F332178

General Info

Members Datasets Scaffolds Average Seq Length
220 181 209 163

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10086174|Ga0105245_100861744
Length 180
Sequence VAPSFVYIVHNQIMHDETASLFDLSYTDNHGSTVPMASYAGRPLLIVNTASECGFTPQYEGLERIHEAYADAGLVVIGFPCDQFGHQEPGDDTEIEEFCRANYGVAFPLSTKIDVNGRDTHPVFAFLKERAGGRLGSAIKWNFTKFLVSADGRTVKRYSPSTKPEAIRRDIEALLPATVR

Samples

Sample ID Description Type Environment
1 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
2 2932401849 Devosia sp. 2618 Isolate Rhizosphere
3 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
4 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
5 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
6 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
7 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
8 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
9 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
181 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.09
Metatranscriptomes 0.91
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0.91
Bulb 0
Endosphere 8.64
Nodule 0.91
Rhizoplane 3.18
Rhizosphere 76.36
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10046734 3300001979 Bacteria 1269
2 JGI24739J22299_10045345 3300001989 Bacteria 1443
3 JGI24737J22298_10014705 3300001990 Bacteria 2539
4 JGI24735J21928_10034184 3300002067 Bacteria 1500
5 JGI24738J21930_10018334 3300002075 Bacteria 1463
6 Ga0055526_1000263 3300003771 Bacteria 44141
7 Ga0055526_1000566 3300003771 Bacteria 29170
8 Ga0055537_1000377 3300003773 Bacteria 30013
9 Ga0055524_1007427 3300003775 Bacteria 4652
10 Ga0055534_1000026 3300003784 Bacteria 130908
11 Ga0055528_1001324 3300003790 Bacteria 15474
12 Ga0055530_10050385 3300003791 Bacteria 970
13 Ga0055531_10046595 3300003794 Bacteria 1189
14 Ga0058692_1000012 3300003856 Bacteria 318930
15 Ga0058860_12021148 3300004801 Bacteria 1097
16 Ga0065704_10141502 3300005289 Bacteria 1513
17 Ga0070682_100119820 3300005337 Bacteria 1765
18 Ga0068868_100669735 3300005338 Bacteria 926
19 Ga0070689_100154515 3300005340 Bacteria 1852
20 Ga0070668_100063865 3300005347 Bacteria 2854
21 Ga0070669_100317072 3300005353 Bacteria 1258
22 Ga0070667_101245119 3300005367 Bacteria 697
23 Ga0070700_100163908 3300005441 Bacteria 1533
24 Ga0070678_100476901 3300005456 Bacteria 1097
25 Ga0068867_100590405 3300005459 Bacteria 967
26 Ga0068867_101145008 3300005459 Bacteria 712
27 Ga0070693_100026754 3300005547 Bacteria 3117
28 Ga0070665_100117901 3300005548 Bacteria 2657
29 Ga0070665_100287934 3300005548 Bacteria 1645
30 Ga0070665_100472248 3300005548 Bacteria 1265
31 Ga0068857_100120596 3300005577 Bacteria 2361
32 Ga0068857_100555655 3300005577 Bacteria 1082
33 Ga0068859_100054657 3300005617 Bacteria 4016
34 Ga0068866_10476778 3300005718 Bacteria 821
35 Ga0068861_100605930 3300005719 Bacteria 1006
36 Ga0068851_10114339 3300005834 Bacteria 1444
37 Ga0068860_100086592 3300005843 Bacteria 2982
38 Ga0068860_100852546 3300005843 Bacteria 926
39 Ga0068862_100135646 3300005844 Bacteria 2181
40 Ga0081538_10149861 3300005981 Bacteria 1058
41 Ga0081540_1090708 3300005983 Bacteria 1345
42 Ga0075364_10108860 3300006051 Bacteria 1848
