F308175

General Info

Members Datasets Scaffolds Average Seq Length
201 128 201 283

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100039554|Ga0070714_1000395544
Length 280
Sequence MFADLHLHTNFSDGTYSPEELVSQAARNHLAAIALTDHDTVEGCQRAGEACRLAQIEFIPGTELTAEQNENEIHILGYFLDTQNKRLLSEIAKFQAVLNELKVPLKVEDVFALANCRSPGRPHVARALVKAGLCSSLDEAFERFLKKHRPAWVPKARISAQFAIELIHQAGGLAVMAHPGLNRSDEVIPDLVEAGLDGIECFHTKHSTAVSEHYLEIADQHHLLVTGGSDCHGMSKGKPLIGTVKLPYQHIEKLKAKVAARKEHLVPPASPLPETVNRKS

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
128 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 1
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002651 3300000545 Unclassified 1246
2 rootH1_10256075 3300003323 Unclassified 1164
3 Ga0070658_10118459 3300005327 Bacteria 2198
4 Ga0070690_100001178 3300005330 Bacteria 13454
5 Ga0070690_100052064 3300005330 Bacteria 2616
6 Ga0070690_100150828 3300005330 Bacteria 1586
7 Ga0070677_10059426 3300005333 Bacteria 1572
8 Ga0070689_100000660 3300005340 Bacteria 20834
9 Ga0070689_100068115 3300005340 Bacteria 2776
10 Ga0070689_100438816 3300005340 Bacteria 1109
11 Ga0070687_100040040 3300005343 Bacteria 2359
12 Ga0070692_10218858 3300005345 Bacteria 1124
13 Ga0070688_100005156 3300005365 Bacteria 6855
14 Ga0070667_100119955 3300005367 Bacteria 2287
15 Ga0070714_100039554 3300005435 Bacteria 3971
16 Ga0070705_100236383 3300005440 Unclassified 1274
17 Ga0070700_100411868 3300005441 Bacteria 1019
18 Ga0070708_100137238 3300005445 Unclassified 2266
19 Ga0070681_10177450 3300005458 Bacteria 2052
20 Ga0070685_10091666 3300005466 Unclassified 1840
21 Ga0070679_100310496 3300005530 Bacteria 1527
22 Ga0070684_100198554 3300005535 Bacteria 1827
23 Ga0070686_100002318 3300005544 Bacteria 10511
24 Ga0070686_100004277 3300005544 Bacteria 7869
25 Ga0070695_100112160 3300005545 Bacteria 1852
26 Ga0070704_100035207 3300005549 Bacteria 3402
27 Ga0068855_100030576 3300005563 Bacteria 6438
28 Ga0068855_100044565 3300005563 Bacteria 5249
29 Ga0068855_100051940 3300005563 Bacteria 4828
30 Ga0068856_100000247 3300005614 Bacteria 58943
31 Ga0068856_100038680 3300005614 Bacteria 4683
32 Ga0068856_100068564 3300005614 Bacteria 3506
33 Ga0068859_100761328 3300005617 Unclassified 1057
34 Ga0068864_100418292 3300005618 Unclassified 1277
35 Ga0068863_100087893 3300005841 Unclassified 2945
36 Ga0068863_100116191 3300005841 Bacteria 2550
37 Ga0075428_100013341 3300006844 Bacteria 9141
38 Ga0075428_100164274 3300006844 Bacteria 2409
39 Ga0075431_100034255 3300006847 Bacteria 5232
40 Ga0075431_100055428 3300006847 Bacteria 4089
41 Ga0097620_100761371 3300006931 Unclassified 1057
42 Ga0105240_10131658 3300009093 Unclassified 2999
43 Ga0105240_10174062 3300009093 Bacteria 2546
44 Ga0105240_10468717 3300009093 Bacteria 1406
45 Ga0111539_10003733 3300009094 Bacteria 20035
46 Ga0111539_10030682 3300009094 Bacteria 6535
47 Ga0111539_10038024 3300009094 Bacteria 5806
48 Ga0111539_10148940 3300009094 Bacteria 2740
49 Ga0111539_10411573 3300009094 Bacteria 1575
