F309205

General Info

Members Datasets Scaffolds Average Seq Length
201 111 164 134

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939664404|2939664434
Length 152
Sequence EQIVAGKEMINCYFCCMVPVKEDILKAVSFKTSRSGGKGGQNVNKVSSKVELIFHLANADFFDEQQKTLLRERLAGRLDQEGNLHVVSQEDRSQLLNKEKTIAKLIALLKSALHVQKKRKPTKVPKAIIRKRLADKQSVAQKKESRRKPQVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
6 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
7 2738541283 Pedobacter sp. OK701 Isolate Unclassified
8 2738541284 Pedobacter sp. YR016 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738541302 Pedobacter sp. CF074 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2738543023 Pedobacter sp. OK628 Isolate Unclassified
13 2739367651 Pedobacter sp. OK291 Isolate Unclassified
14 2739367656 Pedobacter sp. CF523 Isolate Unclassified
15 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
16 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
17 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
18 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
19 2818991437 Pedobacter terrae 518 Isolate Unclassified
20 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
21 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
22 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
23 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
24 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
25 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
26 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
27 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
28 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
29 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
30 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
31 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
32 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
33 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
34 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
35 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
36 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
37 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
100 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
101 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
102 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
103 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
104 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
105 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
109 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
110 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
111 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.59
Metatranscriptomes 0
Isolates 18.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0
Rhizoplane 1.99
Rhizosphere 71.64
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1283784 2162886007 Bacteria 1715
2 SwRhRL2b_contig_235932 2162886007 Bacteria 2224
3 SwRhRL2b_contig_2360950 2162886007 Bacteria 2836
4 SwRhRL2b_contig_3708819 2162886007 Bacteria 9197
5 JGI25152J39213_1000160 3300002773 Bacteria 45741
6 JGI25150J39212_1000002 3300002774 Bacteria 537631
7 JGI25151J46595_10000003 3300003187 Bacteria 715330
8 JGI25153J46596_10000003 3300003215 Bacteria 553253
9 Ga0055530_10002693 3300003791 Bacteria 11059
10 Ga0065714_10002536 3300005288 Bacteria 20360
11 Ga0065714_10002974 3300005288 Bacteria 16891