43 Ga0075428_100264423 3300006844 Bacteria 1852
44 Ga0075430_100754692 3300006846 Bacteria 802
45 Ga0097620_100054659 3300006931 Bacteria 4016
46 Ga0079104_1025036 3300006946 Bacteria 1564
47 Ga0105251_10002088 3300009011 Bacteria 16143
48 Ga0105240_10036674 3300009093 Bacteria 6305
49 Ga0111539_10095068 3300009094 Bacteria 3501
50 Ga0105245_10086174 3300009098 Bacteria 2880
51 Ga0105245_12448786 3300009098 Bacteria 575
52 Ga0105247_10022198 3300009101 Bacteria 3821
53 Ga0114129_10284514 3300009147 Bacteria 2208
54 Ga0105241_10907441 3300009174 Bacteria 819
55 Ga0105248_10953622 3300009177 Bacteria 969
56 Ga0105237_10547582 3300009545 Bacteria 1164
57 Ga0105237_10928161 3300009545 Bacteria 877
58 Ga0105237_11422205 3300009545 Bacteria 700
59 Ga0105238_10527017 3300009551 Bacteria 1184
60 Ga0105249_10288954 3300009553 Bacteria 1640
61 Ga0105249_10371219 3300009553 Bacteria 1454
62 Ga0105249_11170871 3300009553 Bacteria 840
63 Ga0105249_11556967 3300009553 Bacteria 733
64 Ga0105239_10203508 3300010375 Bacteria 2218
65 Ga0105239_10316529 3300010375 Bacteria 1759
66 Ga0105239_10598871 3300010375 Bacteria 1257
67 Ga0105246_10044219 3300011119 Bacteria 3026
68 Ga0105246_10326752 3300011119 Bacteria 1249
69 Ga0157373_10270859 3300013100 Bacteria 1202
70 Ga0157371_10010744 3300013102 Bacteria 7110
71 Ga0157371_10090012 3300013102 Bacteria 2174
72 Ga0157370_10232998 3300013104 Bacteria 1704
73 Ga0157370_11499081 3300013104 Bacteria 606
74 Ga0157369_10946468 3300013105 Bacteria 883
75 Ga0157378_10563240 3300013297 Bacteria 1146
76 Ga0163162_10122369 3300013306 Bacteria 2707
77 Ga0163162_10253229 3300013306 Bacteria 1892
78 Ga0157372_10586902 3300013307 Bacteria 1299
79 Ga0157372_10993752 3300013307 Bacteria 972
80 Ga0163163_10244109 3300014325 Bacteria 1846
81 Ga0163163_10727360 3300014325 Bacteria 1056
82 Ga0182008_10269344 3300014497 Bacteria 883
83 Ga0182006_1105266 3300015261 Bacteria 996
84 Ga0182007_10033119 3300015262 Bacteria 1752
85 Ga0163161_10118987 3300017792 Bacteria 1983
86 Ga0163161_10480140 3300017792 Bacteria 1009
87 Ga0163161_10505443 3300017792 Bacteria 985
88 Ga0224712_10245481 3300022467 Bacteria 826
89 Ga0209565_1000022 3300025263 Bacteria 390888
90 Ga0209673_1000110 3300025273 Bacteria 181173
91 Ga0209675_1000060 3300025291 Bacteria 184316
92 Ga0209564_1000304 3300025295 Bacteria 97304
93 Ga0209050_1057897 3300025298 Bacteria 934
94 Ga0209256_1018250 3300025299 Bacteria 2291
95 Ga0209256_1079539 3300025299 Bacteria 719
96 Ga0209257_1016753 3300025304 Bacteria 2940
97 Ga0207713_1012187 3300025735 Bacteria 4620
98 Ga0207710_10033346 3300025900 Bacteria 2258
99 Ga0207647_10053467 3300025904 Bacteria 2489
100 Ga0207695_10065084 3300025913 Bacteria 3749
101 Ga0207671_10541664 3300025914 Bacteria 928
102 Ga0207681_10253101 3300025923 Bacteria 1376
103 Ga0207650_11093034 3300025925 Bacteria 679
104 Ga0207706_10338247 3300025933 Bacteria 1309
105 Ga0207670_10109111 3300025936 Bacteria 1991
106 Ga0207679_10785512 3300025945 Bacteria 867
107 Ga0207668_10087041 3300025972 Bacteria 2284
108 Ga0207668_10491355 3300025972 Bacteria 1054
109 Ga0207658_11021377 3300025986 Bacteria 754
110 Ga0207708_10107242 3300026075 Bacteria 2166
111 Ga0207674_10142845 3300026116 Bacteria 2353
112 Ga0207674_10824353 3300026116 Bacteria 895
113 Ga0207675_100660154 3300026118 Bacteria 1052
114 Ga0207683_10612341 3300026121 Bacteria 1008
115 Ga0207698_10567118 3300026142 Bacteria 1115
116 Ga0207698_11595193 3300026142 Bacteria 668
117 Ga0209281_1015934 3300027111 Bacteria 1556
118 Ga0209371_1000007 3300027312 Bacteria 1050654
119 Ga0207428_10266844 3300027907 Bacteria 1274
120 Ga0268266_10054182 3300028379 Bacteria 3447
121 Ga0268266_10326135 3300028379 Bacteria 1438
122 Ga0268265_11061145 3300028380 Bacteria 803
123 Ga0268264_10119164 3300028381 Bacteria 2324
124 Ga0268264_10675040 3300028381 Bacteria 1024
125 Ga0268256_1000008 3300030500 Bacteria 1050654
126 Ga0307512_10096951 3300030522 Bacteria 2020
127 Ga0265330_10017012 3300031235 Bacteria 3352
128 Ga0265332_10034152 3300031238 Bacteria 2211
129 Ga0265329_10014964 3300031242 Bacteria 2725
130 Ga0265340_10367944 3300031247 Bacteria 635
131 Ga0265316_10230015 3300031344 Bacteria 1366
132 Ga0265314_10001658 3300031711 Bacteria 24322
133 Ga0265342_10038093 3300031712 Bacteria 2930
134 Ga0307413_10001305 3300031824 Bacteria 9319
135 Ga0307413_11334650 3300031824 Bacteria 629
136 Ga0307406_11153230 3300031901 Bacteria 671
137 Ga0307409_101613585 3300031995 Bacteria 677
138 Ga0307416_100883272 3300032002 Bacteria 993
139 Ga0307414_10487846 3300032004 Bacteria 1088
140 Ga0307414_11627188 3300032004 Bacteria 602
141 Ga0307507_10573764 3300033179 Bacteria 589
142 Ga0395898_0279109 3300037466 Bacteria 1594
143 Ga0436360_0598563 3300039438 Bacteria 703
144 Ga0436360_1022894 3300039438 Bacteria 964
145 Ga0451807_2126778 3300041486 Bacteria 656
146 Ga0451839_1039681 3300041496 Bacteria 652
147 Ga0451853_2979566 3300041512 Bacteria 1078
148 Ga0451853_3280612 3300041512 Bacteria 1134
149 Ga0451577_0000001 3300042876 Bacteria 2461803
150 Ga0453683_0016733 3300044673 Bacteria 4727
151 Ga0466966_0215309 3300044684 Bacteria 1160
152 Ga0466961_0135543 3300044693 Bacteria 1542
153 Ga0466961_0139346 3300044693 Bacteria 1519
154 Ga0466963_0124659 3300044694 Bacteria 1775
155 Ga0453684_0000468 3300044712 Bacteria 160571
156 Ga0453684_2232000 3300044712 Bacteria 546
157 Ga0466971_0488381 3300044719 Bacteria 607
158 Ga0466968_0153822 3300044735 Bacteria 1058
159 Ga0466957_0013250 3300044842 Bacteria 4782
160 Ga0466957_0638153 3300044842 Bacteria 748
161 Ga0466959_0190067 3300045049 Bacteria 1433
162 Ga0451576_0000177 3300045051 Bacteria 160589
163 Ga0466958_0093729 3300045836 Bacteria 1860
164 Ga0495627_163239 3300046453 Bacteria 619
165 Ga0495638_0114674 3300046460 Bacteria 1597
166 Ga0495582_0085281 3300046473 Bacteria 1757
167 Ga0495610_0001273 3300046512 Bacteria 22579
168 Ga0495587_0714167 3300046536 Bacteria 549
169 Ga0495611_0371083 3300046648 Bacteria 656
170 Ga0495625_0141340 3300046660 Bacteria 1624
171 Ga0495658_0110725 3300046683 Bacteria 1651
172 Ga0495649_0227764 3300046694 Bacteria 963
173 Ga0495672_0075646 3300047320 Bacteria 1893
174 Ga0495672_0092224 3300047320 Bacteria 1661
175 Ga0495675_0760040 3300047444 Bacteria 539
176 Ga0496102_0196922 3300048905 Bacteria 1899
177 Ga0496104_0660568 3300048907 Bacteria 954
