F328119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 162 | 201 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_418731_c1|nmdc:mga0n895_418731_c1_176_1048 |
| Length | 290 |
| Sequence | LNPDRPLDTPLSAGGRRLVCKEIFREMLVVLKKDYGDVSREAARIVAGAVRAKPDIVLGLATGGTPLGLYKELVALYRADSLDFSRVTSFNLDEYLGLAPSHPQSFHHFMEENLFSQINLPRERAHVPDGTISGDYDNYCARYEQRIKAAGGIDLQVLGIGRNGHIGFNEPTSSLASRTRLKALSRETIEDNRHVFANESEMPKCAITMGIGTILDCKRVLILASGRAKAAAVAKAIEGPITSSVSASALQMHPDVTFIIDEEAAYSLTQRDYYRHVLEMTRLFTPERLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 3 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 4 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 5 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 6 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 7 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 8 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 9 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 10 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 11 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 12 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 85 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 86 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 87 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 91 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 94 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 95 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 96 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 97 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 98 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 128 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 135 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 136 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 141 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 142 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 143 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 144 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 145 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 158 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 159 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 160 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 161 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 162 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.06 |
| Metatranscriptomes | 0 |
| Isolates | 6.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 73.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10056900 | 3300003320 | Bacteria | 14127 |
| 2 | Ga0065714_10129430 | 3300005288 | Bacteria | 1255 |
| 3 | Ga0065707_10152426 | 3300005295 | Bacteria | 1644 |
| 4 | Ga0070658_10093794 | 3300005327 | Bacteria | 2476 |
| 5 | Ga0070666_10477568 | 3300005335 | Bacteria | 902 |
| 6 | Ga0070680_100243200 | 3300005336 | Bacteria | 1521 |
| 7 | Ga0070660_100054840 | 3300005339 | Bacteria | 3079 |
| 8 | Ga0070671_100147213 | 3300005355 | Bacteria | 1988 |
| 9 | Ga0070709_10090208 | 3300005434 | Bacteria | 2020 |
| 10 | Ga0070713_100034720 | 3300005436 | Bacteria | 4055 |
| 11 | Ga0070706_100125768 | 3300005467 | Unclassified | 2390 |
| 12 | Ga0070707_100119078 | 3300005468 | Bacteria | 2563 |
| 13 | Ga0070707_100166474 | 3300005468 | Unclassified | 2148 |
| 14 | Ga0070697_100358539 | 3300005536 | Unclassified | 1260 |
| 15 | Ga0070665_100003533 | 3300005548 | Bacteria | 16619 |
| 16 | Ga0070665_100006351 | 3300005548 | Bacteria | 12058 |
| 17 | Ga0068855_100003918 | 3300005563 | Bacteria | 18172 |
| 18 | Ga0068855_100033680 | 3300005563 | Bacteria | 6112 |
| 19 | Ga0068855_100410901 | 3300005563 | Bacteria | 1482 |
| 20 | Ga0068857_100348540 | 3300005577 | Bacteria | 1371 |
| 21 | Ga0068856_100000426 | 3300005614 | Bacteria | 46290 |
| 22 | Ga0068852_100179850 | 3300005616 | Bacteria | 1988 |
| 23 | Ga0068859_100176187 | 3300005617 | Unclassified | 2220 |
| 24 | Ga0068863_100039094 | 3300005841 | Bacteria | 4515 |
| 25 | Ga0068858_100032877 | 3300005842 | Bacteria | 4817 |
