F328119

General Info

Members Datasets Scaffolds Average Seq Length
216 162 201 261

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_418731_c1|nmdc:mga0n895_418731_c1_176_1048
Length 290
Sequence LNPDRPLDTPLSAGGRRLVCKEIFREMLVVLKKDYGDVSREAARIVAGAVRAKPDIVLGLATGGTPLGLYKELVALYRADSLDFSRVTSFNLDEYLGLAPSHPQSFHHFMEENLFSQINLPRERAHVPDGTISGDYDNYCARYEQRIKAAGGIDLQVLGIGRNGHIGFNEPTSSLASRTRLKALSRETIEDNRHVFANESEMPKCAITMGIGTILDCKRVLILASGRAKAAAVAKAIEGPITSSVSASALQMHPDVTFIIDEEAAYSLTQRDYYRHVLEMTRLFTPERLS

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221575 Microbacterium sp. Root61 Isolate Unclassified
3 2643221679 Angustibacter sp. Root456 Isolate Unclassified
4 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
5 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
6 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
7 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
8 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
11 2922554459 Rhodococcus sp. 66b Isolate Unclassified
12 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
161 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
162 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 8.33
Rhizosphere 73.15
Stem 0
Stem Tuber 0
Unclassified 14.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10056900 3300003320 Bacteria 14127
2 Ga0065714_10129430 3300005288 Bacteria 1255
3 Ga0065707_10152426 3300005295 Bacteria 1644
4 Ga0070658_10093794 3300005327 Bacteria 2476
5 Ga0070666_10477568 3300005335 Bacteria 902
6 Ga0070680_100243200 3300005336 Bacteria 1521
7 Ga0070660_100054840 3300005339 Bacteria 3079
8 Ga0070671_100147213 3300005355 Bacteria 1988
9 Ga0070709_10090208 3300005434 Bacteria 2020
10 Ga0070713_100034720 3300005436 Bacteria 4055
11 Ga0070706_100125768 3300005467 Unclassified 2390
12 Ga0070707_100119078 3300005468 Bacteria 2563
13 Ga0070707_100166474 3300005468 Unclassified 2148
14 Ga0070697_100358539 3300005536 Unclassified 1260
15 Ga0070665_100003533 3300005548 Bacteria 16619
16 Ga0070665_100006351 3300005548 Bacteria 12058
17 Ga0068855_100003918 3300005563 Bacteria 18172
18 Ga0068855_100033680 3300005563 Bacteria 6112
19 Ga0068855_100410901 3300005563 Bacteria 1482
20 Ga0068857_100348540 3300005577 Bacteria 1371
21 Ga0068856_100000426 3300005614 Bacteria 46290
22 Ga0068852_100179850 3300005616 Bacteria 1988
23 Ga0068859_100176187 3300005617 Unclassified 2220
24 Ga0068863_100039094 3300005841 Bacteria 4515
25 Ga0068858_100032877 3300005842 Bacteria 4817
26 Ga0068858_100087476 3300005842 Bacteria 2898
27 Ga0068858_100138532 3300005842 Bacteria 2284
28 Ga0068860_100133088 3300005843 Bacteria 2387
29 Ga0068862_100018556 3300005844 Bacteria 5795
30 Ga0075363_100033798 3300006048 Bacteria 2666
31 Ga0070712_100078910 3300006175 Bacteria 2378
32 Ga0070712_100214452 3300006175 Unclassified 1520
33 Ga0097621_100005759 3300006237 Bacteria 8746
34 Ga0075370_10050855 3300006353 Bacteria 2351
35 Ga0068871_100004868 3300006358 Bacteria 9384
36 Ga0068871_100027829 3300006358 Bacteria 4426
37 Ga0075428_100099773 3300006844 Bacteria 3166
38 Ga0075431_100388513 3300006847 Bacteria 1398
39 Ga0075434_100009797 3300006871 Bacteria 8960
40 Ga0068865_100046239 3300006881 Bacteria 2986
41 Ga0097620_100176184 3300006931 Unclassified 2220