12 Ga0065714_10064993 3300005288 Bacteria 14329
13 Ga0065714_10122845 3300005288 Bacteria 1328
14 Ga0065714_10341763 3300005288 Bacteria 645
15 Ga0065704_10070358 3300005289 Bacteria 30366
16 Ga0065704_10072726 3300005289 Bacteria 8091
17 Ga0065704_10079018 3300005289 Bacteria 4280
18 Ga0065704_10081542 3300005289 Bacteria 3742
19 Ga0065704_10088379 3300005289 Bacteria 2944
20 Ga0065704_10174391 3300005289 Bacteria 1272
21 Ga0065704_10509657 3300005289 Bacteria 661
22 Ga0065715_10823415 3300005293 Bacteria 601
23 Ga0070693_100016008 3300005547 Bacteria 3874
24 Ga0105244_10059354 3300009036 Bacteria 1928
25 Ga0105237_10003157 3300009545 Bacteria 19816
26 Ga0157373_10000026 3300013100 Bacteria 139930
27 Ga0157373_10001010 3300013100 Bacteria 21720
28 Ga0157373_10060689 3300013100 Bacteria 2678
29 Ga0157371_10001945 3300013102 Bacteria 20538
30 Ga0157371_10003231 3300013102 Bacteria 14955
31 Ga0157371_10006449 3300013102 Bacteria 9674
32 Ga0157370_10001636 3300013104 Bacteria 27645
33 Ga0157370_10006381 3300013104 Bacteria 13014
34 Ga0157370_10006465 3300013104 Bacteria 12923
35 Ga0157370_10009076 3300013104 Bacteria 10664
36 Ga0157370_10010549 3300013104 Bacteria 9730
37 Ga0157370_10016108 3300013104 Bacteria 7578
38 Ga0157370_10026288 3300013104 Bacteria 5749
39 Ga0157370_10041735 3300013104 Bacteria 4423
40 Ga0157370_10099097 3300013104 Bacteria 2732
41 Ga0157370_10235881 3300013104 Bacteria 1693
42 Ga0157370_10312876 3300013104 Bacteria 1449
43 Ga0157370_10320905 3300013104 Bacteria 1429
44 Ga0157370_11578892 3300013104 Bacteria 590
45 Ga0157369_10000441 3300013105 Bacteria 55264
46 Ga0157369_10279306 3300013105 Bacteria 1739
47 Ga0163162_10001751 3300013306 Bacteria 20347
48 Ga0163162_10088167 3300013306 Bacteria 3182
49 Ga0182008_10000017 3300014497 Bacteria 235130
50 Ga0182008_10000043 3300014497 Bacteria 117076
51 Ga0182008_10000934 3300014497 Bacteria 20353
52 Ga0182008_10031329 3300014497 Bacteria 2677
53 Ga0182008_10265384 3300014497 Bacteria 889
54 Ga0182008_10756915 3300014497 Bacteria 560
55 Ga0182006_1000128 3300015261 Bacteria 81425
56 Ga0182006_1001058 3300015261 Bacteria 17753
57 Ga0182006_1002456 3300015261 Bacteria 10130
58 Ga0182006_1026274 3300015261 Bacteria 2384
59 Ga0182007_10000054 3300015262 Bacteria 91906
60 Ga0182007_10085987 3300015262 Bacteria 1033
61 Ga0182007_10358020 3300015262 Bacteria 549
62 Ga0183373_1015 3300015682 Bacteria 63862
63 Ga0163161_10001077 3300017792 Bacteria 20663
64 Ga0163161_10001415 3300017792 Bacteria 17712
65 Ga0163161_10003355 3300017792 Bacteria 11229
66 Ga0163161_10021844 3300017792 Bacteria 4501
67 Ga0163161_10022451 3300017792 Bacteria 4445
68 Ga0163161_10030045 3300017792 Bacteria 3865
69 Ga0163161_10109805 3300017792 Bacteria 2061
70 Ga0163161_10169846 3300017792 Bacteria 1667
71 Ga0163161_10278976 3300017792 Bacteria 1310
72 Ga0163161_10951727 3300017792 Bacteria 730
73 Ga0207425_1000004 3300025245 Bacteria 1092421
74 Ga0209129_1000005 3300025258 Bacteria 777812
75 Ga0209676_1000058 3300025292 Bacteria 345185
76 Ga0209025_1000009 3300025294 Bacteria 1092561
77 Ga0209758_1000010 3300025297 Bacteria 1092782
78 Ga0209050_1000054 3300025298 Bacteria 345186
79 Ga0207655_1101838 3300025728 Bacteria 987
80 Ga0207671_10055827 3300025914 Bacteria 2926
81 Ga0307515_10159200 3300028794 Bacteria 2313
82 Ga0316179_1086875 3300030734 Bacteria 743