| 26 | Ga0068858_100087476 | 3300005842 | Bacteria | 2898 |
| 27 | Ga0068858_100138532 | 3300005842 | Bacteria | 2284 |
| 28 | Ga0068860_100133088 | 3300005843 | Bacteria | 2387 |
| 29 | Ga0068862_100018556 | 3300005844 | Bacteria | 5795 |
| 30 | Ga0075363_100033798 | 3300006048 | Bacteria | 2666 |
| 31 | Ga0070712_100078910 | 3300006175 | Bacteria | 2378 |
| 32 | Ga0070712_100214452 | 3300006175 | Unclassified | 1520 |
| 33 | Ga0097621_100005759 | 3300006237 | Bacteria | 8746 |
| 34 | Ga0075370_10050855 | 3300006353 | Bacteria | 2351 |
| 35 | Ga0068871_100004868 | 3300006358 | Bacteria | 9384 |
| 36 | Ga0068871_100027829 | 3300006358 | Bacteria | 4426 |
| 37 | Ga0075428_100099773 | 3300006844 | Bacteria | 3166 |
| 38 | Ga0075431_100388513 | 3300006847 | Bacteria | 1398 |
| 39 | Ga0075434_100009797 | 3300006871 | Bacteria | 8960 |
| 40 | Ga0068865_100046239 | 3300006881 | Bacteria | 2986 |
| 41 | Ga0097620_100176184 | 3300006931 | Unclassified | 2220 |
| 42 | Ga0111539_10204345 | 3300009094 | Unclassified | 2303 |
| 43 | Ga0114129_10124501 | 3300009147 | Bacteria | 3545 |
| 44 | Ga0105248_10154508 | 3300009177 | Bacteria | 2589 |
| 45 | Ga0105237_10004906 | 3300009545 | Bacteria | 15308 |
| 46 | Ga0105237_10020693 | 3300009545 | Bacteria | 6777 |
| 47 | Ga0105237_10038560 | 3300009545 | Bacteria | 4825 |
| 48 | Ga0105237_10411180 | 3300009545 | Unclassified | 1358 |
| 49 | Ga0105249_10431244 | 3300009553 | Unclassified | 1354 |
| 50 | Ga0105239_10017145 | 3300010375 | Bacteria | 8007 |
| 51 | Ga0105239_10173756 | 3300010375 | Bacteria | 2410 |
| 52 | Ga0157371_10051513 | 3300013102 | Bacteria | 2925 |
| 53 | Ga0157370_10001466 | 3300013104 | Bacteria | 29160 |
| 54 | Ga0157370_10457614 | 3300013104 | Bacteria | 1173 |
| 55 | Ga0157378_10189556 | 3300013297 | Bacteria | 1939 |
| 56 | Ga0163162_10074053 | 3300013306 | Bacteria | 3463 |
| 57 | Ga0157375_10048914 | 3300013308 | Bacteria | 4139 |
| 58 | Ga0157376_10000207 | 3300014969 | Bacteria | 40872 |
| 59 | Ga0157376_10009298 | 3300014969 | Bacteria | 7138 |
| 60 | Ga0163161_10238984 | 3300017792 | Bacteria | 1412 |
| 61 | Ga0209050_1000369 | 3300025298 | Bacteria | 86187 |
| 62 | Ga0207680_10440704 | 3300025903 | Bacteria | 924 |
| 63 | Ga0207699_10051434 | 3300025906 | Bacteria | 2434 |
| 64 | Ga0207705_10005150 | 3300025909 | Bacteria | 9800 |
| 65 | Ga0207705_10172084 | 3300025909 | Bacteria | 1631 |
| 66 | Ga0207684_10111301 | 3300025910 | Unclassified | 2344 |
| 67 | Ga0207671_10009484 | 3300025914 | Bacteria | 8130 |
| 68 | Ga0207671_10045022 | 3300025914 | Bacteria | 3262 |
| 69 | Ga0207693_10006107 | 3300025915 | Bacteria | 9982 |
| 70 | Ga0207693_10113352 | 3300025915 | Bacteria | 2127 |
| 71 | Ga0207693_10248365 | 3300025915 | Unclassified | 1396 |
| 72 | Ga0207663_10052777 | 3300025916 | Unclassified | 2537 |
| 73 | Ga0207646_10090648 | 3300025922 | Unclassified | 2736 |
| 74 | Ga0207646_10115962 | 3300025922 | Bacteria | 2406 |
| 75 | Ga0207681_10013666 | 3300025923 | Bacteria | 5027 |
| 76 | Ga0207700_10020357 | 3300025928 | Unclassified | 4504 |
| 77 | Ga0207665_10002030 | 3300025939 | Bacteria | 13626 |
| 78 | Ga0207665_10007247 | 3300025939 | Bacteria | 7336 |
| 79 | Ga0207665_10018343 | 3300025939 | Bacteria | 4599 |
| 80 | Ga0207711_10158267 | 3300025941 | Bacteria | 2048 |
| 81 | Ga0207667_10016441 | 3300025949 | Bacteria | 8360 |
| 82 | Ga0207667_10042510 | 3300025949 | Bacteria | 4829 |
| 83 | Ga0207667_10501821 | 3300025949 | Bacteria | 1231 |
| 84 | Ga0207712_10641706 | 3300025961 | Bacteria | 922 |
| 85 | Ga0207703_10031024 | 3300026035 | Bacteria | 4226 |
| 86 | Ga0207703_10241927 | 3300026035 | Bacteria | 1623 |
| 87 | Ga0207702_10000850 | 3300026078 | Bacteria | 31954 |
| 88 | Ga0207641_10011932 | 3300026088 | Bacteria | 7130 |
| 89 | Ga0207674_10609831 | 3300026116 | Bacteria | 1054 |
| 90 | Ga0207675_100213928 | 3300026118 | Bacteria | 1855 |
| 91 | Ga0268266_10003211 | 3300028379 | Bacteria | 16531 |
| 92 | Ga0268265_10031900 | 3300028380 | Bacteria | 3810 |
| 93 | Ga0268264_10416132 | 3300028381 | Bacteria | 1295 |
