 3300037466 Ga0395898_0003055 Ga0395898_0003055_17740_18159 139
93 3300038443 Ga0395901_0269676 Ga0395901_0269676_810_1229 139
94 3300039437 Ga0436365_0880647 Ga0436365_0880647_170_589 139
95 3300049571 Ga0501034_0307949 Ga0501034_0307949_532_951 139
96 3300049574 Ga0501038_0241573 Ga0501038_0241573_749_1168 139
97 3300049580 Ga0501046_0357131 Ga0501046_0357131_506_925 139
98 3300049581 Ga0501047_0002319 Ga0501047_0002319_12822_13241 139
99 3300049581 Ga0501047_0581501 Ga0501047_0581501_368_787 139
100 3300049582 Ga0501048_0326572 Ga0501048_0326572_474_893 139
101 3300049585 Ga0501069_0459487 Ga0501069_0459487_297_716 139
102 3300049586 Ga0501070_0108827 Ga0501070_0108827_649_1068 139
103 3300050489 nmdc:mga03683_286202_c1 nmdc:mga03683_286202_c1_216_635 139
104 3300005434 Ga0070709_10009375 Ga0070709_1000937511 140
105 3300005434 Ga0070709_10205854 Ga0070709_102058543 140
106 3300005435 Ga0070714_100004105 Ga0070714_10000410518 140
107 3300005435 Ga0070714_100357531 Ga0070714_1003575314 140
108 3300005436 Ga0070713_100009715 Ga0070713_10000971514 140
109 3300005436 Ga0070713_100692519 Ga0070713_1006925192 140
110 3300005437 Ga0070710_10027030 Ga0070710_100270305 140
111 3300005437 Ga0070710_10290004 Ga0070710_102900043 140
112 3300005437 Ga0070710_10959276 Ga0070710_109592761 140
113 3300005439 Ga0070711_100094383 Ga0070711_1000943834 140
114 3300005467 Ga0070706_100181318 Ga0070706_1001813182 140
115 3300005471 Ga0070698_100039432 Ga0070698_10003943211 140
116 3300005471 Ga0070698_100492142 Ga0070698_1004921422 140
117 3300005518 Ga0070699_100212152 Ga0070699_1002121525 140
118 3300006028 Ga0070717_10003780 Ga0070717_1000378010 140
119 3300006028 Ga0070717_10372302 Ga0070717_103723022 140
120 3300006173 Ga0070716_100438000 Ga0070716_1004380003 140
121 3300006175 Ga0070712_100018095 Ga0070712_1000180959 140
122 3300006175 Ga0070712_100823226 Ga0070712_1008232262 140
123 3300006175 Ga0070712_101253348 Ga0070712_1012533482 140
124 3300006846 Ga0075430_100551041 Ga0075430_1005510411 140
125 3300007265 Ga0099794_10536329 Ga0099794_105363291 140
126 3300007788 Ga0099795_10028110 Ga0099795_100281104 140
127 3300007788 Ga0099795_10127017 Ga0099795_101270173 140
128 3300010159 Ga0099796_10010062 Ga0099796_100100625 140
129 3300019182 Ga0184598_133872 Ga0184598_1338722 140
130 3300021377 Ga0213874_10004526 Ga0213874_100045263 140
131 3300021441 Ga0213871_10001349 Ga0213871_100013499 140
132 3300023672 Ga0247553_100116 Ga0247553_1001165 140
133 3300024227 Ga0228598_1031083 Ga0228598_10310832 140
134 3300025898 Ga0207692_10004608 Ga0207692_1000460811 140
135 3300025898 Ga0207692_10077761 Ga0207692_100777612 140
136 3300025905 Ga0207685_10073364 Ga0207685_100733642 140
137 3300025906 Ga0207699_10135603 Ga0207699_101356032 140
138 3300025906 Ga0207699_10233145 Ga0207699_102331453 140
139 3300025910 Ga0207684_10082801 Ga0207684_100828012 140
140 3300025915 Ga0207693_10008823 Ga0207693_1000882315 140
141 3300025915 Ga0207693_10021027 Ga0207693_100210279 140
142 3300025916 Ga0207663_10355653 Ga0207663_103556532 140
143 3300025916 Ga0207663_10377461 Ga0207663_103774613 140
144 3300025928 Ga0207700_10017186 Ga0207700_1001718611 140
145 3300025928 Ga0207700_10897648 Ga0207700_108976482 140
146 3300025929 Ga0207664_10190811 Ga0207664_101908112 140
147 3300025929 Ga0207664_10648045 Ga0207664_106480452 140