83 Ga0307408_101458769 3300031548 Bacteria 646
84 Ga0307405_10000001 3300031731 Bacteria 1731270
85 Ga0307405_10000481 3300031731 Bacteria 14975
86 Ga0307405_10859263 3300031731 Bacteria 764
87 Ga0307413_10001327 3300031824 Bacteria 9234
88 Ga0307413_10427078 3300031824 Bacteria 1045
89 Ga0307410_10000087 3300031852 Bacteria 30911
90 Ga0307410_11416115 3300031852 Bacteria 610
91 Ga0307406_10000053 3300031901 Bacteria 63933
92 Ga0307406_10022341 3300031901 Bacteria 3752
93 Ga0307407_10000041 3300031903 Bacteria 65180
94 Ga0307407_10001370 3300031903 Bacteria 8782
95 Ga0307412_10000142 3300031911 Bacteria 51770
96 Ga0307412_10206739 3300031911 Unclassified 1495
97 Ga0307412_10529909 3300031911 Bacteria 986
98 Ga0307412_10565215 3300031911 Bacteria 957
99 Ga0307412_12026973 3300031911 Unclassified 533
100 Ga0307409_100438373 3300031995 Bacteria 1258
101 Ga0307416_100000029 3300032002 Bacteria 164815
102 Ga0307414_10000314 3300032004 Bacteria 27951
103 Ga0307414_10000504 3300032004 Bacteria 20317
104 Ga0307414_10001436 3300032004 Bacteria 12368
105 Ga0307414_10010514 3300032004 Bacteria 5376
106 Ga0307414_10011359 3300032004 Bacteria 5218
107 Ga0307414_10011832 3300032004 Bacteria 5137
108 Ga0307414_10071583 3300032004 Bacteria 2501
109 Ga0307414_10160674 3300032004 Bacteria 1784
110 Ga0307414_10273534 3300032004 Bacteria 1416
111 Ga0307414_10299044 3300032004 Bacteria 1360
112 Ga0307414_10331386 3300032004 Bacteria 1299
113 Ga0307414_10384994 3300032004 Bacteria 1214
114 Ga0307414_10538261 3300032004 Bacteria 1039
115 Ga0307414_10987618 3300032004 Bacteria 774
116 Ga0307411_10000002 3300032005 Bacteria 534807
117 Ga0307411_10042362 3300032005 Bacteria 2904
118 Ga0307510_10010426 3300033180 Bacteria 11037
119 Ga0316574_0146623 3300035398 Bacteria 1521
120 Ga0316574_0789158 3300035398 Bacteria 579
121 Ga0439447_000226 3300041407 Bacteria 19887
122 Ga0439466_0001613 3300041411 Bacteria 8804
123 Ga0439466_0123911 3300041411 Bacteria 797
124 Ga0451807_0598672 3300041486 Bacteria 1066
125 Ga0451807_2360370 3300041486 Bacteria 715
126 Ga0451843_0628331 3300041509 Bacteria 1446
127 Ga0453684_0182525 3300044712 Unclassified 2462
128 Ga0495627_000942 3300046453 Bacteria 20011
129 Ga0495627_033327 3300046453 Bacteria 1615
130 Ga0495607_0044733 3300046501 Bacteria 2608
131 Ga0495606_0013581 3300046507 Bacteria 6423
132 Ga0495606_0014575 3300046507 Bacteria 6119
133 Ga0495606_0137782 3300046507 Bacteria 1444
134 Ga0495610_0000093 3300046512 Bacteria 105873
135 Ga0495610_0002547 3300046512 Bacteria 15174
136 Ga0495610_0102267 3300046512 Bacteria 1282
137 Ga0495610_0297040 3300046512 Bacteria 624
138 Ga0495632_0220838 3300046519 Bacteria 857
139 Ga0495643_0000316 3300046522 Bacteria 66852
140 Ga0495625_0016281 3300046660 Bacteria 5856
141 Ga0495625_0385933 3300046660 Bacteria 878
142 Ga0496115_0003933 3300048918 Bacteria 10706
143 Ga0496115_0164488 3300048918 Bacteria 1835
144 Ga0496122_0000479 3300048925 Bacteria 83186
145 Ga0496124_0545191 3300048927 Bacteria 767
146 Ga0496125_0000024 3300048928 Bacteria 442149
147 Ga0496125_0085272 3300048928 Bacteria 2394
148 Ga0496125_0137729 3300048928 Bacteria 1704
149 Ga0496126_0010876 3300048929 Bacteria 9482
150 Ga0496126_0202222 3300048929 Bacteria 1677
151 Ga0501238_000177 3300049671 Bacteria 9522
152 Ga0501249_000519 3300049679 Bacteria 9340
153 Ga0501241_012950 3300049758 Bacteria 1514