| 94 | Ga0265331_10067772 | 3300031250 | Unclassified | 1674 |
| 95 | Ga0265327_10000379 | 3300031251 | Bacteria | 83712 |
| 96 | Ga0265327_10008906 | 3300031251 | Bacteria | 7367 |
| 97 | Ga0307408_100423534 | 3300031548 | Bacteria | 1148 |
| 98 | Ga0307413_10236130 | 3300031824 | Bacteria | 1346 |
| 99 | Ga0307410_10362898 | 3300031852 | Bacteria | 1160 |
| 100 | Ga0307407_10077607 | 3300031903 | Bacteria | 1998 |
| 101 | Ga0307409_100038560 | 3300031995 | Bacteria | 3535 |
| 102 | Ga0307416_100226065 | 3300032002 | Bacteria | 1800 |
| 103 | Ga0373931_0117684 | 3300035691 | Bacteria | 1515 |
| 104 | Ga0373925_0076089 | 3300037068 | Bacteria | 2545 |
| 105 | Ga0395898_0234273 | 3300037466 | Bacteria | 1751 |
| 106 | Ga0436365_0987856 | 3300039437 | Bacteria | 6970 |
| 107 | Ga0451853_3245237 | 3300041512 | Bacteria | 11076 |
| 108 | Ga0451577_0034191 | 3300042876 | Bacteria | 4584 |
| 109 | Ga0466959_0114659 | 3300045049 | Bacteria | 1920 |
| 110 | Ga0451576_0047370 | 3300045051 | Bacteria | 4520 |
| 111 | Ga0466958_0167201 | 3300045836 | Bacteria | 1392 |
| 112 | Ga0495641_0024623 | 3300046461 | Bacteria | 2968 |
| 113 | Ga0495641_0051229 | 3300046461 | Bacteria | 1886 |
| 114 | Ga0495580_0001731 | 3300046472 | Bacteria | 19168 |
| 115 | Ga0495580_0283737 | 3300046472 | Bacteria | 1129 |
| 116 | Ga0495582_0002798 | 3300046473 | Bacteria | 9748 |
| 117 | Ga0495582_0025791 | 3300046473 | Unclassified | 3220 |
| 118 | Ga0495639_0013297 | 3300046475 | Bacteria | 3553 |
| 119 | Ga0495594_0048224 | 3300046499 | Unclassified | 2340 |
| 120 | Ga0495594_0166876 | 3300046499 | Bacteria | 1252 |
| 121 | Ga0495628_0324731 | 3300046516 | Bacteria | 1135 |
| 122 | Ga0495630_0024645 | 3300046517 | Bacteria | 4446 |
| 123 | Ga0495630_0078116 | 3300046517 | Bacteria | 2496 |
| 124 | Ga0495643_0000100 | 3300046522 | Bacteria | 144402 |
| 125 | Ga0495648_0019828 | 3300046524 | Bacteria | 4710 |
| 126 | Ga0495665_0003234 | 3300046531 | Bacteria | 8813 |
| 127 | Ga0495640_0006426 | 3300046533 | Bacteria | 9292 |
| 128 | Ga0495586_0059432 | 3300046535 | Bacteria | 2077 |
| 129 | Ga0495668_0010618 | 3300046616 | Bacteria | 5565 |
| 130 | Ga0495635_0205977 | 3300046663 | Bacteria | 1333 |
| 131 | Ga0495647_0001438 | 3300046681 | Bacteria | 7373 |
| 132 | Ga0495658_0008741 | 3300046683 | Bacteria | 5030 |
| 133 | Ga0495613_0008822 | 3300046689 | Bacteria | 7478 |
| 134 | Ga0495581_0053044 | 3300047315 | Bacteria | 2342 |
| 135 | Ga0495581_0082437 | 3300047315 | Bacteria | 1863 |
| 136 | Ga0495674_0110390 | 3300047319 | Bacteria | 2332 |
| 137 | Ga0495672_0016176 | 3300047320 | Bacteria | 5040 |
| 138 | Ga0495673_0002873 | 3300047469 | Bacteria | 11717 |
| 139 | Ga0495684_0024388 | 3300047471 | Bacteria | 4656 |
| 140 | Ga0495593_0016150 | 3300047673 | Bacteria | 4214 |
| 141 | Ga0495593_0178625 | 3300047673 | Bacteria | 1069 |
| 142 | Ga0495614_0039158 | 3300048089 | Bacteria | 2034 |
| 143 | Ga0496100_0005022 | 3300048903 | Bacteria | 7080 |
| 144 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 145 | Ga0496101_0097909 | 3300048904 | Bacteria | 2191 |
| 146 | Ga0496101_0228488 | 3300048904 | Unclassified | 1446 |
| 147 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 148 | Ga0496102_0101641 | 3300048905 | Bacteria | 2671 |
| 149 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 150 | Ga0496103_0020774 | 3300048906 | Bacteria | 3947 |
| 151 | Ga0496105_0251738 | 3300048908 | Unclassified | 1431 |
| 152 | Ga0496106_0005783 | 3300048909 | Bacteria | 9146 |
| 153 | Ga0496106_0065016 | 3300048909 | Bacteria | 2776 |
| 154 | Ga0496107_0136729 | 3300048910 | Bacteria | 1810 |
| 155 | Ga0496108_0122525 | 3300048911 | Bacteria | 2231 |
| 156 | Ga0496113_0439987 | 3300048916 | Bacteria | 1047 |
| 157 | Ga0496114_0051240 | 3300048917 | Bacteria | 3437 |
| 158 | Ga0496114_0089551 | 3300048917 | Bacteria | 2611 |
| 159 | Ga0496114_0161313 | 3300048917 | Bacteria | 1950 |
| 160 | Ga0496115_0023249 | 3300048918 | Unclassified | 4809 |
| 161 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 162 | Ga0496116_0013776 | 3300048919 | Bacteria | 6498 |