148 3300025929 Ga0207664_10960123 Ga0207664_109601232 140
149 3300025939 Ga0207665_11066227 Ga0207665_110662271 140
150 3300027512 Ga0209179_1020440 Ga0209179_10204403 140
151 3300035241 Ga0373961_0130609 Ga0373961_0130609_379_801 140
152 3300035691 Ga0373931_0183996 Ga0373931_0183996_110_532 140
153 3300035691 Ga0373931_1166323 Ga0373931_1166323_35_496 140
154 3300037853 Ga0436364_0880563 Ga0436364_0880563_152_574 140
155 3300039438 Ga0436360_0385669 Ga0436360_0385669_2583_3005 140
156 3300039438 Ga0436360_0923015 Ga0436360_0923015_3898_4320 140
157 3300039447 Ga0436361_0286998 Ga0436361_0286998_155_577 140
158 3300039447 Ga0436361_1169910 Ga0436361_1169910_199_621 140
159 3300039450 Ga0436363_0123286 Ga0436363_0123286_115_537 140
160 3300039450 Ga0436363_0837239 Ga0436363_0837239_90_512 140
161 3300039453 Ga0436362_0007213 Ga0436362_0007213_748_1170 140
162 3300039453 Ga0436362_0832964 Ga0436362_0832964_2062_2484 140
163 3300005355 Ga0070671_100026292 Ga0070671_1000262922 141
164 3300005364 Ga0070673_100448145 Ga0070673_1004481453 141
165 3300005436 Ga0070713_101238061 Ga0070713_1012380612 141
166 3300006028 Ga0070717_10520824 Ga0070717_105208243 141
167 3300006173 Ga0070716_100440956 Ga0070716_1004409562 141
168 3300006175 Ga0070712_100096219 Ga0070712_1000962194 141
169 3300006871 Ga0075434_101432332 Ga0075434_1014323321 141
170 3300009147 Ga0114129_11510716 Ga0114129_115107162 141
171 3300009176 Ga0105242_12290064 Ga0105242_122900641 141
172 3300013296 Ga0157374_10709297 Ga0157374_107092973 141
173 3300021358 Ga0213873_10059466 Ga0213873_100594662 141
174 3300021361 Ga0213872_10298838 Ga0213872_102988382 141
175 3300021384 Ga0213876_10668482 Ga0213876_106684822 141
176 3300021388 Ga0213875_10000189 Ga0213875_1000018969 141
177 3300025906 Ga0207699_10409908 Ga0207699_104099082 141
178 3300025915 Ga0207693_10124956 Ga0207693_101249562 141
179 3300025926 Ga0207659_10279184 Ga0207659_102791844 141
180 3300025928 Ga0207700_11480490 Ga0207700_114804902 141
181 3300025931 Ga0207644_10520722 Ga0207644_105207222 141
182 3300025939 Ga0207665_10129885 Ga0207665_101298853 141
183 3300025960 Ga0207651_10572535 Ga0207651_105725352 141
184 3300031251 Ga0265327_10009609 Ga0265327_100096097 141
185 3300035113 Ga0373936_0117181 Ga0373936_0117181_48_473 141
186 3300035117 Ga0373953_0019353 Ga0373953_0019353_1514_1939 141
187 3300035118 Ga0373954_0124119 Ga0373954_0124119_227_652 141
188 3300035172 Ga0373955_0142515 Ga0373955_0142515_968_1393 141
189 3300035692 Ga0373935_0538634 Ga0373935_0538634_189_614 141
190 3300035692 Ga0373935_1041655 Ga0373935_1041655_22_447 141
191 3300035724 Ga0373933_0005126 Ga0373933_0005126_5293_5718 141
192 3300035725 Ga0373947_0264093 Ga0373947_0264093_322_747 141
193 3300036401 Ga0373937_0010933 Ga0373937_0010933_5284_5709 141
194 3300037853 Ga0436364_0323530 Ga0436364_0323530_152_577 141
195 3300037853 Ga0436364_0391522 Ga0436364_0391522_4750_5175 141
196 3300037853 Ga0436364_0614422 Ga0436364_0614422_561_986 141
197 3300037853 Ga0436364_1376445 Ga0436364_1376445_38_463 141
198 3300037853 Ga0436364_1477214 Ga0436364_1477214_5434_5859 141
199 3300037853 Ga0436364_1532933 Ga0436364_1532933_1493_1918 141
200 3300039437 Ga0436365_0902520 Ga0436365_0902520_215_640 141
201 3300039437 Ga0436365_1270371 Ga0436365_1270371_336_761 141
202 3300039437 Ga0436365_1674823 Ga0436365_1674823_20_445 141