50 Ga0105242_10050175 3300009176 Unclassified 3397
51 Ga0105242_10316187 3300009176 Unclassified 1431
52 Ga0157370_10111505 3300013104 Bacteria 2557
53 Ga0157374_10251469 3300013296 Unclassified 1739
54 Ga0157378_10740454 3300013297 Unclassified 1005
55 Ga0157372_10031711 3300013307 Bacteria 5788
56 Ga0157375_10051802 3300013308 Bacteria 4033
57 Ga0163163_10011418 3300014325 Bacteria 8055
58 Ga0157380_10404611 3300014326 Bacteria 1296
59 Ga0157379_10396448 3300014968 Bacteria 1268
60 Ga0207705_10371064 3300025909 Unclassified 1104
61 Ga0207707_10140746 3300025912 Bacteria 2110
62 Ga0207652_10107707 3300025921 Bacteria 2469
63 Ga0207694_10010435 3300025924 Bacteria 7004
64 Ga0207664_10008042 3300025929 Bacteria 7331
65 Ga0207686_10093984 3300025934 Bacteria 1987
66 Ga0207686_10315293 3300025934 Bacteria 1166
67 Ga0207670_10007821 3300025936 Bacteria 5998
68 Ga0207670_10183087 3300025936 Bacteria 1579
69 Ga0207670_10216289 3300025936 Unclassified 1464
70 Ga0207711_10617448 3300025941 Unclassified 1012
71 Ga0207667_10022409 3300025949 Bacteria 6979
72 Ga0207667_10027534 3300025949 Bacteria 6184
73 Ga0207667_10097690 3300025949 Bacteria 3031
74 Ga0207667_10216312 3300025949 Bacteria 1963
75 Ga0207667_10671115 3300025949 Bacteria 1041
76 Ga0207658_10094246 3300025986 Bacteria 2330
77 Ga0207703_10176174 3300026035 Bacteria 1884
78 Ga0207708_10437465 3300026075 Bacteria 1087
79 Ga0207702_10000506 3300026078 Bacteria 43980
80 Ga0207702_10020610 3300026078 Bacteria 5457
81 Ga0207702_10300138 3300026078 Bacteria 1524
82 Ga0207641_10073419 3300026088 Bacteria 2948
83 Ga0207641_10177865 3300026088 Unclassified 1946
84 Ga0207676_10215145 3300026095 Bacteria 1708
85 Ga0207674_10177310 3300026116 Unclassified 2084
86 Ga0207428_10263047 3300027907 Unclassified 1284
87 Ga0265337_1001542 3300028556 Bacteria 11308
88 Ga0265337_1003755 3300028556 Bacteria 6478
89 Ga0265337_1003892 3300028556 Bacteria 6325
90 Ga0265337_1022211 3300028556 Unclassified 1968
91 Ga0265326_10012011 3300028558 Bacteria 2550
92 Ga0265319_1000003 3300028563 Bacteria 340561
93 Ga0265319_1017660 3300028563 Bacteria 2706
94 Ga0265319_1022419 3300028563 Bacteria 2302
95 Ga0265319_1029553 3300028563 Bacteria 1924
96 Ga0265334_10057132 3300028573 Bacteria 1480
97 Ga0265318_10016330 3300028577 Bacteria 3069
98 Ga0265338_10000008 3300028800 Bacteria 481542
99 Ga0265338_10000084 3300028800 Bacteria 175415
100 Ga0265338_10001714 3300028800 Bacteria 34782
101 Ga0265338_10003617 3300028800 Bacteria 21551
102 Ga0265338_10007638 3300028800 Bacteria 13344
103 Ga0265338_10010850 3300028800 Bacteria 10606
104 Ga0265338_10013810 3300028800 Bacteria 9075
105 Ga0265338_10016543 3300028800 Bacteria 8014
106 Ga0265338_10017114 3300028800 Bacteria 7834
107 Ga0265338_10029677 3300028800 Bacteria 5413
108 Ga0265338_10032887 3300028800 Bacteria 5048
109 Ga0265338_10041555 3300028800 Bacteria 4299
110 Ga0265338_10077136 3300028800 Bacteria 2818
111 Ga0265338_10132302 3300028800 Bacteria 1967
112 Ga0265324_10000409 3300029957 Bacteria 30860
113 Ga0265324_10000769 3300029957 Bacteria 21141
114 Ga0265324_10023849 3300029957 Bacteria 2176
115 Ga0265332_10114462 3300031238 Unclassified 1135
116 Ga0265320_10000145 3300031240 Bacteria 59716
117 Ga0265320_10010769 3300031240 Bacteria 5421
118 Ga0265320_10016242 3300031240 Bacteria 4178
119 Ga0265325_10182247 3300031241 Unclassified 977
120 Ga0265340_10002949 3300031247 Bacteria 9689
121 Ga0265340_10012891 3300031247 Bacteria 4404
122 Ga0265339_10003602 3300031249 Bacteria 10810
123 Ga0265339_10078189 3300031249 Unclassified 1752
124 Ga0265339_10108002 3300031249 Unclassified 1443
125 Ga0265327_10000767 3300031251 Bacteria 49654
126 Ga0265327_10015015 3300031251 Bacteria 5033
127 Ga0265327_10172242 3300031251 Bacteria 994
128 Ga0265316_10072810 3300031344 Bacteria 2647
129 Ga0265313_10001445 3300031595 Bacteria 22165
130 Ga0265342_10046458 3300031712 Bacteria 2610
131 Ga0373928_0000027 3300035084 Bacteria 25217
132 Ga0373944_0000193 3300035089 Bacteria 12867
133 Ga0373944_0102344 3300035089 Bacteria 969
134 Ga0373932_0000001 3300035112 Bacteria 1459067
135 Ga0373945_0050049 3300035116 Bacteria 1534
136 Ga0373946_0178672 3300035171 Unclassified 1006
137 Ga0373955_0067188 3300035172 Bacteria 1995
138 Ga0373962_0000122 3300035242 Bacteria 16004
139 Ga0373924_0051614 3300035410 Bacteria 1706
140 Ga0373931_0000002 3300035691 Bacteria 599830
141 Ga0373927_0006021 3300035695 Bacteria 8308
142 Ga0373933_0032308 3300035724 Bacteria 3042
143 Ga0373947_0013923 3300035725 Bacteria 4612
144 Ga0373937_0001450 3300036401 Bacteria 19831
145 Ga0373925_0000977 3300037068 Bacteria 26025
146 Ga0373925_0042457 3300037068 Bacteria 3373
147 Ga0395905_0084278 3300037471 Unclassified 2978
148 Ga0451577_0026162 3300042876 Bacteria 5285
149 Ga0453684_0209460 3300044712 Unclassified 2267
150 Ga0451576_0058880 3300045051 Bacteria 4012
151 Ga0451576_0067536 3300045051 Bacteria 3722
152 Ga0451576_0211210 3300045051 Bacteria 2027
153 Ga0495592_0000012 3300046454 Bacteria 154054
154 Ga0495651_0018550 3300046462 Bacteria 5390
155 Ga0495653_0426401 3300046463 Bacteria 838
156 Ga0495662_0104906 3300046476 Bacteria 1383
157 Ga0495664_0073175 3300046477 Unclassified 2049
158 Ga0495618_0001981 3300046514 Bacteria 13433
159 Ga0495618_0015901 3300046514 Bacteria 4593
160 Ga0495628_0000320 3300046516 Bacteria 43366
161 Ga0495628_0061987 3300046516 Bacteria 2932
162 Ga0495630_0004207 3300046517 Bacteria 10078
163 Ga0495630_0203725 3300046517 Bacteria 1510
164 Ga0495666_0042315 3300046526 Unclassified 2203
165 Ga0495652_0031903 3300046529 Bacteria 4611
166 Ga0495652_0197750 3300046529 Bacteria 1528
167 Ga0495640_0010746 3300046533 Bacteria 7063
168 Ga0495640_0047114 3300046533 Bacteria 2984
169 Ga0495640_0105792 3300046533 Bacteria 1843
170 Ga0495586_0000398 3300046535 Bacteria 26391
171 Ga0495586_0000971 3300046535 Bacteria 16236
172 Ga0495587_0020806 3300046536 Bacteria 4047
173 Ga0495645_0118699 3300046543 Bacteria 1864
174 Ga0495645_0189142 3300046543 Bacteria 1404
175 Ga0495667_0246649 3300046559 Unclassified 1137
176 Ga0495634_0000500 3300046642 Bacteria 38456
177 Ga0495634_0068563 3300046642 Bacteria 2343
178 Ga0495599_0011346 3300046678 Bacteria 5472
179 Ga0495647_0084526 3300046681 Unclassified 1292
180 Ga0495658_0005024 3300046683 Bacteria 6497
181 Ga0495613_0003628 3300046689 Bacteria 11562
182 Ga0495674_0415573 3300047319 Bacteria 1084
183 Ga0495680_0050141 3300047322 Bacteria 3265
184 Ga0495675_0154830 3300047444 Bacteria 1414
185 Ga0495684_0090503 3300047471 Bacteria 2318
186 Ga0495684_0158425 3300047471 Unclassified 1690
187 Ga0495684_0238859 3300047471 Bacteria 1326
188 Ga0496106_0320071 3300048909 Bacteria 1245
189 Ga0496107_0033339 3300048910 Bacteria 3684
190 Ga0501031_0000093 3300049568 Bacteria 47816
191 Ga0501033_0001521 3300049570 Bacteria 20493
192 Ga0501046_0441094 3300049580 Unclassified 937
193 Ga0501035_0212359 3300049822 Bacteria 1655
194 Ga0501044_0000089 3300049823 Bacteria 112278
195 nmdc:mga09592_111862_c1 3300050508 Bacteria 2343
196 nmdc:mga09592_621593_c1 3300050508 Unclassified 924
197 nmdc:mga0qj67_127149_c1 3300050509 Bacteria 2062
198 nmdc:mga06r32_29276_c1 3300050510 Bacteria 5159
199 nmdc:mga08y16_30337_c1 3300050511 Bacteria 5691
200 Ga0500650_0035779 3300053098 Bacteria 2277
201 Ga0500636_0036266 3300053177 Bacteria 2919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_111862_c1 nmdc:mga09592_111862_c1_1593_2321 234
2 3300050508 nmdc:mga09592_621593_c1 nmdc:mga09592_621593_c1_33_788 241
3 3300046463 Ga0495653_0426401 Ga0495653_0426401_27_785 248
4 3300005435 Ga0070714_100039554 Ga0070714_1000395544 270
5 3300025929 Ga0207664_10008042 Ga0207664_100080426 270
6 3300046529 Ga0495652_0197750 Ga0495652_0197750_544_1374 272
7 3300046543 Ga0495645_0118699 Ga0495645_0118699_967_1797 272
8 3300046642 Ga0495634_0068563 Ga0495634_0068563_656_1486 272
9 3300047471 Ga0495684_0090503 Ga0495684_0090503_1304_2134 272
10 3300005330 Ga0070690_100001178 Ga0070690_1000011782 273
11 3300006847 Ga0075431_100034255 Ga0075431_1000342553 273
12 3300006847 Ga0075431_100055428 Ga0075431_1000554282 273
13 3300009094 Ga0111539_10038024 Ga0111539_100380245 273
14 3300013307 Ga0157372_10031711 Ga0157372_100317112 273
15 3300027907 Ga0207428_10263047 Ga0207428_102630472 273
16 3300028563 Ga0265319_1029553 Ga0265319_10295532 273
17 3300028800 Ga0265338_10007638 Ga0265338_1000763811 273
18 3300028800 Ga0265338_10016543 Ga0265338_100165438 273
19 3300035410 Ga0373924_0051614 Ga0373924_0051614_518_1402 273
20 3300046462 Ga0495651_0018550 Ga0495651_0018550_2543_3427 273
21 3300050510 nmdc:mga06r32_29276_c1 nmdc:mga06r32_29276_c1_3998_4840 273
22 3300050511 nmdc:mga08y16_30337_c1 nmdc:mga08y16_30337_c1_3188_4015 273
23 3300053098 Ga0500650_0035779 Ga0500650_0035779_1114_1935 273
24 3300031251 Ga0265327_10015015 Ga0265327_100150152 274
25 3300003323 rootH1_10256075 rootH1_102560751 275
26 3300005327 Ga0070658_10118459 Ga0070658_101184592 275
27 3300005563 Ga0068855_100051940 Ga0068855_1000519405 275
28 3300005614 Ga0068856_100068564 Ga0068856_1000685643 275
29 3300009093 Ga0105240_10468717 Ga0105240_104687172 275
30 3300014968 Ga0157379_10396448 Ga0157379_103964482 275
31 3300025909 Ga0207705_10371064 Ga0207705_103710642 275
32 3300025924 Ga0207694_10010435 Ga0207694_1001043510 275
33 3300025949 Ga0207667_10022409 Ga0207667_100224096 275
34 3300025949 Ga0207667_10097690 Ga0207667_100976903 275
35 3300025949 Ga0207667_10216312 Ga0207667_102163123 275
36 3300026078 Ga0207702_10300138 Ga0207702_103001382 275
37 3300005333 Ga0070677_10059426 Ga0070677_100594263 276
38 3300013104 Ga0157370_10111505 Ga0157370_101115054 276
39 3300046683 Ga0495658_0005024 Ga0495658_0005024_3885_4739 276
40 3300047444 Ga0495675_0154830 Ga0495675_0154830_369_1199 276
41 3300048909 Ga0496106_0320071 Ga0496106_0320071_372_1202 276
42 3300048910 Ga0496107_0033339 Ga0496107_0033339_1453_2283 276
43 3300005563 Ga0068855_100030576 Ga0068855_1000305766 277
44 3300005614 Ga0068856_100000247 Ga0068856_1000002472 277
45 3300005614 Ga0068856_100038680 Ga0068856_1000386804 277
46 3300025949 Ga0207667_10027534 Ga0207667_100275343 277
47 3300026078 Ga0207702_10000506 Ga0207702_100005066 277
48 3300026078 Ga0207702_10020610 Ga0207702_100206102 277
49 3300028556 Ga0265337_1003892 Ga0265337_10038927 277
50 3300028556 Ga0265337_1022211 Ga0265337_10222112 277
51 3300028558 Ga0265326_10012011 Ga0265326_100120113 277
52 3300028563 Ga0265319_1000003 Ga0265319_1000003189 277
53 3300028563 Ga0265319_1017660 Ga0265319_10176605 277
54 3300028573 Ga0265334_10057132 Ga0265334_100571322 277
55 3300028577 Ga0265318_10016330 Ga0265318_100163303 277
56 3300028800 Ga0265338_10000084 Ga0265338_10000084108 277
57 3300028800 Ga0265338_10010850 Ga0265338_100108501 277
58 3300028800 Ga0265338_10013810 Ga0265338_100138109 277
59 3300028800 Ga0265338_10017114 Ga0265338_100171149 277
60 3300028800 Ga0265338_10029677 Ga0265338_100296775 277
61 3300028800 Ga0265338_10041555 Ga0265338_100415556 277
62 3300028800 Ga0265338_10077136 Ga0265338_100771362 277
63 3300029957 Ga0265324_10000409 Ga0265324_1000040925 277
64 3300029957 Ga0265324_10023849 Ga0265324_100238493 277
65 3300031240 Ga0265320_10016242 Ga0265320_100162423 277
66 3300031247 Ga0265340_10002949 Ga0265340_100029495 277
67 3300031247 Ga0265340_10012891 Ga0265340_100128914 277
68 3300031251 Ga0265327_10000767 Ga0265327_1000076723 277
69 3300031251 Ga0265327_10172242 Ga0265327_101722421 277
70 3300031595 Ga0265313_10001445 Ga0265313_1000144510 277
71 3300031712 Ga0265342_10046458 Ga0265342_100464582 277
72 3300035084 Ga0373928_0000027 Ga0373928_0000027_14877_15722 277
73 3300035089 Ga0373944_0000193 Ga0373944_0000193_8367_9212 277
74 3300035089 Ga0373944_0102344 Ga0373944_0102344_16_864 277
75 3300035112 Ga0373932_0000001 Ga0373932_0000001_1066875_1067720 277
76 3300035116 Ga0373945_0050049 Ga0373945_0050049_209_1054 277
77 3300035171 Ga0373946_0178672 Ga0373946_0178672_128_973 277