| 163 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 164 | Ga0496117_0000387 | 3300048920 | Bacteria | 75589 |
| 165 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 166 | Ga0496118_0095011 | 3300048921 | Bacteria | 2036 |
| 167 | Ga0496119_0032134 | 3300048922 | Bacteria | 3503 |
| 168 | Ga0496120_0010873 | 3300048923 | Bacteria | 6299 |
| 169 | Ga0496121_0000809 | 3300048924 | Bacteria | 56983 |
| 170 | Ga0496122_0000020 | 3300048925 | Bacteria | 401675 |
| 171 | Ga0496122_0001200 | 3300048925 | Bacteria | 44223 |
| 172 | Ga0496122_0004879 | 3300048925 | Bacteria | 16291 |
| 173 | Ga0496122_0006600 | 3300048925 | Bacteria | 13242 |
| 174 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 175 | Ga0496123_0001124 | 3300048926 | Bacteria | 39914 |
| 176 | Ga0496123_0008151 | 3300048926 | Bacteria | 9670 |
| 177 | Ga0496124_0004596 | 3300048927 | Bacteria | 16001 |
| 178 | Ga0496125_0051647 | 3300048928 | Bacteria | 3388 |
| 179 | Ga0496126_0002555 | 3300048929 | Bacteria | 24367 |
| 180 | Ga0496126_0145890 | 3300048929 | Bacteria | 2032 |
| 181 | Ga0501036_0304300 | 3300049572 | Bacteria | 1333 |
| 182 | Ga0501038_0040598 | 3300049574 | Bacteria | 4062 |
| 183 | Ga0501042_0324275 | 3300049578 | Bacteria | 1113 |
| 184 | Ga0501043_0108433 | 3300049579 | Bacteria | 2181 |
| 185 | Ga0501046_0113966 | 3300049580 | Bacteria | 2063 |
| 186 | Ga0501074_0265867 | 3300049590 | Bacteria | 1219 |
| 187 | Ga0501035_0286253 | 3300049822 | Bacteria | 1392 |
| 188 | Ga0501045_0354568 | 3300049824 | Bacteria | 1092 |
| 189 | nmdc:mga05p37_73541_c1 | 3300050507 | Bacteria | 4206 |
| 190 | nmdc:mga0n895_226040_c1 | 3300050512 | Bacteria | 1900 |
| 191 | nmdc:mga0n895_41541_c1 | 3300050512 | Unclassified | 4472 |
| 192 | nmdc:mga0n895_418731_c1 | 3300050512 | Bacteria | 1354 |
| 193 | nmdc:mga0rr50_4028_c1 | 3300050513 | Bacteria | 8571 |
| 194 | nmdc:mga0rr50_622203_c1 | 3300050513 | Bacteria | 921 |
| 195 | nmdc:mga0a205_345798_c1 | 3300050515 | Bacteria | 1355 |
| 196 | nmdc:mga0sz30_118413_c1 | 3300050516 | Bacteria | 1163 |
| 197 | Ga0500556_0004730 | 3300053104 | Bacteria | 3862 |
| 198 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 199 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 200 | Ga0500616_0004283 | 3300053153 | Bacteria | 10249 |
| 201 | Ga0500616_0014577 | 3300053153 | Bacteria | 4513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_100138532 | Ga0068858_1001385322 | 230 |
| 2 | 3300053153 | Ga0500616_0000010 | Ga0500616_0000010_515312_516046 | 239 |
| 3 | 3300053153 | Ga0500616_0004283 | Ga0500616_0004283_6694_7476 | 240 |
| 4 | 3300048925 | Ga0496122_0006600 | Ga0496122_0006600_10153_10893 | 241 |
| 5 | iso_pu_bacteria | 2857460504 | 2857461889 | 241 |
| 6 | 3300005563 | Ga0068855_100410901 | Ga0068855_1004109012 | 243 |
| 7 | 3300025949 | Ga0207667_10501821 | Ga0207667_105018212 | 243 |
| 8 | 3300026118 | Ga0207675_100213928 | Ga0207675_1002139282 | 244 |
| 9 | 3300048919 | Ga0496116_0013776 | Ga0496116_0013776_3706_4485 | 244 |
| 10 | 3300048921 | Ga0496118_0095011 | Ga0496118_0095011_1131_1910 | 244 |
| 11 | 3300048927 | Ga0496124_0004596 | Ga0496124_0004596_10702_11481 | 244 |
| 12 | 3300048929 | Ga0496126_0145890 | Ga0496126_0145890_194_973 | 244 |
| 13 | iso_pu_bacteria | 2643221679 | 2644444796 | 248 |
| 14 | iso_pu_bacteria | 2565956761 | 2566991485 | 251 |
| 15 | iso_pu_bacteria | 2799112218 | 2799183779 | 251 |
| 16 | iso_pu_bacteria | 2842888712 | 2842890580 | 251 |
| 17 | iso_pu_bacteria | 2902792274 | 2902795007 | 251 |
| 18 | iso_pu_bacteria | 2904535858 | 2904541010 | 251 |
| 19 | iso_pu_bacteria | 2922554459 | 2922560653 | 251 |
| 20 | iso_pu_bacteria | 2953998280 | 2953998542 | 251 |
| 21 | 3300009545 | Ga0105237_10038560 | Ga0105237_100385604 | 252 |
| 22 | iso_pu_bacteria | 2855386786 | 2855388015 | 252 |
| 23 | iso_pu_bacteria | 8004021418 | 8004022212 | 252 |
| 24 | 3300046516 | Ga0495628_0324731 | Ga0495628_0324731_192_953 | 253 |
| 25 | iso_pu_bacteria | 2643221575 | 2643887216 | 253 |