203 3300039438 Ga0436360_0043361 Ga0436360_0043361_36_461 141
204 3300039447 Ga0436361_0029744 Ga0436361_0029744_326_751 141
205 3300039447 Ga0436361_0183398 Ga0436361_0183398_1029_1454 141
206 3300039447 Ga0436361_0613994 Ga0436361_0613994_841_1266 141
207 3300039447 Ga0436361_0798781 Ga0436361_0798781_301_726 141
208 3300039447 Ga0436361_1055966 Ga0436361_1055966_2772_3197 141
209 3300039450 Ga0436363_0845311 Ga0436363_0845311_31_456 141
210 3300039450 Ga0436363_0982058 Ga0436363_0982058_225_650 141
211 3300039450 Ga0436363_1129608 Ga0436363_1129608_115_540 141
212 3300039453 Ga0436362_0142063 Ga0436362_0142063_427_852 141
213 3300039453 Ga0436362_0735607 Ga0436362_0735607_221_646 141
214 3300039453 Ga0436362_0948364 Ga0436362_0948364_316_741 141
215 3300045976 Ga0466967_1510463 Ga0466967_1510463_97_522 141
216 3300046472 Ga0495580_0364349 Ga0495580_0364349_154_579 141
217 3300046511 Ga0495608_0831612 Ga0495608_0831612_72_497 141
218 3300046559 Ga0495667_0292370 Ga0495667_0292370_116_541 141
219 3300046559 Ga0495667_0982326 Ga0495667_0982326_20_445 141
220 3300046679 Ga0495623_0620982 Ga0495623_0620982_36_461 141
221 3300047317 Ga0495604_0821783 Ga0495604_0821783_17_442 141
222 3300047322 Ga0495680_0564638 Ga0495680_0564638_108_533 141
223 3300049586 Ga0501070_0039565 Ga0501070_0039565_413_838 141
224 3300053077 Ga0495601_0691198 Ga0495601_0691198_167_592 141
225 3300053084 Ga0495595_0131944 Ga0495595_0131944_758_1183 141
226 3300053085 Ga0495619_0101015 Ga0495619_0101015_388_813 141
227 3300053725 Ga0500576_205408 Ga0500576_205408_173_598 141
228 3300054114 Ga0501084_0205343 Ga0501084_0205343_663_1088 141
229 3300060353 Ga0501082_0073164 Ga0501082_0073164_491_916 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

4

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lqm-assembly1.cif.gz_J cryo-em structure of a pre-60s ribosomal subunit - state c 0.8321 32 132
7f5s-assembly1.cif.gz_LI human delta-mettl18 60s ribosome 0.8286 32 133
7xny-assembly1.cif.gz_LI high resolution cry-em structure of the human 80s ribosome from snord127+/- kasumi-1 cells 0.8269 32 132
6frk-assembly1.cif.gz_I structure of a prehandover mammalian ribosomal srp and srp receptor targeting complex 0.8257 32 132
7cpu-assembly1.cif.gz_LI cryo-em structure of 80s ribosome from mouse kidney 0.8249 32 132
ID Description Score Start End Superfamily
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8659 23 137 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.858 23 137 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8448 27 137 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8027 27 137 3.90.1170.10
2pa2B00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.797 32 132 3.90.1170.10
ID Description Score Start End GO Terms
AF-A0A0H4T321-F1-model_v4 50S ribosomal protein L16 0.8657 29 135 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A0G1YXY5-F1-model_v4 50S ribosomal protein L16 0.8649 27 135 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-W4TLS0-F1-model_v4 deleted 0.8649 27 133
AF-A0A4D6Q3F3-F1-model_v4 50S ribosomal protein L16, chloroplastic 0.8635 32 135 GO:0003735
GO:0005762
GO:0009507
GO:0019843
GO:0032543
AF-A0A1Q6VHX4-F1-model_v4 50S ribosomal protein L16 0.8632 30 137 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
73.3 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map