178 Ga0496105_0184926 3300048908 Bacteria 1705
179 Ga0496108_0982039 3300048911 Bacteria 722
180 Ga0496109_0402701 3300048912 Bacteria 1293
181 Ga0496110_0356940 3300048913 Bacteria 1332
182 Ga0496117_0201942 3300048920 Bacteria 1122
183 Ga0496117_0385603 3300048920 Bacteria 712
184 Ga0496118_0083795 3300048921 Bacteria 2227
185 Ga0496119_0001341 3300048922 Bacteria 30136
186 Ga0496120_0000523 3300048923 Bacteria 59431
187 Ga0496121_0238342 3300048924 Bacteria 1269
188 Ga0496123_0177912 3300048926 Bacteria 1114
189 Ga0496124_0103062 3300048927 Bacteria 2308
190 Ga0496125_0026109 3300048928 Bacteria 5333
191 Ga0496125_0059312 3300048928 Bacteria 3085
192 Ga0496126_0020626 3300048929 Bacteria 6455
193 Ga0496126_0538148 3300048929 Bacteria 929
194 Ga0495682_0283180 3300049460 Bacteria 585
195 Ga0501298_025355 3300049521 Bacteria 1135
196 Ga0501031_0033720 3300049568 Bacteria 3341
197 Ga0501033_0004786 3300049570 Bacteria 10807
198 Ga0501034_0254029 3300049571 Bacteria 1702
199 Ga0501047_0001209 3300049581 Bacteria 25621
200 Ga0501257_100907 3300049686 Bacteria 758
201 nmdc:mga00v17_624754_c1 3300050491 Bacteria 694
202 nmdc:mga05p37_71730_c1 3300050507 Bacteria 4261
203 nmdc:mga09592_982903_c1 3300050508 Bacteria 706
204 nmdc:mga0qj67_131725_c1 3300050509 Bacteria 2025
205 nmdc:mga06r32_1098591_c1 3300050510 Bacteria 744
206 nmdc:mga08y16_161806_c1 3300050511 Bacteria 2326
207 nmdc:mga0rr50_194927_c1 3300050513 Bacteria 1662
208 Ga0500646_0087445 3300053090 Bacteria 960
209 Ga0466962_0343665 3300061719 Bacteria 742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10371219 Ga0105249_103712192 135
2 3300004801 Ga0058860_12021148 Ga0058860_120211481 141
3 3300009545 Ga0105237_10547582 Ga0105237_105475823 144
4 3300025914 Ga0207671_10541664 Ga0207671_105416641 144
5 3300044712 Ga0453684_0000468 Ga0453684_0000468_1362_1823 152
6 3300045051 Ga0451576_0000177 Ga0451576_0000177_158767_159228 152
7 iso_pu_bacteria 2932401849 2932405164 154
8 iso_pu_bacteria 2939589442 2939590913 155
9 iso_pu_bacteria 2941475908 2941476455 155
10 iso_pu_bacteria 2974307012 2974308413 155
11 iso_pu_bacteria 2977247770 2977249169 155
12 iso_pu_bacteria 2984514374 2984516378 155
13 iso_pu_bacteria 8002869464 8002872264 156
14 3300044712 Ga0453684_2232000 Ga0453684_2232000_59_535 157
15 3300050509 nmdc:mga0qj67_131725_c1 nmdc:mga0qj67_131725_c1_1237_1710 157
16 3300005338 Ga0068868_100669735 Ga0068868_1006697352 158
17 3300005340 Ga0070689_100154515 Ga0070689_1001545152 158
18 3300005353 Ga0070669_100317072 Ga0070669_1003170723 158
19 3300005441 Ga0070700_100163908 Ga0070700_1001639082 158
20 3300005459 Ga0068867_101145008 Ga0068867_1011450081 158
21 3300005547 Ga0070693_100026754 Ga0070693_1000267543 158
22 3300005548 Ga0070665_100287934 Ga0070665_1002879342 158
23 3300005617 Ga0068859_100054657 Ga0068859_1000546574 158
24 3300005843 Ga0068860_100086592 Ga0068860_1000865922 158
25 3300005844 Ga0068862_100135646 Ga0068862_1001356462 158
26 3300006844 Ga0075428_100264423 Ga0075428_1002644232 158
27 3300006931 Ga0097620_100054659 Ga0097620_1000546594 158
28 3300006946 Ga0079104_1025036 Ga0079104_10250362 158
29 3300009094 Ga0111539_10095068 Ga0111539_100950684 158