| 26 | 3300053104 | Ga0500556_0004730 | Ga0500556_0004730_2138_2917 | 254 |
| 27 | iso_pu_bacteria | 2844852863 | 2844854406 | 254 |
| 28 | iso_pu_bacteria | 8056037122 | 8056039298 | 254 |
| 29 | iso_pu_bacteria | 8057345674 | 8057347491 | 254 |
| 30 | 3300005563 | Ga0068855_100033680 | Ga0068855_1000336805 | 255 |
| 31 | 3300005616 | Ga0068852_100179850 | Ga0068852_1001798502 | 255 |
| 32 | 3300006048 | Ga0075363_100033798 | Ga0075363_1000337982 | 255 |
| 33 | 3300006353 | Ga0075370_10050855 | Ga0075370_100508552 | 255 |
| 34 | 3300006844 | Ga0075428_100099773 | Ga0075428_1000997733 | 255 |
| 35 | 3300006847 | Ga0075431_100388513 | Ga0075431_1003885132 | 255 |
| 36 | 3300009147 | Ga0114129_10124501 | Ga0114129_101245012 | 255 |
| 37 | 3300009545 | Ga0105237_10004906 | Ga0105237_100049064 | 255 |
| 38 | 3300010375 | Ga0105239_10017145 | Ga0105239_100171453 | 255 |
| 39 | 3300013306 | Ga0163162_10074053 | Ga0163162_100740534 | 255 |
| 40 | 3300017792 | Ga0163161_10238984 | Ga0163161_102389842 | 255 |
| 41 | 3300025914 | Ga0207671_10009484 | Ga0207671_100094849 | 255 |
| 42 | 3300025923 | Ga0207681_10013666 | Ga0207681_100136663 | 255 |
| 43 | 3300031548 | Ga0307408_100423534 | Ga0307408_1004235342 | 255 |
| 44 | 3300031824 | Ga0307413_10236130 | Ga0307413_102361302 | 255 |
| 45 | 3300031852 | Ga0307410_10362898 | Ga0307410_103628981 | 255 |
| 46 | 3300031903 | Ga0307407_10077607 | Ga0307407_100776073 | 255 |
| 47 | 3300031995 | Ga0307409_100038560 | Ga0307409_1000385603 | 255 |
| 48 | 3300037466 | Ga0395898_0234273 | Ga0395898_0234273_633_1412 | 255 |
| 49 | 3300041512 | Ga0451853_3245237 | Ga0451853_3245237_3366_4145 | 255 |
| 50 | 3300045049 | Ga0466959_0114659 | Ga0466959_0114659_449_1228 | 255 |
| 51 | 3300045836 | Ga0466958_0167201 | Ga0466958_0167201_337_1116 | 255 |
| 52 | 3300046524 | Ga0495648_0019828 | Ga0495648_0019828_2629_3408 | 255 |
| 53 | 3300046616 | Ga0495668_0010618 | Ga0495668_0010618_202_981 | 255 |
| 54 | 3300047320 | Ga0495672_0016176 | Ga0495672_0016176_2629_3408 | 255 |
| 55 | 3300047469 | Ga0495673_0002873 | Ga0495673_0002873_8310_9089 | 255 |
| 56 | 3300048903 | Ga0496100_0005022 | Ga0496100_0005022_2473_3252 | 255 |
| 57 | 3300048904 | Ga0496101_0000021 | Ga0496101_0000021_199603_200382 | 255 |
| 58 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_58001_58780 | 255 |
| 59 | 3300048906 | Ga0496103_0000007 | Ga0496103_0000007_296909_297688 | 255 |
| 60 | 3300048909 | Ga0496106_0005783 | Ga0496106_0005783_386_1165 | 255 |
| 61 | 3300048911 | Ga0496108_0122525 | Ga0496108_0122525_31_810 | 255 |
| 62 | 3300048919 | Ga0496116_0000018 | Ga0496116_0000018_21103_21882 | 255 |
| 63 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_523996_524775 | 255 |
| 64 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_523996_524775 | 255 |
| 65 | 3300048922 | Ga0496119_0032134 | Ga0496119_0032134_1121_1900 | 255 |
| 66 | 3300048923 | Ga0496120_0010873 | Ga0496120_0010873_5084_5863 | 255 |
| 67 | 3300048924 | Ga0496121_0000809 | Ga0496121_0000809_16709_17488 | 255 |
| 68 | 3300048925 | Ga0496122_0001200 | Ga0496122_0001200_5394_6164 | 255 |
| 69 | 3300048926 | Ga0496123_0001124 | Ga0496123_0001124_36390_37160 | 255 |
| 70 | 3300048928 | Ga0496125_0051647 | Ga0496125_0051647_2011_2790 | 255 |
| 71 | 3300048929 | Ga0496126_0002555 | Ga0496126_0002555_9444_10223 | 255 |
| 72 | 3300049574 | Ga0501038_0040598 | Ga0501038_0040598_1589_2368 | 255 |
| 73 | 3300050507 | nmdc:mga05p37_73541_c1 | nmdc:mga05p37_73541_c1_215_994 | 255 |
| 74 | 3300050516 | nmdc:mga0sz30_118413_c1 | nmdc:mga0sz30_118413_c1_318_1097 | 255 |
| 75 | 3300005288 | Ga0065714_10129430 | Ga0065714_101294302 | 256 |
| 76 | 3300005327 | Ga0070658_10093794 | Ga0070658_100937942 | 256 |
| 77 | 3300005339 | Ga0070660_100054840 | Ga0070660_1000548403 | 256 |
| 78 | 3300005563 | Ga0068855_100003918 | Ga0068855_1000039186 | 256 |
| 79 | 3300005577 | Ga0068857_100348540 | Ga0068857_1003485402 | 256 |
| 80 | 3300005614 | Ga0068856_100000426 | Ga0068856_10000042622 | 256 |