42 Ga0111539_10204345 3300009094 Unclassified 2303
43 Ga0114129_10124501 3300009147 Bacteria 3545
44 Ga0105248_10154508 3300009177 Bacteria 2589
45 Ga0105237_10004906 3300009545 Bacteria 15308
46 Ga0105237_10020693 3300009545 Bacteria 6777
47 Ga0105237_10038560 3300009545 Bacteria 4825
48 Ga0105237_10411180 3300009545 Unclassified 1358
49 Ga0105249_10431244 3300009553 Unclassified 1354
50 Ga0105239_10017145 3300010375 Bacteria 8007
51 Ga0105239_10173756 3300010375 Bacteria 2410
52 Ga0157371_10051513 3300013102 Bacteria 2925
53 Ga0157370_10001466 3300013104 Bacteria 29160
54 Ga0157370_10457614 3300013104 Bacteria 1173
55 Ga0157378_10189556 3300013297 Bacteria 1939
56 Ga0163162_10074053 3300013306 Bacteria 3463
57 Ga0157375_10048914 3300013308 Bacteria 4139
58 Ga0157376_10000207 3300014969 Bacteria 40872
59 Ga0157376_10009298 3300014969 Bacteria 7138
60 Ga0163161_10238984 3300017792 Bacteria 1412
61 Ga0209050_1000369 3300025298 Bacteria 86187
62 Ga0207680_10440704 3300025903 Bacteria 924
63 Ga0207699_10051434 3300025906 Bacteria 2434
64 Ga0207705_10005150 3300025909 Bacteria 9800
65 Ga0207705_10172084 3300025909 Bacteria 1631
66 Ga0207684_10111301 3300025910 Unclassified 2344
67 Ga0207671_10009484 3300025914 Bacteria 8130
68 Ga0207671_10045022 3300025914 Bacteria 3262
69 Ga0207693_10006107 3300025915 Bacteria 9982
70 Ga0207693_10113352 3300025915 Bacteria 2127
71 Ga0207693_10248365 3300025915 Unclassified 1396
72 Ga0207663_10052777 3300025916 Unclassified 2537
73 Ga0207646_10090648 3300025922 Unclassified 2736
74 Ga0207646_10115962 3300025922 Bacteria 2406
75 Ga0207681_10013666 3300025923 Bacteria 5027
76 Ga0207700_10020357 3300025928 Unclassified 4504
77 Ga0207665_10002030 3300025939 Bacteria 13626
78 Ga0207665_10007247 3300025939 Bacteria 7336
79 Ga0207665_10018343 3300025939 Bacteria 4599
80 Ga0207711_10158267 3300025941 Bacteria 2048
81 Ga0207667_10016441 3300025949 Bacteria 8360
82 Ga0207667_10042510 3300025949 Bacteria 4829
83 Ga0207667_10501821 3300025949 Bacteria 1231
84 Ga0207712_10641706 3300025961 Bacteria 922
85 Ga0207703_10031024 3300026035 Bacteria 4226
86 Ga0207703_10241927 3300026035 Bacteria 1623
87 Ga0207702_10000850 3300026078 Bacteria 31954
88 Ga0207641_10011932 3300026088 Bacteria 7130
89 Ga0207674_10609831 3300026116 Bacteria 1054
90 Ga0207675_100213928 3300026118 Bacteria 1855
91 Ga0268266_10003211 3300028379 Bacteria 16531
92 Ga0268265_10031900 3300028380 Bacteria 3810
93 Ga0268264_10416132 3300028381 Bacteria 1295
94 Ga0265331_10067772 3300031250 Unclassified 1674
95 Ga0265327_10000379 3300031251 Bacteria 83712
96 Ga0265327_10008906 3300031251 Bacteria 7367
97 Ga0307408_100423534 3300031548 Bacteria 1148
98 Ga0307413_10236130 3300031824 Bacteria 1346
99 Ga0307410_10362898 3300031852 Bacteria 1160
100 Ga0307407_10077607 3300031903 Bacteria 1998
101 Ga0307409_100038560 3300031995 Bacteria 3535
102 Ga0307416_100226065 3300032002 Bacteria 1800
103 Ga0373931_0117684 3300035691 Bacteria 1515
104 Ga0373925_0076089 3300037068 Bacteria 2545
105 Ga0395898_0234273 3300037466 Bacteria 1751
106 Ga0436365_0987856 3300039437 Bacteria 6970
107 Ga0451853_3245237 3300041512 Bacteria 11076
108 Ga0451577_0034191 3300042876 Bacteria 4584
109 Ga0466959_0114659 3300045049 Bacteria 1920