30 3300009098 Ga0105245_12448786 Ga0105245_124487861 158
31 3300009101 Ga0105247_10022198 Ga0105247_100221983 158
32 3300009147 Ga0114129_10284514 Ga0114129_102845142 158
33 3300009177 Ga0105248_10953622 Ga0105248_109536222 158
34 3300010375 Ga0105239_10316529 Ga0105239_103165293 158
35 3300011119 Ga0105246_10044219 Ga0105246_100442193 158
36 3300013297 Ga0157378_10563240 Ga0157378_105632402 158
37 3300013306 Ga0163162_10122369 Ga0163162_101223693 158
38 3300014325 Ga0163163_10727360 Ga0163163_107273602 158
39 3300025900 Ga0207710_10033346 Ga0207710_100333462 158
40 3300025923 Ga0207681_10253101 Ga0207681_102531013 158
41 3300025925 Ga0207650_11093034 Ga0207650_110930341 158
42 3300025936 Ga0207670_10109111 Ga0207670_101091112 158
43 3300026075 Ga0207708_10107242 Ga0207708_101072424 158
44 3300026142 Ga0207698_11595193 Ga0207698_115951931 158
45 3300027111 Ga0209281_1015934 Ga0209281_10159342 158
46 3300027907 Ga0207428_10266844 Ga0207428_102668441 158
47 3300028380 Ga0268265_11061145 Ga0268265_110611452 158
48 3300028381 Ga0268264_10119164 Ga0268264_101191643 158
49 3300041512 Ga0451853_2979566 Ga0451853_2979566_93_581 158
50 3300041512 Ga0451853_3280612 Ga0451853_3280612_574_1062 158
51 3300046536 Ga0495587_0714167 Ga0495587_0714167_22_501 158
52 3300047444 Ga0495675_0760040 Ga0495675_0760040_31_510 158
53 3300049460 Ga0495682_0283180 Ga0495682_0283180_36_515 158
54 3300049521 Ga0501298_025355 Ga0501298_025355_615_1121 158
55 3300049581 Ga0501047_0001209 Ga0501047_0001209_4324_4803 158
56 3300049686 Ga0501257_100907 Ga0501257_100907_232_711 158
57 3300050507 nmdc:mga05p37_71730_c1 nmdc:mga05p37_71730_c1_3247_3726 158
58 3300050510 nmdc:mga06r32_1098591_c1 nmdc:mga06r32_1098591_c1_162_641 158
59 3300050511 nmdc:mga08y16_161806_c1 nmdc:mga08y16_161806_c1_541_1020 158
60 3300053090 Ga0500646_0087445 Ga0500646_0087445_277_756 158
61 iso_pu_bacteria 8021648035 8021651776 158
62 3300003771 Ga0055526_1000263 Ga0055526_100026338 159
63 3300003771 Ga0055526_1000566 Ga0055526_100056623 159
64 3300003773 Ga0055537_1000377 Ga0055537_100037726 159
65 3300003775 Ga0055524_1007427 Ga0055524_10074271 159
66 3300003784 Ga0055534_1000026 Ga0055534_100002691 159
67 3300003790 Ga0055528_1001324 Ga0055528_10013246 159
68 3300003791 Ga0055530_10050385 Ga0055530_100503852 159
69 3300003794 Ga0055531_10046595 Ga0055531_100465952 159
70 3300005289 Ga0065704_10141502 Ga0065704_101415022 159
71 3300005459 Ga0068867_100590405 Ga0068867_1005904051 159
72 3300005548 Ga0070665_100117901 Ga0070665_1001179012 159
73 3300006051 Ga0075364_10108860 Ga0075364_101088602 159
74 3300009011 Ga0105251_10002088 Ga0105251_1000208816 159
75 3300009093 Ga0105240_10036674 Ga0105240_100366749 159
76 3300009174 Ga0105241_10907441 Ga0105241_109074412 159
77 3300009545 Ga0105237_10928161 Ga0105237_109281612 159
78 3300009551 Ga0105238_10527017 Ga0105238_105270171 159
79 3300009553 Ga0105249_11170871 Ga0105249_111708711 159
80 3300013100 Ga0157373_10270859 Ga0157373_102708592 159
81 3300013102 Ga0157371_10010744 Ga0157371_100107442 159
82 3300013102 Ga0157371_10090012 Ga0157371_100900121 159
83 3300013104 Ga0157370_10232998 Ga0157370_102329982 159