| 81 | 3300005842 | Ga0068858_100087476 | Ga0068858_1000874763 | 256 |
| 82 | 3300005843 | Ga0068860_100133088 | Ga0068860_1001330884 | 256 |
| 83 | 3300009545 | Ga0105237_10020693 | Ga0105237_100206934 | 256 |
| 84 | 3300010375 | Ga0105239_10173756 | Ga0105239_101737561 | 256 |
| 85 | 3300013102 | Ga0157371_10051513 | Ga0157371_100515132 | 256 |
| 86 | 3300013104 | Ga0157370_10001466 | Ga0157370_1000146615 | 256 |
| 87 | 3300025909 | Ga0207705_10005150 | Ga0207705_1000515010 | 256 |
| 88 | 3300025909 | Ga0207705_10172084 | Ga0207705_101720841 | 256 |
| 89 | 3300025914 | Ga0207671_10045022 | Ga0207671_100450223 | 256 |
| 90 | 3300025949 | Ga0207667_10016441 | Ga0207667_100164417 | 256 |
| 91 | 3300025949 | Ga0207667_10042510 | Ga0207667_100425105 | 256 |
| 92 | 3300026035 | Ga0207703_10241927 | Ga0207703_102419272 | 256 |
| 93 | 3300026078 | Ga0207702_10000850 | Ga0207702_100008504 | 256 |
| 94 | 3300026116 | Ga0207674_10609831 | Ga0207674_106098312 | 256 |
| 95 | 3300028381 | Ga0268264_10416132 | Ga0268264_104161321 | 256 |
| 96 | 3300031250 | Ga0265331_10067772 | Ga0265331_100677722 | 256 |
| 97 | 3300031251 | Ga0265327_10000379 | Ga0265327_1000037958 | 256 |
| 98 | 3300031251 | Ga0265327_10008906 | Ga0265327_100089065 | 256 |
| 99 | 3300039437 | Ga0436365_0987856 | Ga0436365_0987856_2737_3519 | 256 |
| 100 | 3300046461 | Ga0495641_0051229 | Ga0495641_0051229_190_972 | 256 |
| 101 | 3300046499 | Ga0495594_0166876 | Ga0495594_0166876_396_1178 | 256 |
| 102 | 3300046522 | Ga0495643_0000100 | Ga0495643_0000100_15211_15993 | 256 |
| 103 | 3300047315 | Ga0495581_0082437 | Ga0495581_0082437_1017_1799 | 256 |
| 104 | 3300047673 | Ga0495593_0016150 | Ga0495593_0016150_2026_2808 | 256 |
| 105 | 3300048904 | Ga0496101_0097909 | Ga0496101_0097909_309_1094 | 256 |
| 106 | 3300048905 | Ga0496102_0101641 | Ga0496102_0101641_584_1369 | 256 |
| 107 | 3300048906 | Ga0496103_0020774 | Ga0496103_0020774_702_1487 | 256 |
| 108 | 3300048909 | Ga0496106_0065016 | Ga0496106_0065016_1068_1853 | 256 |
| 109 | 3300048910 | Ga0496107_0136729 | Ga0496107_0136729_584_1369 | 256 |
| 110 | 3300048916 | Ga0496113_0439987 | Ga0496113_0439987_166_945 | 256 |
| 111 | 3300048917 | Ga0496114_0089551 | Ga0496114_0089551_344_1129 | 256 |
| 112 | 3300048917 | Ga0496114_0161313 | Ga0496114_0161313_790_1572 | 256 |
| 113 | 3300048925 | Ga0496122_0000020 | Ga0496122_0000020_219702_220481 | 256 |
| 114 | 3300048926 | Ga0496123_0000003 | Ga0496123_0000003_434826_435605 | 256 |
| 115 | 3300049578 | Ga0501042_0324275 | Ga0501042_0324275_261_1043 | 256 |
| 116 | 3300049580 | Ga0501046_0113966 | Ga0501046_0113966_43_825 | 256 |
| 117 | 3300049590 | Ga0501074_0265867 | Ga0501074_0265867_253_1035 | 256 |
| 118 | 3300049824 | Ga0501045_0354568 | Ga0501045_0354568_122_904 | 256 |
| 119 | 3300003320 | rootH2_10056900 | rootH2_100569008 | 257 |
| 120 | 3300005295 | Ga0065707_10152426 | Ga0065707_101524262 | 257 |
| 121 | 3300005335 | Ga0070666_10477568 | Ga0070666_104775681 | 257 |
| 122 | 3300005336 | Ga0070680_100243200 | Ga0070680_1002432002 | 257 |
| 123 | 3300005355 | Ga0070671_100147213 | Ga0070671_1001472133 | 257 |
| 124 | 3300005434 | Ga0070709_10090208 | Ga0070709_100902083 | 257 |
| 125 | 3300005436 | Ga0070713_100034720 | Ga0070713_1000347203 | 257 |
| 126 | 3300005467 | Ga0070706_100125768 | Ga0070706_1001257682 | 257 |
| 127 | 3300005468 | Ga0070707_100119078 | Ga0070707_1001190783 | 257 |
| 128 | 3300005468 | Ga0070707_100166474 | Ga0070707_1001664742 | 257 |
| 129 | 3300005536 | Ga0070697_100358539 | Ga0070697_1003585392 | 257 |
| 130 | 3300005548 | Ga0070665_100003533 | Ga0070665_10000353314 | 257 |
| 131 | 3300005548 | Ga0070665_100006351 | Ga0070665_1000063516 | 257 |
| 132 | 3300005617 | Ga0068859_100176187 | Ga0068859_1001761872 | 257 |
| 133 | 3300005841 | Ga0068863_100039094 | Ga0068863_1000390942 | 257 |
| 134 | 3300005842 | Ga0068858_100032877 | Ga0068858_1000328772 | 257 |
| 135 | 3300005844 | Ga0068862_100018556 | Ga0068862_1000185563 | 257 |
| 136 | 3300006175 | Ga0070712_100078910 | Ga0070712_1000789103 | 257 |