154 Ga0501266_000001 3300049763 Bacteria 562004
155 Ga0501269_001874 3300049766 Bacteria 2658
156 Ga0501280_000315 3300049776 Bacteria 12164
157 Ga0500646_0021109 3300053090 Bacteria 1734
158 Ga0500646_0183829 3300053090 Bacteria 710
159 Ga0500651_0000280 3300053093 Bacteria 29979
160 Ga0500566_0218206 3300053094 Bacteria 950
161 Ga0500641_0000046 3300053096 Bacteria 60650
162 Ga0500641_0000060 3300053096 Bacteria 46714
163 Ga0500658_0000001 3300053134 Bacteria 592738
164 Ga0500559_0028733 3300053136 Bacteria 2377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10160674 Ga0307414_101606742 117
2 3300032004 Ga0307414_10384994 Ga0307414_103849942 120
3 3300032005 Ga0307411_10042362 Ga0307411_100423622 120
4 3300017792 Ga0163161_10109805 Ga0163161_101098052 124
5 3300053096 Ga0500641_0000060 Ga0500641_0000060_44670_45071 126
6 3300031852 Ga0307410_11416115 Ga0307410_114161151 127
7 3300017792 Ga0163161_10022451 Ga0163161_100224511 128
8 iso_pu_bacteria 8036736890 8036737238 128
9 iso_pu_bacteria 2643221725 2644684319 129
10 iso_pu_bacteria 2802428842 2802651789 129
11 iso_pu_bacteria 2881247448 2881250499 129
12 iso_pu_bacteria 2919509842 2919512893 129
13 iso_pu_bacteria 2958512119 2958515832 129
14 iso_pu_bacteria 2977268062 2977268529 129
15 iso_pu_bacteria 2513020052 2513233078 130
16 iso_pu_bacteria 2643221667 2644371786 130
17 iso_pu_bacteria 2738541279 2738734946 130
18 iso_pu_bacteria 2738541285 2738769089 130
19 iso_pu_bacteria 2738543007 2739216528 130
20 iso_pu_bacteria 2739367857 2739999824 130
21 iso_pu_bacteria 2739367858 2740004640 130
22 iso_pu_bacteria 2857613821 2857615362 130
23 iso_pu_bacteria 2857618242 2857622831 130
24 iso_pu_bacteria 2919683626 2919683679 130
25 iso_pu_bacteria 2929150217 2929151800 130
26 iso_pu_bacteria 2585427687 2586210493 131
27 iso_pu_bacteria 2738541302 2738852327 131
28 iso_pu_bacteria 2739367651 2739589783 131
29 iso_pu_bacteria 2818991437 2819550303 131
30 iso_pu_bacteria 2833640130 2833641346 131
31 iso_pu_bacteria 2849281842 2849287081 131
32 iso_pu_bacteria 2857627736 2857632360 131
33 3300032004 Ga0307414_10010514 Ga0307414_100105145 132
34 iso_pu_bacteria 2738541284 2738763758 132
35 iso_pu_bacteria 2738543023 2739304473 132
36 iso_pu_bacteria 2739367656 2739617925 132
37 iso_pu_bacteria 2775506987 2776614895 132
38 iso_pu_bacteria 2842909656 2842914590 132
39 iso_pu_bacteria 2852627209 2852630012 132
40 iso_pu_bacteria 2904445276 2904449404 132
41 iso_pu_bacteria 2919186247 2919188299 132
42 iso_pu_bacteria 2945997725 2945999442 132
43 iso_pu_bacteria 2954016120 2954016173 132
44 2162886007 SwRhRL2b_contig_235932 SwRhRL2b_0884.00002020 133
45 2162886007 SwRhRL2b_contig_2360950 SwRhRL2b_0117.00000590 133
46 3300005289 Ga0065704_10072726 Ga0065704_100727267 133
47 3300005289 Ga0065704_10079018 Ga0065704_100790183 133
48 3300005289 Ga0065704_10088379 Ga0065704_100883792 133
49 3300005547 Ga0070693_100016008 Ga0070693_1000160082 133
50 3300013100 Ga0157373_10000026 Ga0157373_1000002659 133
51 3300013104 Ga0157370_10001636 Ga0157370_1000163614 133
52 3300013104 Ga0157370_10006381 Ga0157370_100063818 133
53 3300013104 Ga0157370_10026288 Ga0157370_100262882 133
54 3300013306 Ga0163162_10088167 Ga0163162_100881674 133
55 3300015261 Ga0182006_1002456 Ga0182006_10024569 133
56 3300017792 Ga0163161_10021844 Ga0163161_100218443 133
57 3300017792 Ga0163161_10030045 Ga0163161_100300452 133