84 3300013104 Ga0157370_11499081 Ga0157370_114990811 159
85 3300013307 Ga0157372_10993752 Ga0157372_109937522 159
86 3300014497 Ga0182008_10269344 Ga0182008_102693442 159
87 3300015261 Ga0182006_1105266 Ga0182006_11052662 159
88 3300017792 Ga0163161_10118987 Ga0163161_101189872 159
89 3300017792 Ga0163161_10505443 Ga0163161_105054432 159
90 3300025263 Ga0209565_1000022 Ga0209565_1000022112 159
91 3300025273 Ga0209673_1000110 Ga0209673_1000110144 159
92 3300025291 Ga0209675_1000060 Ga0209675_100006070 159
93 3300025295 Ga0209564_1000304 Ga0209564_100030411 159
94 3300025298 Ga0209050_1057897 Ga0209050_10578972 159
95 3300025299 Ga0209256_1018250 Ga0209256_10182502 159
96 3300025299 Ga0209256_1079539 Ga0209256_10795392 159
97 3300025304 Ga0209257_1016753 Ga0209257_10167532 159
98 3300025735 Ga0207713_1012187 Ga0207713_10121875 159
99 3300025913 Ga0207695_10065084 Ga0207695_100650844 159
100 3300028379 Ga0268266_10326135 Ga0268266_103261352 159
101 3300031824 Ga0307413_10001305 Ga0307413_100013053 159
102 3300032004 Ga0307414_10487846 Ga0307414_104878461 159
103 3300032004 Ga0307414_11627188 Ga0307414_116271882 159
104 3300039438 Ga0436360_0598563 Ga0436360_0598563_106_591 159
105 3300039438 Ga0436360_1022894 Ga0436360_1022894_113_598 159
106 3300041496 Ga0451839_1039681 Ga0451839_1039681_38_529 159
107 3300044684 Ga0466966_0215309 Ga0466966_0215309_106_591 159
108 3300044693 Ga0466961_0135543 Ga0466961_0135543_158_643 159
109 3300045049 Ga0466959_0190067 Ga0466959_0190067_52_537 159
110 3300045836 Ga0466958_0093729 Ga0466958_0093729_782_1267 159
111 3300046460 Ga0495638_0114674 Ga0495638_0114674_341_823 159
112 3300047320 Ga0495672_0075646 Ga0495672_0075646_648_1130 159
113 3300048908 Ga0496105_0184926 Ga0496105_0184926_1010_1492 159
114 3300048920 Ga0496117_0201942 Ga0496117_0201942_295_777 159
115 3300048920 Ga0496117_0385603 Ga0496117_0385603_105_587 159
116 3300048921 Ga0496118_0083795 Ga0496118_0083795_1384_1866 159
117 3300048922 Ga0496119_0001341 Ga0496119_0001341_27574_28056 159
118 3300048923 Ga0496120_0000523 Ga0496120_0000523_5766_6248 159
119 3300048924 Ga0496121_0238342 Ga0496121_0238342_226_708 159
120 3300048926 Ga0496123_0177912 Ga0496123_0177912_351_833 159
121 3300048927 Ga0496124_0103062 Ga0496124_0103062_434_916 159
122 3300048928 Ga0496125_0026109 Ga0496125_0026109_238_720 159
123 3300048928 Ga0496125_0059312 Ga0496125_0059312_2242_2724 159
124 3300048929 Ga0496126_0020626 Ga0496126_0020626_5762_6244 159
125 3300048929 Ga0496126_0538148 Ga0496126_0538148_290_772 159
126 3300049568 Ga0501031_0033720 Ga0501031_0033720_1570_2082 159
127 3300049570 Ga0501033_0004786 Ga0501033_0004786_4762_5247 159
128 3300049571 Ga0501034_0254029 Ga0501034_0254029_40_531 159
129 3300050491 nmdc:mga00v17_624754_c1 nmdc:mga00v17_624754_c1_156_638 159
130 3300061719 Ga0466962_0343665 Ga0466962_0343665_101_586 159
131 iso_pu_bacteria 2974315732 2974318574 159
132 iso_pu_bacteria 2984523437 2984526786 159
133 3300015262 Ga0182007_10033119 Ga0182007_100331193 160
134 3300025972 Ga0207668_10491355 Ga0207668_104913552 160
135 3300031235 Ga0265330_10017012 Ga0265330_100170122 160
136 3300031238 Ga0265332_10034152 Ga0265332_100341523 160
137 3300031242 Ga0265329_10014964 Ga0265329_100149641 160
138 3300031247 Ga0265340_10367944 Ga0265340_103679442 160
139 3300031344 Ga0265316_10230015 Ga0265316_102300152 160
140 3300031711 Ga0265314_10001658 Ga0265314_1000165810 160
141 3300031712 Ga0265342_10038093 Ga0265342_100380933 160
142 3300041486 Ga0451807_2126778 Ga0451807_2126778_134_619 160
143 3300044673 Ga0453683_0016733 Ga0453683_0016733_2628_3113 160
144 3300044735 Ga0466968_0153822 Ga0466968_0153822_374_859 160
145 3300044842 Ga0466957_0638153 Ga0466957_0638153_165_659 160
146 3300046512 Ga0495610_0001273 Ga0495610_0001273_9405_9905 161
147 3300003856 Ga0058692_1000012 Ga0058692_1000012156 162
148 3300027312 Ga0209371_1000007 Ga0209371_1000007234 162
149 3300030500 Ga0268256_1000008 Ga0268256_1000008716 162
150 3300042876 Ga0451577_0000001 Ga0451577_0000001_985112_985603 162
151 3300005718 Ga0068866_10476778 Ga0068866_104767781 163
152 3300009098 Ga0105245_10086174 Ga0105245_100861744 163
153 3300009553 Ga0105249_10288954 Ga0105249_102889542 163
154 3300010375 Ga0105239_10203508 Ga0105239_102035082 163
155 3300013306 Ga0163162_10253229 Ga0163162_102532293 163
156 3300025933 Ga0207706_10338247 Ga0207706_103382472 163
157 3300048905 Ga0496102_0196922 Ga0496102_0196922_955_1497 163
158 3300050513 nmdc:mga0rr50_194927_c1 nmdc:mga0rr50_194927_c1_90_593 163
159 3300044693 Ga0466961_0139346 Ga0466961_0139346_101_595 164
160 3300044694 Ga0466963_0124659 Ga0466963_0124659_623_1117 164
161 3300044842 Ga0466957_0013250 Ga0466957_0013250_3086_3580 164
162 iso_pu_bacteria 2816332119 2816428125 165
163 3300001979 JGI24740J21852_10046734 JGI24740J21852_100467342 169
164 3300001989 JGI24739J22299_10045345 JGI24739J22299_100453452 169
165 3300001990 JGI24737J22298_10014705 JGI24737J22298_100147052 169
166 3300002067 JGI24735J21928_10034184 JGI24735J21928_100341842 169
167 3300002075 JGI24738J21930_10018334 JGI24738J21930_100183341 169
168 3300005337 Ga0070682_100119820 Ga0070682_1001198202 169
169 3300005347 Ga0070668_100063865 Ga0070668_1000638652 169
170 3300005367 Ga0070667_101245119 Ga0070667_1012451191 169
171 3300005456 Ga0070678_100476901 Ga0070678_1004769012 169
172 3300005548 Ga0070665_100472248 Ga0070665_1004722482 169
173 3300005577 Ga0068857_100120596 Ga0068857_1001205962 169
174 3300005577 Ga0068857_100555655 Ga0068857_1005556552 169
175 3300005719 Ga0068861_100605930 Ga0068861_1006059302 169
176 3300005834 Ga0068851_10114339 Ga0068851_101143392 169
177 3300005843 Ga0068860_100852546 Ga0068860_1008525461 169
178 3300005981 Ga0081538_10149861 Ga0081538_101498612 169
179 3300005983 Ga0081540_1090708 Ga0081540_10907082 169
180 3300006846 Ga0075430_100754692 Ga0075430_1007546921 169
181 3300009545 Ga0105237_11422205 Ga0105237_114222052 169
182 3300009553 Ga0105249_11556967 Ga0105249_115569672 169
183 3300010375 Ga0105239_10598871 Ga0105239_105988712 169
184 3300011119 Ga0105246_10326752 Ga0105246_103267522 169
185 3300013105 Ga0157369_10946468 Ga0157369_109464681 169
186 3300013307 Ga0157372_10586902 Ga0157372_105869022 169
187 3300014325 Ga0163163_10244109 Ga0163163_102441091 169
188 3300017792 Ga0163161_10480140 Ga0163161_104801401 169
189 3300022467 Ga0224712_10245481 Ga0224712_102454811 169