78 3300035242 Ga0373962_0000122 Ga0373962_0000122_9670_10515 277
79 3300035691 Ga0373931_0000002 Ga0373931_0000002_427678_428523 277
80 3300035695 Ga0373927_0006021 Ga0373927_0006021_7176_8024 277
81 3300035724 Ga0373933_0032308 Ga0373933_0032308_1179_2027 277
82 3300035725 Ga0373947_0013923 Ga0373947_0013923_814_1659 277
83 3300036401 Ga0373937_0001450 Ga0373937_0001450_5578_6426 277
84 3300037068 Ga0373925_0000977 Ga0373925_0000977_23978_24823 277
85 3300037068 Ga0373925_0042457 Ga0373925_0042457_1646_2494 277
86 3300046514 Ga0495618_0015901 Ga0495618_0015901_2663_3511 277
87 3300046517 Ga0495630_0203725 Ga0495630_0203725_436_1281 277
88 3300046533 Ga0495640_0047114 Ga0495640_0047114_1041_1889 277
89 3300046535 Ga0495586_0000398 Ga0495586_0000398_8071_8919 277
90 3300046642 Ga0495634_0000500 Ga0495634_0000500_19240_20088 277
91 3300046681 Ga0495647_0084526 Ga0495647_0084526_13_861 277
92 3300046689 Ga0495613_0003628 Ga0495613_0003628_1505_2353 277
93 3300047322 Ga0495680_0050141 Ga0495680_0050141_59_907 277
94 3300047471 Ga0495684_0158425 Ga0495684_0158425_270_1118 277
95 3300049568 Ga0501031_0000093 Ga0501031_0000093_46302_47144 277
96 3300049570 Ga0501033_0001521 Ga0501033_0001521_453_1295 277
97 3300049580 Ga0501046_0441094 Ga0501046_0441094_17_859 277
98 3300049822 Ga0501035_0212359 Ga0501035_0212359_664_1506 277
99 3300049823 Ga0501044_0000089 Ga0501044_0000089_91000_91842 277
100 3300053177 Ga0500636_0036266 Ga0500636_0036266_1208_2053 277
101 3300005458 Ga0070681_10177450 Ga0070681_101774502 278
102 3300005530 Ga0070679_100310496 Ga0070679_1003104961 278
103 3300005535 Ga0070684_100198554 Ga0070684_1001985542 278
104 3300005544 Ga0070686_100004277 Ga0070686_1000042774 278
105 3300005563 Ga0068855_100044565 Ga0068855_1000445652 278
106 3300009093 Ga0105240_10131658 Ga0105240_101316583 278
107 3300009093 Ga0105240_10174062 Ga0105240_101740623 278
108 3300013296 Ga0157374_10251469 Ga0157374_102514692 278
109 3300025912 Ga0207707_10140746 Ga0207707_101407462 278
110 3300025921 Ga0207652_10107707 Ga0207652_101077073 278
111 3300025949 Ga0207667_10671115 Ga0207667_106711151 278
112 3300026075 Ga0207708_10437465 Ga0207708_104374651 278
113 3300037471 Ga0395905_0084278 Ga0395905_0084278_583_1440 278
114 3300045051 Ga0451576_0067536 Ga0451576_0067536_506_1363 278
115 3300046533 Ga0495640_0105792 Ga0495640_0105792_430_1281 278
116 3300046536 Ga0495587_0020806 Ga0495587_0020806_204_1040 278
117 3300046559 Ga0495667_0246649 Ga0495667_0246649_59_910 278
118 3300005841 Ga0068863_100087893 Ga0068863_1000878932 279
119 3300009176 Ga0105242_10050175 Ga0105242_100501752 279
120 3300025934 Ga0207686_10315293 Ga0207686_103152932 279
121 3300026088 Ga0207641_10177865 Ga0207641_101778652 279
122 3300028556 Ga0265337_1001542 Ga0265337_10015423 279
123 3300028800 Ga0265338_10001714 Ga0265338_1000171410 279
124 3300028800 Ga0265338_10003617 Ga0265338_100036179 279
125 3300028800 Ga0265338_10032887 Ga0265338_100328872 279
126 3300028800 Ga0265338_10132302 Ga0265338_101323022 279
127 3300031240 Ga0265320_10000145 Ga0265320_1000014521 279
128 3300031249 Ga0265339_10003602 Ga0265339_100036026 279
129 3300035172 Ga0373955_0067188 Ga0373955_0067188_1037_1927 279
130 3300042876 Ga0451577_0026162 Ga0451577_0026162_878_1717 279
131 3300046516 Ga0495628_0061987 Ga0495628_0061987_1027_1872 279
132 3300005330 Ga0070690_100052064 Ga0070690_1000520642 280
133 3300005330 Ga0070690_100150828 Ga0070690_1001508281 280
134 3300005340 Ga0070689_100068115 Ga0070689_1000681152 280
135 3300005340 Ga0070689_100438816 Ga0070689_1004388161 280
136 3300005343 Ga0070687_100040040 Ga0070687_1000400402 280
137 3300005345 Ga0070692_10218858 Ga0070692_102188581 280
138 3300005440 Ga0070705_100236383 Ga0070705_1002363832 280
139 3300005441 Ga0070700_100411868 Ga0070700_1004118681 280
140 3300005445 Ga0070708_100137238 Ga0070708_1001372381 280
141 3300005544 Ga0070686_100002318 Ga0070686_1000023182 280
142 3300005549 Ga0070704_100035207 Ga0070704_1000352071 280
143 3300005617 Ga0068859_100761328 Ga0068859_1007613282 280
144 3300005841 Ga0068863_100116191 Ga0068863_1001161914 280
145 3300006931 Ga0097620_100761371 Ga0097620_1007613712 280
146 3300009094 Ga0111539_10030682 Ga0111539_100306824 280
147 3300014325 Ga0163163_10011418 Ga0163163_100114183 280
148 3300014326 Ga0157380_10404611 Ga0157380_104046111 280
149 3300025936 Ga0207670_10183087 Ga0207670_101830872 280
150 3300025936 Ga0207670_10216289 Ga0207670_102162892 280
151 3300026088 Ga0207641_10073419 Ga0207641_100734193 280
152 3300026116 Ga0207674_10177310 Ga0207674_101773102 280
153 3300028563 Ga0265319_1022419 Ga0265319_10224192 280
154 3300031240 Ga0265320_10010769 Ga0265320_100107697 280
155 3300031241 Ga0265325_10182247 Ga0265325_101822471 280
156 3300045051 Ga0451576_0211210 Ga0451576_0211210_519_1385 280
157 3300046454 Ga0495592_0000012 Ga0495592_0000012_101775_102629 280
158 3300046476 Ga0495662_0104906 Ga0495662_0104906_347_1201 280
159 3300046477 Ga0495664_0073175 Ga0495664_0073175_894_1748 280
160 3300046514 Ga0495618_0001981 Ga0495618_0001981_6933_7787 280
161 3300046516 Ga0495628_0000320 Ga0495628_0000320_10770_11624 280
162 3300046517 Ga0495630_0004207 Ga0495630_0004207_2645_3499 280
163 3300046526 Ga0495666_0042315 Ga0495666_0042315_486_1340 280
164 3300046529 Ga0495652_0031903 Ga0495652_0031903_372_1226 280
165 3300046533 Ga0495640_0010746 Ga0495640_0010746_3264_4118 280
166 3300046535 Ga0495586_0000971 Ga0495586_0000971_4811_5665 280
167 3300046543 Ga0495645_0189142 Ga0495645_0189142_351_1205 280
168 3300046678 Ga0495599_0011346 Ga0495599_0011346_759_1613 280
169 3300047319 Ga0495674_0415573 Ga0495674_0415573_46_900 280
170 3300047471 Ga0495684_0238859 Ga0495684_0238859_349_1203 280
171 3300005340 Ga0070689_100000660 Ga0070689_10000066012 281
172 3300005365 Ga0070688_100005156 Ga0070688_1000051566 281
173 3300005367 Ga0070667_100119955 Ga0070667_1001199552 281
174 3300005466 Ga0070685_10091666 Ga0070685_100916662 281
175 3300005545 Ga0070695_100112160 Ga0070695_1001121602 281
176 3300005618 Ga0068864_100418292 Ga0068864_1004182922 281
177 3300006844 Ga0075428_100013341 Ga0075428_10001334110 281
178 3300006844 Ga0075428_100164274 Ga0075428_1001642743 281
179 3300009094 Ga0111539_10003733 Ga0111539_100037333 281
180 3300009094 Ga0111539_10148940 Ga0111539_101489402 281
181 3300009094 Ga0111539_10411573 Ga0111539_104115732 281
182 3300009176 Ga0105242_10316187 Ga0105242_103161872 281
183 3300013297 Ga0157378_10740454 Ga0157378_107404542 281
184 3300013308 Ga0157375_10051802 Ga0157375_100518023 281
185 3300025934 Ga0207686_10093984 Ga0207686_100939842 281
186 3300025936 Ga0207670_10007821 Ga0207670_100078216 281
187 3300025941 Ga0207711_10617448 Ga0207711_106174481 281
188 3300025986 Ga0207658_10094246 Ga0207658_100942462 281
189 3300026035 Ga0207703_10176174 Ga0207703_101761742 281
190 3300026095 Ga0207676_10215145 Ga0207676_102151452 281
191 3300028556 Ga0265337_1003755 Ga0265337_10037553 281
192 3300031344 Ga0265316_10072810 Ga0265316_100728102 281
193 3300045051 Ga0451576_0058880 Ga0451576_0058880_31_903 281
194 3300050509 nmdc:mga0qj67_127149_c1 nmdc:mga0qj67_127149_c1_753_1625 281
195 3300000545 CNXas_1002651 CNXas_10026512 282
196 3300028800 Ga0265338_10000008 Ga0265338_10000008256 282
197 3300029957 Ga0265324_10000769 Ga0265324_1000076913 282
198 3300031238 Ga0265332_10114462 Ga0265332_101144622 282
199 3300031249 Ga0265339_10078189 Ga0265339_100781892 282
200 3300031249 Ga0265339_10108002 Ga0265339_101080022 282
201 3300044712 Ga0453684_0209460 Ga0453684_0209460_870_1745 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

4

213

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.9121 4 266
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8879 4 259
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8509 4 273
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.8505 4 266
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8297 4 259
ID Description Score Start End Superfamily
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9054 99 168 1.10.150.650
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8605 99 168 1.10.150.650
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8531 4 266 3.20.20.140
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8382 4 273 3.20.20.140
2wrzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8166 20 61 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A538PC56-F1-model_v4 PHP domain-containing protein 0.9895 1 238 GO:0004534
GO:0035312
AF-A0A2V6EYS0-F1-model_v4 Histidinol phosphatase 0.9875 2 276 GO:0004534
GO:0035312
AF-A0A538PC56-F1-model_v4 PHP domain-containing protein 0.9854 1 238 GO:0004534
GO:0035312
AF-A0A3D1IP53-F1-model_v4 Histidinol phosphatase 0.9849 2 271 GO:0004534
GO:0035312
AF-A0A7W0YFP6-F1-model_v4 PHP domain-containing protein 0.9796 1 64 GO:0004534
GO:0035312

Feature Viewer

pLDDT pTM Quality
93.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map