110 Ga0451576_0047370 3300045051 Bacteria 4520
111 Ga0466958_0167201 3300045836 Bacteria 1392
112 Ga0495641_0024623 3300046461 Bacteria 2968
113 Ga0495641_0051229 3300046461 Bacteria 1886
114 Ga0495580_0001731 3300046472 Bacteria 19168
115 Ga0495580_0283737 3300046472 Bacteria 1129
116 Ga0495582_0002798 3300046473 Bacteria 9748
117 Ga0495582_0025791 3300046473 Unclassified 3220
118 Ga0495639_0013297 3300046475 Bacteria 3553
119 Ga0495594_0048224 3300046499 Unclassified 2340
120 Ga0495594_0166876 3300046499 Bacteria 1252
121 Ga0495628_0324731 3300046516 Bacteria 1135
122 Ga0495630_0024645 3300046517 Bacteria 4446
123 Ga0495630_0078116 3300046517 Bacteria 2496
124 Ga0495643_0000100 3300046522 Bacteria 144402
125 Ga0495648_0019828 3300046524 Bacteria 4710
126 Ga0495665_0003234 3300046531 Bacteria 8813
127 Ga0495640_0006426 3300046533 Bacteria 9292
128 Ga0495586_0059432 3300046535 Bacteria 2077
129 Ga0495668_0010618 3300046616 Bacteria 5565
130 Ga0495635_0205977 3300046663 Bacteria 1333
131 Ga0495647_0001438 3300046681 Bacteria 7373
132 Ga0495658_0008741 3300046683 Bacteria 5030
133 Ga0495613_0008822 3300046689 Bacteria 7478
134 Ga0495581_0053044 3300047315 Bacteria 2342
135 Ga0495581_0082437 3300047315 Bacteria 1863
136 Ga0495674_0110390 3300047319 Bacteria 2332
137 Ga0495672_0016176 3300047320 Bacteria 5040
138 Ga0495673_0002873 3300047469 Bacteria 11717
139 Ga0495684_0024388 3300047471 Bacteria 4656
140 Ga0495593_0016150 3300047673 Bacteria 4214
141 Ga0495593_0178625 3300047673 Bacteria 1069
142 Ga0495614_0039158 3300048089 Bacteria 2034
143 Ga0496100_0005022 3300048903 Bacteria 7080
144 Ga0496101_0000021 3300048904 Bacteria 217090
145 Ga0496101_0097909 3300048904 Bacteria 2191
146 Ga0496101_0228488 3300048904 Unclassified 1446
147 Ga0496102_0000001 3300048905 Bacteria 873433
148 Ga0496102_0101641 3300048905 Bacteria 2671
149 Ga0496103_0000007 3300048906 Bacteria 354915
150 Ga0496103_0020774 3300048906 Bacteria 3947
151 Ga0496105_0251738 3300048908 Unclassified 1431
152 Ga0496106_0005783 3300048909 Bacteria 9146
153 Ga0496106_0065016 3300048909 Bacteria 2776
154 Ga0496107_0136729 3300048910 Bacteria 1810
155 Ga0496108_0122525 3300048911 Bacteria 2231
156 Ga0496113_0439987 3300048916 Bacteria 1047
157 Ga0496114_0051240 3300048917 Bacteria 3437
158 Ga0496114_0089551 3300048917 Bacteria 2611
159 Ga0496114_0161313 3300048917 Bacteria 1950
160 Ga0496115_0023249 3300048918 Unclassified 4809
161 Ga0496116_0000018 3300048919 Bacteria 545877
162 Ga0496116_0013776 3300048919 Bacteria 6498
163 Ga0496117_0000015 3300048920 Bacteria 583316
164 Ga0496117_0000387 3300048920 Bacteria 75589
165 Ga0496118_0000012 3300048921 Bacteria 583316
166 Ga0496118_0095011 3300048921 Bacteria 2036
167 Ga0496119_0032134 3300048922 Bacteria 3503
168 Ga0496120_0010873 3300048923 Bacteria 6299
169 Ga0496121_0000809 3300048924 Bacteria 56983
170 Ga0496122_0000020 3300048925 Bacteria 401675
171 Ga0496122_0001200 3300048925 Bacteria 44223
172 Ga0496122_0004879 3300048925 Bacteria 16291
173 Ga0496122_0006600 3300048925 Bacteria 13242
174 Ga0496123_0000003 3300048926 Bacteria 866556
175 Ga0496123_0001124 3300048926 Bacteria 39914
176 Ga0496123_0008151 3300048926 Bacteria 9670
177 Ga0496124_0004596 3300048927 Bacteria 16001
178 Ga0496125_0051647 3300048928 Bacteria 3388
179 Ga0496126_0002555 3300048929 Bacteria 24367
180 Ga0496126_0145890 3300048929 Bacteria 2032
181 Ga0501036_0304300 3300049572 Bacteria 1333
182 Ga0501038_0040598 3300049574 Bacteria 4062
183 Ga0501042_0324275 3300049578 Bacteria 1113
184 Ga0501043_0108433 3300049579 Bacteria 2181
185 Ga0501046_0113966 3300049580 Bacteria 2063
186 Ga0501074_0265867 3300049590 Bacteria 1219
187 Ga0501035_0286253 3300049822 Bacteria 1392
188 Ga0501045_0354568 3300049824 Bacteria 1092
189 nmdc:mga05p37_73541_c1 3300050507 Bacteria 4206
190 nmdc:mga0n895_226040_c1 3300050512 Bacteria 1900
191 nmdc:mga0n895_41541_c1 3300050512 Unclassified 4472
192 nmdc:mga0n895_418731_c1 3300050512 Bacteria 1354
193 nmdc:mga0rr50_4028_c1 3300050513 Bacteria 8571
194 nmdc:mga0rr50_622203_c1 3300050513 Bacteria 921
195 nmdc:mga0a205_345798_c1 3300050515 Bacteria 1355
196 nmdc:mga0sz30_118413_c1 3300050516 Bacteria 1163
197 Ga0500556_0004730 3300053104 Bacteria 3862
198 Ga0500616_0000010 3300053153 Bacteria 761410
199 Ga0500616_0000027 3300053153 Bacteria 441053
200 Ga0500616_0004283 3300053153 Bacteria 10249
201 Ga0500616_0014577 3300053153 Bacteria 4513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100138532 Ga0068858_1001385322 230
2 3300053153 Ga0500616_0000010 Ga0500616_0000010_515312_516046 239
3 3300053153 Ga0500616_0004283 Ga0500616_0004283_6694_7476 240
4 3300048925 Ga0496122_0006600 Ga0496122_0006600_10153_10893 241
5 iso_pu_bacteria 2857460504 2857461889 241
6 3300005563 Ga0068855_100410901 Ga0068855_1004109012 243
7 3300025949 Ga0207667_10501821 Ga0207667_105018212 243
8 3300026118 Ga0207675_100213928 Ga0207675_1002139282 244
9 3300048919 Ga0496116_0013776 Ga0496116_0013776_3706_4485 244
10 3300048921 Ga0496118_0095011 Ga0496118_0095011_1131_1910 244
11 3300048927 Ga0496124_0004596 Ga0496124_0004596_10702_11481 244
12 3300048929 Ga0496126_0145890 Ga0496126_0145890_194_973 244
13 iso_pu_bacteria 2643221679 2644444796 248
14 iso_pu_bacteria 2565956761 2566991485 251
15 iso_pu_bacteria 2799112218 2799183779 251
16 iso_pu_bacteria 2842888712 2842890580 251
17 iso_pu_bacteria 2902792274 2902795007 251
18 iso_pu_bacteria 2904535858 2904541010 251
19 iso_pu_bacteria 2922554459 2922560653 251
20 iso_pu_bacteria 2953998280 2953998542 251
21 3300009545 Ga0105237_10038560 Ga0105237_100385604 252
22 iso_pu_bacteria 2855386786 2855388015 252
23 iso_pu_bacteria 8004021418 8004022212 252
24 3300046516 Ga0495628_0324731 Ga0495628_0324731_192_953 253
25 iso_pu_bacteria 2643221575 2643887216 253
26 3300053104 Ga0500556_0004730 Ga0500556_0004730_2138_2917 254
27 iso_pu_bacteria 2844852863 2844854406 254
28 iso_pu_bacteria 8056037122 8056039298 254
29 iso_pu_bacteria 8057345674 8057347491 254
30 3300005563 Ga0068855_100033680 Ga0068855_1000336805 255
31 3300005616 Ga0068852_100179850 Ga0068852_1001798502 255
32 3300006048 Ga0075363_100033798 Ga0075363_1000337982 255
33 3300006353 Ga0075370_10050855 Ga0075370_100508552 255
34 3300006844 Ga0075428_100099773 Ga0075428_1000997733 255
35 3300006847 Ga0075431_100388513 Ga0075431_1003885132 255
36 3300009147 Ga0114129_10124501 Ga0114129_101245012 255
37 3300009545 Ga0105237_10004906 Ga0105237_100049064 255
38 3300010375 Ga0105239_10017145 Ga0105239_100171453 255
39 3300013306 Ga0163162_10074053 Ga0163162_100740534 255
40 3300017792 Ga0163161_10238984 Ga0163161_102389842 255
41 3300025914 Ga0207671_10009484 Ga0207671_100094849 255
42 3300025923 Ga0207681_10013666 Ga0207681_100136663 255
43 3300031548 Ga0307408_100423534 Ga0307408_1004235342 255
44 3300031824 Ga0307413_10236130 Ga0307413_102361302 255
45 3300031852 Ga0307410_10362898 Ga0307410_103628981 255
46 3300031903 Ga0307407_10077607 Ga0307407_100776073 255
47 3300031995 Ga0307409_100038560 Ga0307409_1000385603 255
48 3300037466 Ga0395898_0234273 Ga0395898_0234273_633_1412 255
49 3300041512 Ga0451853_3245237 Ga0451853_3245237_3366_4145 255
50 3300045049 Ga0466959_0114659 Ga0466959_0114659_449_1228 255
51 3300045836 Ga0466958_0167201 Ga0466958_0167201_337_1116 255
52 3300046524 Ga0495648_0019828 Ga0495648_0019828_2629_3408 255
53 3300046616 Ga0495668_0010618 Ga0495668_0010618_202_981 255
54 3300047320 Ga0495672_0016176 Ga0495672_0016176_2629_3408 255
55 3300047469 Ga0495673_0002873 Ga0495673_0002873_8310_9089 255
56 3300048903 Ga0496100_0005022 Ga0496100_0005022_2473_3252 255
57 3300048904 Ga0496101_0000021 Ga0496101_0000021_199603_200382 255
58 3300048905 Ga0496102_0000001 Ga0496102_0000001_58001_58780 255
59 3300048906 Ga0496103_0000007 Ga0496103_0000007_296909_297688 255
60 3300048909 Ga0496106_0005783 Ga0496106_0005783_386_1165 255
61 3300048911 Ga0496108_0122525 Ga0496108_0122525_31_810 255
62 3300048919 Ga0496116_0000018 Ga0496116_0000018_21103_21882 255
63 3300048920 Ga0496117_0000015 Ga0496117_0000015_523996_524775 255
64 3300048921 Ga0496118_0000012 Ga0496118_0000012_523996_524775 255
65 3300048922 Ga0496119_0032134 Ga0496119_0032134_1121_1900 255
66 3300048923 Ga0496120_0010873 Ga0496120_0010873_5084_5863 255
67 3300048924 Ga0496121_0000809 Ga0496121_0000809_16709_17488 255
68 3300048925 Ga0496122_0001200 Ga0496122_0001200_5394_6164 255
69 3300048926 Ga0496123_0001124 Ga0496123_0001124_36390_37160 255
70 3300048928 Ga0496125_0051647 Ga0496125_0051647_2011_2790 255
71 3300048929 Ga0496126_0002555 Ga0496126_0002555_9444_10223 255
72 3300049574 Ga0501038_0040598 Ga0501038_0040598_1589_2368 255
73 3300050507 nmdc:mga05p37_73541_c1 nmdc:mga05p37_73541_c1_215_994 255
74 3300050516 nmdc:mga0sz30_118413_c1 nmdc:mga0sz30_118413_c1_318_1097 255
75 3300005288 Ga0065714_10129430 Ga0065714_101294302 256
76 3300005327 Ga0070658_10093794 Ga0070658_100937942 256
77 3300005339 Ga0070660_100054840 Ga0070660_1000548403 256
78 3300005563 Ga0068855_100003918 Ga0068855_1000039186 256
79 3300005577 Ga0068857_100348540 Ga0068857_1003485402 256
80 3300005614 Ga0068856_100000426 Ga0068856_10000042622 256
81 3300005842 Ga0068858_100087476 Ga0068858_1000874763 256
82 3300005843 Ga0068860_100133088 Ga0068860_1001330884 256
83 3300009545 Ga0105237_10020693 Ga0105237_100206934 256
84 3300010375 Ga0105239_10173756 Ga0105239_101737561 256
85 3300013102 Ga0157371_10051513 Ga0157371_100515132 256
86 3300013104 Ga0157370_10001466 Ga0157370_1000146615 256
87 3300025909 Ga0207705_10005150 Ga0207705_1000515010 256
88 3300025909 Ga0207705_10172084 Ga0207705_101720841 256
89 3300025914 Ga0207671_10045022 Ga0207671_100450223 256
90 3300025949 Ga0207667_10016441 Ga0207667_100164417 256
91 3300025949 Ga0207667_10042510 Ga0207667_100425105 256
92 3300026035 Ga0207703_10241927 Ga0207703_102419272 256
93 3300026078 Ga0207702_10000850 Ga0207702_100008504 256
94 3300026116 Ga0207674_10609831 Ga0207674_106098312 256
95 3300028381 Ga0268264_10416132 Ga0268264_104161321 256
96 3300031250 Ga0265331_10067772 Ga0265331_100677722 256
97 3300031251 Ga0265327_10000379 Ga0265327_1000037958 256
98 3300031251 Ga0265327_10008906 Ga0265327_100089065 256
99 3300039437 Ga0436365_0987856 Ga0436365_0987856_2737_3519 256
100 3300046461 Ga0495641_0051229 Ga0495641_0051229_190_972 256
101 3300046499 Ga0495594_0166876 Ga0495594_0166876_396_1178 256
102 3300046522 Ga0495643_0000100 Ga0495643_0000100_15211_15993 256
103 3300047315 Ga0495581_0082437 Ga0495581_0082437_1017_1799 256
104 3300047673 Ga0495593_0016150 Ga0495593_0016150_2026_2808 256
105 3300048904 Ga0496101_0097909 Ga0496101_0097909_309_1094 256
106 3300048905 Ga0496102_0101641 Ga0496102_0101641_584_1369 256
107 3300048906 Ga0496103_0020774 Ga0496103_0020774_702_1487 256
108 3300048909 Ga0496106_0065016 Ga0496106_0065016_1068_1853 256
109 3300048910 Ga0496107_0136729 Ga0496107_0136729_584_1369 256
110 3300048916 Ga0496113_0439987 Ga0496113_0439987_166_945 256
111 3300048917 Ga0496114_0089551 Ga0496114_0089551_344_1129 256
112 3300048917 Ga0496114_0161313 Ga0496114_0161313_790_1572 256
113 3300048925 Ga0496122_0000020 Ga0496122_0000020_219702_220481 256
114 3300048926 Ga0496123_0000003 Ga0496123_0000003_434826_435605 256
115 3300049578 Ga0501042_0324275 Ga0501042_0324275_261_1043 256
116 3300049580 Ga0501046_0113966 Ga0501046_0113966_43_825 256
117 3300049590 Ga0501074_0265867 Ga0501074_0265867_253_1035 256
118 3300049824 Ga0501045_0354568 Ga0501045_0354568_122_904 256
119 3300003320 rootH2_10056900 rootH2_100569008 257
120 3300005295 Ga0065707_10152426 Ga0065707_101524262 257
121 3300005335 Ga0070666_10477568 Ga0070666_104775681 257
122 3300005336 Ga0070680_100243200 Ga0070680_1002432002 257
123 3300005355 Ga0070671_100147213 Ga0070671_1001472133 257
124 3300005434 Ga0070709_10090208 Ga0070709_100902083 257
125 3300005436 Ga0070713_100034720 Ga0070713_1000347203 257
126 3300005467 Ga0070706_100125768 Ga0070706_1001257682 257
127 3300005468 Ga0070707_100119078 Ga0070707_1001190783 257
128 3300005468 Ga0070707_100166474 Ga0070707_1001664742 257
129 3300005536 Ga0070697_100358539 Ga0070697_1003585392 257
130 3300005548 Ga0070665_100003533 Ga0070665_10000353314 257
131 3300005548 Ga0070665_100006351 Ga0070665_1000063516 257
132 3300005617 Ga0068859_100176187 Ga0068859_1001761872 257
133 3300005841 Ga0068863_100039094 Ga0068863_1000390942 257
134 3300005842 Ga0068858_100032877 Ga0068858_1000328772 257
135 3300005844 Ga0068862_100018556 Ga0068862_1000185563 257
136 3300006175 Ga0070712_100078910 Ga0070712_1000789103 257
137 3300006175 Ga0070712_100214452 Ga0070712_1002144521 257
138 3300006237 Ga0097621_100005759 Ga0097621_1000057594 257
139 3300006358 Ga0068871_100004868 Ga0068871_1000048685 257
140 3300006358 Ga0068871_100027829 Ga0068871_1000278293 257
141 3300006871 Ga0075434_100009797 Ga0075434_1000097976 257
142 3300006881 Ga0068865_100046239 Ga0068865_1000462393 257
143 3300006931 Ga0097620_100176184 Ga0097620_1001761842 257
144 3300009094 Ga0111539_10204345 Ga0111539_102043452 257
145 3300009177 Ga0105248_10154508 Ga0105248_101545082 257
146 3300009545 Ga0105237_10411180 Ga0105237_104111801 257
147 3300009553 Ga0105249_10431244 Ga0105249_104312441 257
148 3300013104 Ga0157370_10457614 Ga0157370_104576141 257
149 3300013297 Ga0157378_10189556 Ga0157378_101895562 257
150 3300013308 Ga0157375_10048914 Ga0157375_100489144 257
151 3300014969 Ga0157376_10000207 Ga0157376_1000020717 257
152 3300014969 Ga0157376_10009298 Ga0157376_100092982 257
153 3300025298 Ga0209050_1000369 Ga0209050_10003697 257
154 3300025903 Ga0207680_10440704 Ga0207680_104407041 257
155 3300025906 Ga0207699_10051434 Ga0207699_100514342 257
156 3300025910 Ga0207684_10111301 Ga0207684_101113013 257
157 3300025915 Ga0207693_10006107 Ga0207693_100061074 257
158 3300025915 Ga0207693_10113352 Ga0207693_101133522 257
159 3300025915 Ga0207693_10248365 Ga0207693_102483652 257
160 3300025916 Ga0207663_10052777 Ga0207663_100527774 257
161 3300025922 Ga0207646_10090648 Ga0207646_100906482 257
162 3300025922 Ga0207646_10115962 Ga0207646_101159622 257
163 3300025928 Ga0207700_10020357 Ga0207700_100203572 257
164 3300025939 Ga0207665_10002030 Ga0207665_100020307 257
165 3300025939 Ga0207665_10007247 Ga0207665_100072474 257
166 3300025939 Ga0207665_10018343 Ga0207665_100183432 257
167 3300025941 Ga0207711_10158267 Ga0207711_101582672 257
168 3300025961 Ga0207712_10641706 Ga0207712_106417061 257
169 3300026035 Ga0207703_10031024 Ga0207703_100310243 257
170 3300026088 Ga0207641_10011932 Ga0207641_100119324 257
171 3300028379 Ga0268266_10003211 Ga0268266_100032113 257
172 3300028380 Ga0268265_10031900 Ga0268265_100319002 257
173 3300032002 Ga0307416_100226065 Ga0307416_1002260652 257
174 3300035691 Ga0373931_0117684 Ga0373931_0117684_250_1044 257
175 3300037068 Ga0373925_0076089 Ga0373925_0076089_340_1134 257
176 3300042876 Ga0451577_0034191 Ga0451577_0034191_3253_4026 257
177 3300045051 Ga0451576_0047370 Ga0451576_0047370_1772_2545 257
178 3300046461 Ga0495641_0024623 Ga0495641_0024623_1050_1844 257
179 3300046472 Ga0495580_0001731 Ga0495580_0001731_1393_2187 257
180 3300046472 Ga0495580_0283737 Ga0495580_0283737_103_897 257
181 3300046473 Ga0495582_0002798 Ga0495582_0002798_1873_2667 257
182 3300046473 Ga0495582_0025791 Ga0495582_0025791_1973_2767 257
183 3300046475 Ga0495639_0013297 Ga0495639_0013297_35_829 257
184 3300046499 Ga0495594_0048224 Ga0495594_0048224_317_1111 257
185 3300046517 Ga0495630_0024645 Ga0495630_0024645_923_1717 257
186 3300046517 Ga0495630_0078116 Ga0495630_0078116_994_1779 257
187 3300046531 Ga0495665_0003234 Ga0495665_0003234_6263_7057 257
188 3300046533 Ga0495640_0006426 Ga0495640_0006426_1011_1805 257
189 3300046535 Ga0495586_0059432 Ga0495586_0059432_1082_1876 257
190 3300046663 Ga0495635_0205977 Ga0495635_0205977_464_1258 257
191 3300046681 Ga0495647_0001438 Ga0495647_0001438_3423_4217 257
192 3300046683 Ga0495658_0008741 Ga0495658_0008741_2856_3650 257
193 3300046689 Ga0495613_0008822 Ga0495613_0008822_1837_2631 257
194 3300047315 Ga0495581_0053044 Ga0495581_0053044_1233_2027 257
195 3300047319 Ga0495674_0110390 Ga0495674_0110390_309_1103 257
196 3300047471 Ga0495684_0024388 Ga0495684_0024388_1383_2177 257
197 3300047673 Ga0495593_0178625 Ga0495593_0178625_262_1056 257
198 3300048089 Ga0495614_0039158 Ga0495614_0039158_1122_1916 257
199 3300048904 Ga0496101_0228488 Ga0496101_0228488_371_1165 257
200 3300048908 Ga0496105_0251738 Ga0496105_0251738_61_855 257
201 3300048917 Ga0496114_0051240 Ga0496114_0051240_1321_2115 257
202 3300048918 Ga0496115_0023249 Ga0496115_0023249_580_1374 257
203 3300048920 Ga0496117_0000387 Ga0496117_0000387_55790_56578 257
204 3300048925 Ga0496122_0004879 Ga0496122_0004879_6218_7006 257
205 3300048926 Ga0496123_0008151 Ga0496123_0008151_6847_7635 257
206 3300049572 Ga0501036_0304300 Ga0501036_0304300_498_1307 257
207 3300049579 Ga0501043_0108433 Ga0501043_0108433_1003_1812 257
208 3300049822 Ga0501035_0286253 Ga0501035_0286253_278_1087 257
209 3300050512 nmdc:mga0n895_226040_c1 nmdc:mga0n895_226040_c1_190_984 257
210 3300050512 nmdc:mga0n895_41541_c1 nmdc:mga0n895_41541_c1_127_921 257
211 3300050512 nmdc:mga0n895_418731_c1 nmdc:mga0n895_418731_c1_176_1048 257
212 3300050513 nmdc:mga0rr50_4028_c1 nmdc:mga0rr50_4028_c1_2011_2805 257
213 3300050513 nmdc:mga0rr50_622203_c1 nmdc:mga0rr50_622203_c1_55_849 257
214 3300050515 nmdc:mga0a205_345798_c1 nmdc:mga0a205_345798_c1_282_1076 257
215 3300053153 Ga0500616_0000027 Ga0500616_0000027_124848_125636 257
216 3300053153 Ga0500616_0014577 Ga0500616_0014577_369_1160 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

35

258

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hn6-assembly1.cif.gz_D crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi 0.9855 1 246
3hn6-assembly1.cif.gz_E crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi 0.9734 1 246
7lqn-assembly2.cif.gz_I glucosamine-6-phosphate deaminase from h. influenzae 0.9707 1 246
7lqm-assembly1.cif.gz_B glucosamie-6-phosphate deaminase from pasturella multocida 0.9704 1 248
1ne7-assembly1.cif.gz_E human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino-glucitol-6-phosphate 0.9702 1 246
ID Description Score Start End Superfamily
af_Q04802_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9764 1 238 3.40.50.1360
af_Q54M58_36_296_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9758 1 239 3.40.50.1360
2bkxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9708 1 237 3.40.50.1360
1d9tA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9682 1 246 3.40.50.1360
af_M0RCH5_1_250_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9653 36 246 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A286SBN4-F1-model_v4 glucosamine-6-phosphate deaminase (EC 3.5.99.6) (Glucosamine-6-phosphate deaminase) 0.9935 96 230 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0016853
GO:0019262
GO:0042802
AF-A0A7X8H9W1-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9933 1 233 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A6V7KCE2-F1-model_v4 glucosamine-6-phosphate deaminase (EC 3.5.99.6) (Glucosamine-6-phosphate deaminase) 0.9932 34 122 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A1W2DH45-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9929 1 247 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A4R3ZTM4-F1-model_v4 deleted 0.9925 1 119

Feature Viewer

pLDDT pTM Quality
96.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map