58 3300017792 Ga0163161_10169846 Ga0163161_101698462 133
59 3300017792 Ga0163161_10278976 Ga0163161_102789762 133
60 3300031548 Ga0307408_101458769 Ga0307408_1014587692 133
61 3300031731 Ga0307405_10000001 Ga0307405_10000001508 133
62 3300031901 Ga0307406_10022341 Ga0307406_100223412 133
63 3300032004 Ga0307414_10011359 Ga0307414_100113592 133
64 3300046453 Ga0495627_000942 Ga0495627_000942_15822_16223 133
65 3300046507 Ga0495606_0013581 Ga0495606_0013581_3080_3481 133
66 3300046507 Ga0495606_0014575 Ga0495606_0014575_3706_4107 133
67 3300046507 Ga0495606_0137782 Ga0495606_0137782_51_452 133
68 3300046522 Ga0495643_0000316 Ga0495643_0000316_53858_54259 133
69 3300046660 Ga0495625_0016281 Ga0495625_0016281_2718_3119 133
70 3300048918 Ga0496115_0003933 Ga0496115_0003933_10228_10629 133
71 3300048927 Ga0496124_0545191 Ga0496124_0545191_57_458 133
72 3300048928 Ga0496125_0137729 Ga0496125_0137729_17_418 133
73 3300048929 Ga0496126_0010876 Ga0496126_0010876_6159_6560 133
74 3300053090 Ga0500646_0021109 Ga0500646_0021109_977_1378 133
75 3300005293 Ga0065715_10823415 Ga0065715_108234152 134
76 3300013104 Ga0157370_10006465 Ga0157370_100064659 134
77 3300028794 Ga0307515_10159200 Ga0307515_101592002 134
78 3300030734 Ga0316179_1086875 Ga0316179_10868751 134
79 3300031731 Ga0307405_10859263 Ga0307405_108592631 134
80 3300031824 Ga0307413_10001327 Ga0307413_100013277 134
81 3300031824 Ga0307413_10427078 Ga0307413_104270782 134
82 3300031852 Ga0307410_10000087 Ga0307410_100000873 134
83 3300031901 Ga0307406_10000053 Ga0307406_1000005348 134
84 3300031903 Ga0307407_10001370 Ga0307407_100013702 134
85 3300031911 Ga0307412_10565215 Ga0307412_105652152 134
86 3300031995 Ga0307409_100438373 Ga0307409_1004383732 134
87 3300032004 Ga0307414_10000314 Ga0307414_1000031423 134
88 3300032004 Ga0307414_10299044 Ga0307414_102990442 134
89 3300032004 Ga0307414_10331386 Ga0307414_103313862 134
90 3300032005 Ga0307411_10000002 Ga0307411_10000002258 134
91 3300033180 Ga0307510_10010426 Ga0307510_100104269 134
92 3300041407 Ga0439447_000226 Ga0439447_000226_5820_6224 134
93 3300041411 Ga0439466_0001613 Ga0439466_0001613_6738_7142 134
94 3300041411 Ga0439466_0123911 Ga0439466_0123911_322_726 134
95 3300041486 Ga0451807_2360370 Ga0451807_2360370_217_621 134
96 3300041509 Ga0451843_0628331 Ga0451843_0628331_761_1165 134
97 3300046501 Ga0495607_0044733 Ga0495607_0044733_1880_2284 134
98 3300046512 Ga0495610_0102267 Ga0495610_0102267_724_1128 134
99 3300046512 Ga0495610_0297040 Ga0495610_0297040_65_469 134
100 3300046519 Ga0495632_0220838 Ga0495632_0220838_439_843 134
101 3300046660 Ga0495625_0385933 Ga0495625_0385933_83_487 134
102 3300048929 Ga0496126_0202222 Ga0496126_0202222_892_1296 134
103 3300049671 Ga0501238_000177 Ga0501238_000177_7714_8118 134
104 3300049679 Ga0501249_000519 Ga0501249_000519_6046_6450 134
105 3300049763 Ga0501266_000001 Ga0501266_000001_376566_376970 134
106 3300049766 Ga0501269_001874 Ga0501269_001874_2000_2404 134
107 3300049776 Ga0501280_000315 Ga0501280_000315_7242_7646 134
108 3300053090 Ga0500646_0183829 Ga0500646_0183829_217_621 134
109 3300053096 Ga0500641_0000046 Ga0500641_0000046_2647_3051 134
110 3300053134 Ga0500658_0000001 Ga0500658_0000001_70107_70511 134
111 3300053136 Ga0500559_0028733 Ga0500559_0028733_403_807 134
112 3300002773 JGI25152J39213_1000160 JGI25152J39213_100016021 135
113 3300002774 JGI25150J39212_1000002 JGI25150J39212_100000221 135
114 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003635 135
115 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003467 135
116 3300009036 Ga0105244_10059354 Ga0105244_100593542 135
117 3300013104 Ga0157370_10009076 Ga0157370_100090766 135
118 3300013104 Ga0157370_10099097 Ga0157370_100990972 135
119 3300013104 Ga0157370_10320905 Ga0157370_103209052 135
120 3300013104 Ga0157370_11578892 Ga0157370_115788921 135
121 3300013306 Ga0163162_10001751 Ga0163162_1000175112 135
122 3300014497 Ga0182008_10000934 Ga0182008_100009342 135
123 3300015261 Ga0182006_1001058 Ga0182006_10010588 135
124 3300015682 Ga0183373_1015 Ga0183373_101513 135
125 3300017792 Ga0163161_10001415 Ga0163161_1000141511 135
126 3300025245 Ga0207425_1000004 Ga0207425_1000004919 135
127 3300025258 Ga0209129_1000005 Ga0209129_100000521 135
128 3300025294 Ga0209025_1000009 Ga0209025_1000009919 135
129 3300025297 Ga0209758_1000010 Ga0209758_1000010920 135
130 3300025728 Ga0207655_1101838 Ga0207655_11018382 135
131 3300031903 Ga0307407_10000041 Ga0307407_1000004138 135
132 3300032002 Ga0307416_100000029 Ga0307416_100000029101 135
133 3300032004 Ga0307414_10001436 Ga0307414_1000143616 135
134 3300035398 Ga0316574_0146623 Ga0316574_0146623_520_927 135
135 3300035398 Ga0316574_0789158 Ga0316574_0789158_23_430 135
136 3300041486 Ga0451807_0598672 Ga0451807_0598672_38_445 135
137 3300044712 Ga0453684_0182525 Ga0453684_0182525_123_530 135
138 3300046453 Ga0495627_033327 Ga0495627_033327_1154_1561 135
139 3300046512 Ga0495610_0000093 Ga0495610_0000093_15685_16092 135
140 3300046512 Ga0495610_0002547 Ga0495610_0002547_12068_12475 135
141 3300048928 Ga0496125_0000024 Ga0496125_0000024_389785_390198 135
142 2162886007 SwRhRL2b_contig_1283784 SwRhRL2b_0055.00003050 136
143 2162886007 SwRhRL2b_contig_3708819 SwRhRL2b_0079.00001840 136
144 3300003791 Ga0055530_10002693 Ga0055530_100026934 136
145 3300005288 Ga0065714_10002536 Ga0065714_1000253610 136
146 3300005288 Ga0065714_10002974 Ga0065714_1000297411 136
147 3300005288 Ga0065714_10064993 Ga0065714_1006499312 136
148 3300005288 Ga0065714_10122845 Ga0065714_101228452 136
149 3300005288 Ga0065714_10341763 Ga0065714_103417631 136
150 3300005289 Ga0065704_10070358 Ga0065704_1007035812 136
151 3300005289 Ga0065704_10081542 Ga0065704_100815422 136
152 3300005289 Ga0065704_10174391 Ga0065704_101743912 136
153 3300005289 Ga0065704_10509657 Ga0065704_105096571 136
154 3300009545 Ga0105237_10003157 Ga0105237_1000315717 136
155 3300013100 Ga0157373_10001010 Ga0157373_1000101010 136
156 3300013100 Ga0157373_10060689 Ga0157373_100606892 136
157 3300013102 Ga0157371_10001945 Ga0157371_100019458 136
158 3300013102 Ga0157371_10003231 Ga0157371_100032314 136
159 3300013102 Ga0157371_10006449 Ga0157371_100064498 136
160 3300013104 Ga0157370_10010549 Ga0157370_100105496 136
161 3300013104 Ga0157370_10016108 Ga0157370_100161086 136
162 3300013104 Ga0157370_10041735 Ga0157370_100417354 136
163 3300013104 Ga0157370_10235881 Ga0157370_102358812 136
164 3300013104 Ga0157370_10312876 Ga0157370_103128762 136
165 3300013105 Ga0157369_10000441 Ga0157369_100004418 136
166 3300013105 Ga0157369_10279306 Ga0157369_102793063 136
167 3300014497 Ga0182008_10000017 Ga0182008_10000017167 136
168 3300014497 Ga0182008_10000043 Ga0182008_100000432 136