| 137 | 3300006175 | Ga0070712_100214452 | Ga0070712_1002144521 | 257 |
| 138 | 3300006237 | Ga0097621_100005759 | Ga0097621_1000057594 | 257 |
| 139 | 3300006358 | Ga0068871_100004868 | Ga0068871_1000048685 | 257 |
| 140 | 3300006358 | Ga0068871_100027829 | Ga0068871_1000278293 | 257 |
| 141 | 3300006871 | Ga0075434_100009797 | Ga0075434_1000097976 | 257 |
| 142 | 3300006881 | Ga0068865_100046239 | Ga0068865_1000462393 | 257 |
| 143 | 3300006931 | Ga0097620_100176184 | Ga0097620_1001761842 | 257 |
| 144 | 3300009094 | Ga0111539_10204345 | Ga0111539_102043452 | 257 |
| 145 | 3300009177 | Ga0105248_10154508 | Ga0105248_101545082 | 257 |
| 146 | 3300009545 | Ga0105237_10411180 | Ga0105237_104111801 | 257 |
| 147 | 3300009553 | Ga0105249_10431244 | Ga0105249_104312441 | 257 |
| 148 | 3300013104 | Ga0157370_10457614 | Ga0157370_104576141 | 257 |
| 149 | 3300013297 | Ga0157378_10189556 | Ga0157378_101895562 | 257 |
| 150 | 3300013308 | Ga0157375_10048914 | Ga0157375_100489144 | 257 |
| 151 | 3300014969 | Ga0157376_10000207 | Ga0157376_1000020717 | 257 |
| 152 | 3300014969 | Ga0157376_10009298 | Ga0157376_100092982 | 257 |
| 153 | 3300025298 | Ga0209050_1000369 | Ga0209050_10003697 | 257 |
| 154 | 3300025903 | Ga0207680_10440704 | Ga0207680_104407041 | 257 |
| 155 | 3300025906 | Ga0207699_10051434 | Ga0207699_100514342 | 257 |
| 156 | 3300025910 | Ga0207684_10111301 | Ga0207684_101113013 | 257 |
| 157 | 3300025915 | Ga0207693_10006107 | Ga0207693_100061074 | 257 |
| 158 | 3300025915 | Ga0207693_10113352 | Ga0207693_101133522 | 257 |
| 159 | 3300025915 | Ga0207693_10248365 | Ga0207693_102483652 | 257 |
| 160 | 3300025916 | Ga0207663_10052777 | Ga0207663_100527774 | 257 |
| 161 | 3300025922 | Ga0207646_10090648 | Ga0207646_100906482 | 257 |
| 162 | 3300025922 | Ga0207646_10115962 | Ga0207646_101159622 | 257 |
| 163 | 3300025928 | Ga0207700_10020357 | Ga0207700_100203572 | 257 |
| 164 | 3300025939 | Ga0207665_10002030 | Ga0207665_100020307 | 257 |
| 165 | 3300025939 | Ga0207665_10007247 | Ga0207665_100072474 | 257 |
| 166 | 3300025939 | Ga0207665_10018343 | Ga0207665_100183432 | 257 |
| 167 | 3300025941 | Ga0207711_10158267 | Ga0207711_101582672 | 257 |
| 168 | 3300025961 | Ga0207712_10641706 | Ga0207712_106417061 | 257 |
| 169 | 3300026035 | Ga0207703_10031024 | Ga0207703_100310243 | 257 |
| 170 | 3300026088 | Ga0207641_10011932 | Ga0207641_100119324 | 257 |
| 171 | 3300028379 | Ga0268266_10003211 | Ga0268266_100032113 | 257 |
| 172 | 3300028380 | Ga0268265_10031900 | Ga0268265_100319002 | 257 |
| 173 | 3300032002 | Ga0307416_100226065 | Ga0307416_1002260652 | 257 |
| 174 | 3300035691 | Ga0373931_0117684 | Ga0373931_0117684_250_1044 | 257 |
| 175 | 3300037068 | Ga0373925_0076089 | Ga0373925_0076089_340_1134 | 257 |
| 176 | 3300042876 | Ga0451577_0034191 | Ga0451577_0034191_3253_4026 | 257 |
| 177 | 3300045051 | Ga0451576_0047370 | Ga0451576_0047370_1772_2545 | 257 |
| 178 | 3300046461 | Ga0495641_0024623 | Ga0495641_0024623_1050_1844 | 257 |
| 179 | 3300046472 | Ga0495580_0001731 | Ga0495580_0001731_1393_2187 | 257 |
| 180 | 3300046472 | Ga0495580_0283737 | Ga0495580_0283737_103_897 | 257 |
| 181 | 3300046473 | Ga0495582_0002798 | Ga0495582_0002798_1873_2667 | 257 |
| 182 | 3300046473 | Ga0495582_0025791 | Ga0495582_0025791_1973_2767 | 257 |
| 183 | 3300046475 | Ga0495639_0013297 | Ga0495639_0013297_35_829 | 257 |
| 184 | 3300046499 | Ga0495594_0048224 | Ga0495594_0048224_317_1111 | 257 |
| 185 | 3300046517 | Ga0495630_0024645 | Ga0495630_0024645_923_1717 | 257 |
| 186 | 3300046517 | Ga0495630_0078116 | Ga0495630_0078116_994_1779 | 257 |
| 187 | 3300046531 | Ga0495665_0003234 | Ga0495665_0003234_6263_7057 | 257 |
| 188 | 3300046533 | Ga0495640_0006426 | Ga0495640_0006426_1011_1805 | 257 |
| 189 | 3300046535 | Ga0495586_0059432 | Ga0495586_0059432_1082_1876 | 257 |
| 190 | 3300046663 | Ga0495635_0205977 | Ga0495635_0205977_464_1258 | 257 |
| 191 | 3300046681 | Ga0495647_0001438 | Ga0495647_0001438_3423_4217 | 257 |
| 192 | 3300046683 | Ga0495658_0008741 | Ga0495658_0008741_2856_3650 | 257 |