190 3300025904 Ga0207647_10053467 Ga0207647_100534672 169
191 3300025945 Ga0207679_10785512 Ga0207679_107855121 169
192 3300025972 Ga0207668_10087041 Ga0207668_100870412 169
193 3300025986 Ga0207658_11021377 Ga0207658_110213771 169
194 3300026116 Ga0207674_10142845 Ga0207674_101428453 169
195 3300026116 Ga0207674_10824353 Ga0207674_108243531 169
196 3300026118 Ga0207675_100660154 Ga0207675_1006601542 169
197 3300026121 Ga0207683_10612341 Ga0207683_106123411 169
198 3300026142 Ga0207698_10567118 Ga0207698_105671182 169
199 3300028379 Ga0268266_10054182 Ga0268266_100541822 169
200 3300028381 Ga0268264_10675040 Ga0268264_106750401 169
201 3300030522 Ga0307512_10096951 Ga0307512_100969512 169
202 3300031824 Ga0307413_11334650 Ga0307413_113346501 169
203 3300031901 Ga0307406_11153230 Ga0307406_111532301 169
204 3300031995 Ga0307409_101613585 Ga0307409_1016135851 169
205 3300032002 Ga0307416_100883272 Ga0307416_1008832721 169
206 3300033179 Ga0307507_10573764 Ga0307507_105737641 169
207 3300037466 Ga0395898_0279109 Ga0395898_0279109_300_809 169
208 3300044719 Ga0466971_0488381 Ga0466971_0488381_16_525 169
209 3300046453 Ga0495627_163239 Ga0495627_163239_83_592 169
210 3300046473 Ga0495582_0085281 Ga0495582_0085281_930_1439 169
211 3300046648 Ga0495611_0371083 Ga0495611_0371083_101_610 169
212 3300046660 Ga0495625_0141340 Ga0495625_0141340_542_1051 169
213 3300046683 Ga0495658_0110725 Ga0495658_0110725_728_1237 169
214 3300046694 Ga0495649_0227764 Ga0495649_0227764_194_703 169
215 3300047320 Ga0495672_0092224 Ga0495672_0092224_1059_1568 169
216 3300048907 Ga0496104_0660568 Ga0496104_0660568_186_695 169
217 3300048911 Ga0496108_0982039 Ga0496108_0982039_124_633 169
218 3300048912 Ga0496109_0402701 Ga0496109_0402701_260_769 169
219 3300048913 Ga0496110_0356940 Ga0496110_0356940_267_776 169
220 3300050508 nmdc:mga09592_982903_c1 nmdc:mga09592_982903_c1_131_640 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

21

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9518 1 158
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.95 1 160
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9456 4 160
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.9353 2 160
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.9341 2 157
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.952 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9504 1 157 3.40.30.10
af_Q59WD3_4_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9463 4 160 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9443 1 160 3.40.30.10
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9418 1 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3S1A3K2-F1-model_v4 Glutathione peroxidase 0.9642 1 160 GO:0004601
GO:0034599
AF-A0A7L5Y631-F1-model_v4 Glutathione peroxidase 0.9635 1 160 GO:0004601
GO:0034599
AF-A0A7V9GWC1-F1-model_v4 Glutathione peroxidase 0.9633 1 160 GO:0004601
GO:0034599
AF-A0A562ZQX2-F1-model_v4 Glutathione peroxidase 0.9632 1 160 GO:0004601
GO:0034599
AF-A0A7W8M8F6-F1-model_v4 Glutathione peroxidase 0.9627 1 160 GO:0004602
GO:0034599

Feature Viewer

pLDDT pTM Quality
88.28 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map