169 3300014497 Ga0182008_10031329 Ga0182008_100313291 136
170 3300014497 Ga0182008_10265384 Ga0182008_102653842 136
171 3300014497 Ga0182008_10756915 Ga0182008_107569151 136
172 3300015261 Ga0182006_1000128 Ga0182006_100012863 136
173 3300015261 Ga0182006_1026274 Ga0182006_10262743 136
174 3300015262 Ga0182007_10000054 Ga0182007_1000005431 136
175 3300015262 Ga0182007_10085987 Ga0182007_100859872 136
176 3300015262 Ga0182007_10358020 Ga0182007_103580201 136
177 3300017792 Ga0163161_10001077 Ga0163161_100010776 136
178 3300017792 Ga0163161_10003355 Ga0163161_1000335510 136
179 3300017792 Ga0163161_10951727 Ga0163161_109517271 136
180 3300025292 Ga0209676_1000058 Ga0209676_1000058257 136
181 3300025298 Ga0209050_1000054 Ga0209050_1000054257 136
182 3300025914 Ga0207671_10055827 Ga0207671_100558273 136
183 3300031731 Ga0307405_10000481 Ga0307405_100004813 136
184 3300031911 Ga0307412_10000142 Ga0307412_1000014232 136
185 3300031911 Ga0307412_10206739 Ga0307412_102067391 136
186 3300031911 Ga0307412_10529909 Ga0307412_105299092 136
187 3300031911 Ga0307412_12026973 Ga0307412_120269731 136
188 3300032004 Ga0307414_10000504 Ga0307414_1000050414 136
189 3300032004 Ga0307414_10011832 Ga0307414_100118323 136
190 3300032004 Ga0307414_10071583 Ga0307414_100715833 136
191 3300032004 Ga0307414_10273534 Ga0307414_102735342 136
192 3300032004 Ga0307414_10538261 Ga0307414_105382612 136
193 3300032004 Ga0307414_10987618 Ga0307414_109876182 136
194 3300048918 Ga0496115_0164488 Ga0496115_0164488_522_932 136
195 3300048925 Ga0496122_0000479 Ga0496122_0000479_31950_32390 136
196 3300048928 Ga0496125_0085272 Ga0496125_0085272_879_1319 136
197 3300049758 Ga0501241_012950 Ga0501241_012950_26_436 136
198 3300053093 Ga0500651_0000280 Ga0500651_0000280_27720_28130 136
199 3300053094 Ga0500566_0218206 Ga0500566_0218206_498_908 136
200 iso_pu_bacteria 2738541283 2738758040 136
201 iso_pu_bacteria 2939664404 2939664434 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

21

151

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8299 1 98
7jt1-assembly1.cif.gz_9 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.8298 34 98
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.8285 9 99
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8215 1 98
2jva-assembly1.cif.gz_A nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211 0.7959 10 100
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8881 37 95 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.85 37 95 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8299 1 98 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8215 1 98 3.30.160.20
2jvaA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7959 10 100 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A0R2VK58-F1-model_v4 Peptide chain release factor 1 0.8881 3 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-B9THS4-F1-model_v4 Immature colon carcinoma transcript, putative 0.8715 9 89 GO:0003747
AF-A0A0R2VK58-F1-model_v4 Peptide chain release factor 1 0.8704 3 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A3D4BK31-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8689 22 110 GO:0004045
GO:0043022
GO:0072344
AF-A0A7X6A8X0-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8677 12 96 GO:0003747
GO:0004045
GO:0043022
GO:0072344

Feature Viewer

pLDDT pTM Quality
88.77 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map