| 193 | 3300046689 | Ga0495613_0008822 | Ga0495613_0008822_1837_2631 | 257 |
| 194 | 3300047315 | Ga0495581_0053044 | Ga0495581_0053044_1233_2027 | 257 |
| 195 | 3300047319 | Ga0495674_0110390 | Ga0495674_0110390_309_1103 | 257 |
| 196 | 3300047471 | Ga0495684_0024388 | Ga0495684_0024388_1383_2177 | 257 |
| 197 | 3300047673 | Ga0495593_0178625 | Ga0495593_0178625_262_1056 | 257 |
| 198 | 3300048089 | Ga0495614_0039158 | Ga0495614_0039158_1122_1916 | 257 |
| 199 | 3300048904 | Ga0496101_0228488 | Ga0496101_0228488_371_1165 | 257 |
| 200 | 3300048908 | Ga0496105_0251738 | Ga0496105_0251738_61_855 | 257 |
| 201 | 3300048917 | Ga0496114_0051240 | Ga0496114_0051240_1321_2115 | 257 |
| 202 | 3300048918 | Ga0496115_0023249 | Ga0496115_0023249_580_1374 | 257 |
| 203 | 3300048920 | Ga0496117_0000387 | Ga0496117_0000387_55790_56578 | 257 |
| 204 | 3300048925 | Ga0496122_0004879 | Ga0496122_0004879_6218_7006 | 257 |
| 205 | 3300048926 | Ga0496123_0008151 | Ga0496123_0008151_6847_7635 | 257 |
| 206 | 3300049572 | Ga0501036_0304300 | Ga0501036_0304300_498_1307 | 257 |
| 207 | 3300049579 | Ga0501043_0108433 | Ga0501043_0108433_1003_1812 | 257 |
| 208 | 3300049822 | Ga0501035_0286253 | Ga0501035_0286253_278_1087 | 257 |
| 209 | 3300050512 | nmdc:mga0n895_226040_c1 | nmdc:mga0n895_226040_c1_190_984 | 257 |
| 210 | 3300050512 | nmdc:mga0n895_41541_c1 | nmdc:mga0n895_41541_c1_127_921 | 257 |
| 211 | 3300050512 | nmdc:mga0n895_418731_c1 | nmdc:mga0n895_418731_c1_176_1048 | 257 |
| 212 | 3300050513 | nmdc:mga0rr50_4028_c1 | nmdc:mga0rr50_4028_c1_2011_2805 | 257 |
| 213 | 3300050513 | nmdc:mga0rr50_622203_c1 | nmdc:mga0rr50_622203_c1_55_849 | 257 |
| 214 | 3300050515 | nmdc:mga0a205_345798_c1 | nmdc:mga0a205_345798_c1_282_1076 | 257 |
| 215 | 3300053153 | Ga0500616_0000027 | Ga0500616_0000027_124848_125636 | 257 |
| 216 | 3300053153 | Ga0500616_0014577 | Ga0500616_0014577_369_1160 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hn6-assembly1.cif.gz_D | crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi | 0.9855 | 1 | 246 |
| 3hn6-assembly1.cif.gz_E | crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi | 0.9734 | 1 | 246 |
| 7lqn-assembly2.cif.gz_I | glucosamine-6-phosphate deaminase from h. influenzae | 0.9707 | 1 | 246 |
| 7lqm-assembly1.cif.gz_B | glucosamie-6-phosphate deaminase from pasturella multocida | 0.9704 | 1 | 248 |
| 1ne7-assembly1.cif.gz_E | human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino-glucitol-6-phosphate | 0.9702 | 1 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q04802_1_247_3.40.50.1360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9764 | 1 | 238 | 3.40.50.1360 |
| af_Q54M58_36_296_3.40.50.1360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9758 | 1 | 239 | 3.40.50.1360 |
| 2bkxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9708 | 1 | 237 | 3.40.50.1360 |
| 1d9tA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9682 | 1 | 246 | 3.40.50.1360 |
| af_M0RCH5_1_250_3.40.50.1360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9653 | 36 | 246 | 3.40.50.1360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A286SBN4-F1-model_v4 | glucosamine-6-phosphate deaminase (EC 3.5.99.6) (Glucosamine-6-phosphate deaminase) | 0.9935 | 96 | 230 |
GO:0004342
GO:0005737 GO:0005975 GO:0006043 GO:0006046 GO:0016853 GO:0019262 GO:0042802 |
| AF-A0A7X8H9W1-F1-model_v4 | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) | 0.9933 | 1 | 233 |
GO:0004342
GO:0005737 GO:0005975 GO:0006043 GO:0006046 GO:0019262 GO:0042802 |
| AF-A0A6V7KCE2-F1-model_v4 | glucosamine-6-phosphate deaminase (EC 3.5.99.6) (Glucosamine-6-phosphate deaminase) | 0.9932 | 34 | 122 |
GO:0004342
GO:0005737 GO:0005975 GO:0006043 GO:0006046 GO:0019262 GO:0042802 |
| AF-A0A1W2DH45-F1-model_v4 | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) | 0.9929 | 1 | 247 |
GO:0004342
GO:0005737 GO:0005975 GO:0006043 GO:0006046 GO:0019262 GO:0042802 |
| AF-A0A4R3ZTM4-F1-model_v4 | deleted | 0.9925 | 1 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar