F300815

General Info

Members Datasets Scaffolds Average Seq Length
195 114 184 185

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2903748898|2903754525
Length 226
Sequence TRAARSIMPRAFSSEVDTGSREENASKRESRARSDPIATGSSKDEALPFFTIGHSNRSLADFVVLLTAAGIDRVVDIRTVPRSRSNPQFNKDTLPEPLAAAGISYEHLADLGGLRGKARDVPASVNGFWSNESFRNYADYALSPQFHASLQHLRDEGHRRRCAIMCSEAVWWRCHRRIVADYLIASGETVVHIMGEGRLEPARLTEGAVVESDGTVVYPATGQLDL

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
6 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
7 2904699407
8 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
9 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
29 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
30 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
58 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
59 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
114 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 7.69
Rhizoplane 1.03
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000335 3300002737 Bacteria 41157
2 JGI25162J39368_1001251 3300002737 Bacteria 14526
3 JGI25165J46597_1000649 3300003214 Bacteria 28510
4 rootH1_10066140 3300003316 Bacteria 2726
5 rootH2_10063108 3300003320 Bacteria 3849
6 rootL2_10073652 3300003322 Bacteria 5545
7 rootL2_10122361 3300003322 Bacteria 9536
8 rootL2_10192740 3300003322 Bacteria 2127
9 Ga0055542_1000318 3300003762 Bacteria 51721
10 Ga0055542_1000713 3300003762 Bacteria 26128
11 Ga0070680_100012041 3300005336 Bacteria 6711
12 Ga0070680_100036654 3300005336 Bacteria 3962
13 Ga0070682_100008136 3300005337 Bacteria 5914
14 Ga0070660_100463764 3300005339 Bacteria 1052
15 Ga0070663_101119180 3300005455 Bacteria 689
16 Ga0070681_10861198 3300005458 Bacteria 824
17 Ga0070679_100020749 3300005530 Bacteria 6408
18 Ga0070665_100007234 3300005548 Bacteria 11277
19 Ga0068855_100003165 3300005563 Bacteria 20145
20 Ga0068857_101379567 3300005577 Bacteria 685
21 Ga0068854_100151016 3300005578 Bacteria 1791
22 Ga0068856_100733729 3300005614 Bacteria 1008
23 Ga0081539_10148914 3300005985 Bacteria 1128
24 Ga0099825_1043739 3300006941 Bacteria 1189
25 Ga0099824_1013255 3300006942 Bacteria 8634
26 Ga0099822_1007508 3300006943 Bacteria 14086
27 Ga0105240_10025269 3300009093 Bacteria 7810
28 Ga0105240_10576542 3300009093 Bacteria 1242
29 Ga0105237_10737738 3300009545 Bacteria 991
30 Ga0105238_10019593 3300009551 Bacteria 6889
31 Ga0105238_10081485 3300009551 Bacteria 3225
32 Ga0105238_10124703 3300009551 Bacteria 2555
33 Ga0105239_10465060 3300010375 Bacteria 1436
34 Ga0157370_10035441 3300013104 Bacteria 4849
35 Ga0157370_10052811 3300013104 Bacteria 3878
36 Ga0157369_10040935 3300013105 Bacteria 5057
37 Ga0157369_10049763 3300013105 Bacteria 4541
38 Ga0157374_10342162 3300013296 Bacteria 1485
39 Ga0157372_10041296 3300013307 Bacteria 5099
40 Ga0157372_11099788 3300013307 Bacteria 919
41 Ga0207427_100789 3300025231 Bacteria 14414
42 Ga0209437_100076 3300025233 Bacteria 295194
43 Ga0209437_100301 3300025233 Bacteria 69230
44 Ga0209258_101908 3300025242 Bacteria 6163
45 Ga0209026_1001856 3300025250 Bacteria 8627
46 Ga0209148_1000002 3300025254 Bacteria 2399500
47 Ga0209233_1000285 3300025261 Bacteria 69238
48 Ga0209233_1003505 3300025261 Bacteria 5515
49 Ga0209233_1023932 3300025261 Bacteria 1536
50 Ga0207654_10044842 3300025911 Bacteria 2514
51 Ga0207707_10000736 3300025912 Bacteria 32389
52 Ga0207707_10045325 3300025912 Bacteria 3832
53 Ga0207707_10690353 3300025912 Bacteria 858
54 Ga0207695_10006455 3300025913 Bacteria 15225
55 Ga0207660_10074151 3300025917 Bacteria 2483
56 Ga0207657_10327874 3300025919 Bacteria 1210
57 Ga0207652_10019356 3300025921 Bacteria 5598
58 Ga0207694_10046951 3300025924 Bacteria 3339
59 Ga0207667_10103199 3300025949 Bacteria 2941
60 Ga0207640_10354163 3300025981 Bacteria 1180
61 Ga0207639_11096381 3300026041 Unclassified 747
62 Ga0207678_11016800 3300026067 Bacteria 734
63 Ga0207702_10672904 3300026078 Bacteria 1019
64 Ga0209589_1000002 3300027357 Bacteria 708598
65 Ga0209489_100002 3300027361 Bacteria 708609
66 Ga0209700_100002 3300027363 Bacteria 708598
67 Ga0307414_10296922 3300032004 Bacteria 1365
68 Ga0395899_0000307 3300037312 Bacteria 62610
69 Ga0395900_0000976 3300037418 Bacteria 37190
70 Ga0395898_0000144 3300037466 Bacteria 187889
71 Ga0395898_0011304 3300037466 Bacteria 9281
72 Ga0395898_0165168 3300037466 Bacteria 2117
73 Ga0395905_0033369 3300037471 Bacteria 4835
74 Ga0395905_0044417 3300037471 Bacteria 4171
75 Ga0395901_0244724 3300038443 Bacteria 1870
76 Ga0395901_0464093 3300038443 Bacteria 1293
77 Ga0436363_0628514 3300039450 Bacteria 1821
78 Ga0450901_026519 3300042533 Bacteria 632
79 Ga0466969_0009251 3300044656 Bacteria 5223
80 Ga0466982_0394061 3300044672 Bacteria 752
81 Ga0466966_0033164 3300044684 Bacteria 3343
82 Ga0466961_0019411 3300044693 Bacteria 4371
83 Ga0466971_0059121 3300044719 Bacteria 1731
84 Ga0466960_0009579 3300044901 Bacteria 3998
85 Ga0466958_0027726 3300045836 Bacteria 3353
86 Ga0466958_0253130 3300045836 Bacteria 1127
87 Ga0495604_0046854 3300047317 Bacteria 3370
88 Ga0495674_0225210 3300047319 Bacteria 1549
89 Ga0496100_0438067 3300048903 Bacteria 1000
90 Ga0496102_0124321 3300048905 Bacteria 2411
91 Ga0496121_0124043 3300048924 Bacteria 1945
92 Ga0501031_0001929 3300049568 Bacteria 13080
93 Ga0501031_0037753 3300049568 Bacteria 3153
94 Ga0501031_0183211 3300049568 Bacteria 1368
95 Ga0501032_0000520 3300049569 Bacteria 31263
96 Ga0501032_0020215 3300049569 Bacteria 4641
97 Ga0501032_0088459 3300049569 Bacteria 2056
98 Ga0501032_0095068 3300049569 Bacteria 1975
99 Ga0501033_0000192 3300049570 Bacteria 58682
100 Ga0501033_0048867 3300049570 Bacteria 3141
101 Ga0501033_0507429 3300049570 Bacteria 834
102 Ga0501034_0000161 3300049571 Bacteria 126011
103 Ga0501034_0002321 3300049571 Bacteria 23230
104 Ga0501034_0081134 3300049571 Bacteria 3246
105 Ga0501034_0281010 3300049571 Bacteria 1604
106 Ga0501034_0492268 3300049571 Bacteria 1140
107 Ga0501034_0494695 3300049571 Bacteria 1137
108 Ga0501036_0000152 3300049572 Bacteria 45346
109 Ga0501036_0000242 3300049572 Bacteria 36845
110 Ga0501036_0025763 3300049572 Bacteria 4963
111 Ga0501036_0352708 3300049572 Bacteria 1228
112 Ga0501037_0000029 3300049573 Bacteria 139680
113 Ga0501037_0041194 3300049573 Bacteria 3396
114 Ga0501037_0191427 3300049573 Bacteria 1448
115 Ga0501037_0344309 3300049573 Bacteria 1029
116 Ga0501038_0000263 3300049574 Bacteria 44382
117 Ga0501038_0101377 3300049574 Bacteria 2397
118 Ga0501038_0137444 3300049574 Bacteria 2001
119 Ga0501038_0146121 3300049574 Bacteria 1930
120 Ga0501039_0000043 3300049575 Bacteria 109462
121 Ga0501039_0004465 3300049575 Bacteria 10560
122 Ga0501041_0339601 3300049577 Bacteria 948
123 Ga0501042_0170338 3300049578 Bacteria 1571
124 Ga0501042_0434864 3300049578 Bacteria 951
125 Ga0501043_0000260 3300049579 Bacteria 48057
126 Ga0501043_0005561 3300049579 Bacteria 10160
127 Ga0501043_0016378 3300049579 Bacteria 5812
128 Ga0501043_0173830 3300049579 Bacteria 1680
129 Ga0501046_0028292 3300049580 Bacteria 4566
130 Ga0501046_0184266 3300049580 Bacteria 1560
131 Ga0501046_0208195 3300049580 Bacteria 1453
132 Ga0501047_0000073 3300049581 Bacteria 125990
133 Ga0501047_0294612 3300049581 Bacteria 1466
134 Ga0501047_0497766 3300049581 Bacteria 1045
135 Ga0501048_0000014 3300049582 Bacteria 75001
136 Ga0501048_0084120 3300049582 Bacteria 2243
137 Ga0501067_0084680 3300049583 Bacteria 1759
138 Ga0501068_0112247 3300049584 Bacteria 1695
139 Ga0501069_0019659 3300049585 Bacteria 3654
140 Ga0501070_0006639 3300049586 Bacteria 9848
141 Ga0501070_0021605 3300049586 Bacteria 5397
142 Ga0501070_0144130 3300049586 Bacteria 1966
143 Ga0501070_0390377 3300049586 Bacteria 1127
144 Ga0501071_0049356 3300049587 Bacteria 3029
145 Ga0501072_0186083 3300049588 Bacteria 1656
146 Ga0501072_0336093 3300049588 Bacteria 1200
147 Ga0501072_0819124 3300049588 Bacteria 729
148 Ga0501073_0025251 3300049589 Bacteria 4263
149 Ga0501073_0146741 3300049589 Bacteria 1635
150 Ga0501074_0015045 3300049590 Bacteria 5628
151 Ga0501074_0038668 3300049590 Bacteria 3456
152 Ga0501075_0201169 3300049591 Bacteria 1519
153 Ga0501076_0153971 3300049592 Bacteria 1871
154 Ga0501076_0393097 3300049592 Bacteria 1140
155 Ga0501076_0877083 3300049592 Bacteria 740
156 Ga0501079_0078369 3300049741 Bacteria 2556
157 Ga0501079_0225379 3300049741 Bacteria 1464
158 Ga0501080_0000187 3300049742 Bacteria 45224
159 Ga0501080_0012496 3300049742 Bacteria 7786
160 Ga0501080_0084333 3300049742 Bacteria 2952
161 Ga0501080_0228136 3300049742 Bacteria 1703
162 Ga0501080_0248864 3300049742 Bacteria 1621
163 Ga0501081_0137616 3300049743 Bacteria 1749
164 Ga0501083_0000139 3300049744 Bacteria 49384
165 Ga0501083_0024817 3300049744 Bacteria 4152
166 Ga0501083_0337009 3300049744 Bacteria 981
167 Ga0501035_0000057 3300049822 Bacteria 135297
168 Ga0501035_0050783 3300049822 Bacteria 3715
169 Ga0501035_0066318 3300049822 Bacteria 3203
170 Ga0501035_0105192 3300049822 Bacteria 2475
171 Ga0501044_0000140 3300049823 Bacteria 88672
172 Ga0501044_0002061 3300049823 Bacteria 23167
173 Ga0501044_0009678 3300049823 Bacteria 10484
174 Ga0501044_0067771 3300049823 Bacteria 3635
175 Ga0501044_0225725 3300049823 Bacteria 1822
176 Ga0501044_0269161 3300049823 Bacteria 1640
177 Ga0501044_0332228 3300049823 Bacteria 1442
178 Ga0501044_0342308 3300049823 Bacteria 1416
179 Ga0501044_0377318 3300049823 Bacteria 1333
180 Ga0501044_0478157 3300049823 Bacteria 1149
181 Ga0501045_0266196 3300049824 Bacteria 1276
182 Ga0501045_0337153 3300049824 Bacteria 1122
183 Ga0501082_0196576 3300060353 Bacteria 1754
184 Ga0466962_0003923 3300061719 Bacteria 7116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003762 Ga0055542_1000318 Ga0055542_100031813 180
2 3300003322 rootL2_10192740 rootL2_101927402 181
3 3300005985 Ga0081539_10148914 Ga0081539_101489143 181
4 3300037471 Ga0395905_0044417 Ga0395905_0044417_3543_4106 181
5 3300042533 Ga0450901_026519 Ga0450901_026519_50_595 181
6 3300044656 Ga0466969_0009251 Ga0466969_0009251_2496_3044 181
7 3300044684 Ga0466966_0033164 Ga0466966_0033164_976_1524 181
8 3300044719 Ga0466971_0059121 Ga0466971_0059121_864_1412 181
9 3300045836 Ga0466958_0027726 Ga0466958_0027726_1725_2273 181
10 3300049586 Ga0501070_0390377 Ga0501070_0390377_197_742 181
11 3300061719 Ga0466962_0003923 Ga0466962_0003923_829_1377 181
12 3300002737 JGI25162J39368_1001251 JGI25162J39368_10012515 182
13 3300003316 rootH1_10066140 rootH1_100661402 182
14 3300003320 rootH2_10063108 rootH2_100631084 182
15 3300003322 rootL2_10073652 rootL2_100736522 182
16 3300003322 rootL2_10122361 rootL2_101223619 182
17 3300003762 Ga0055542_1000713 Ga0055542_100071320 182
18 3300005336 Ga0070680_100012041 Ga0070680_1000120413 182
19 3300005336 Ga0070680_100036654 Ga0070680_1000366544 182
20 3300005337 Ga0070682_100008136 Ga0070682_1000081364 182
21 3300005339 Ga0070660_100463764 Ga0070660_1004637641 182
22 3300005455 Ga0070663_101119180 Ga0070663_1011191801 182
23 3300005458 Ga0070681_10861198 Ga0070681_108611981 182
24 3300005530 Ga0070679_100020749 Ga0070679_1000207493 182
25 3300005548 Ga0070665_100007234 Ga0070665_1000072347 182
26 3300005563 Ga0068855_100003165 Ga0068855_1000031653 182
27 3300005578 Ga0068854_100151016 Ga0068854_1001510162 182
28 3300005614 Ga0068856_100733729 Ga0068856_1007337292 182
29 3300006941 Ga0099825_1043739 Ga0099825_10437392 182
30 3300006942 Ga0099824_1013255 Ga0099824_10132554 182
31 3300006943 Ga0099822_1007508 Ga0099822_10075087 182
32 3300009093 Ga0105240_10025269 Ga0105240_100252699 182
33 3300009093 Ga0105240_10576542 Ga0105240_105765422 182
34 3300009551 Ga0105238_10019593 Ga0105238_100195933 182
35 3300009551 Ga0105238_10081485 Ga0105238_100814852 182
36 3300009551 Ga0105238_10124703 Ga0105238_101247033 182
37 3300013104 Ga0157370_10035441 Ga0157370_100354412 182
38 3300013104 Ga0157370_10052811 Ga0157370_100528114 182
39 3300013105 Ga0157369_10040935 Ga0157369_100409352 182
40 3300013105 Ga0157369_10049763 Ga0157369_100497633 182
41 3300013296 Ga0157374_10342162 Ga0157374_103421622 182
42 3300013307 Ga0157372_10041296 Ga0157372_100412962 182
43 3300013307 Ga0157372_11099788 Ga0157372_110997881 182
44 3300025231 Ga0207427_100789 Ga0207427_10078920 182
45 3300025233 Ga0209437_100076 Ga0209437_10007684 182
46 3300025242 Ga0209258_101908 Ga0209258_1019085 182
47 3300025250 Ga0209026_1001856 Ga0209026_10018562 182
48 3300025254 Ga0209148_1000002 Ga0209148_10000021087 182
49 3300025261 Ga0209233_1023932 Ga0209233_10239322 182
50 3300025911 Ga0207654_10044842 Ga0207654_100448422 182
51 3300025912 Ga0207707_10000736 Ga0207707_100007366 182
52 3300025912 Ga0207707_10045325 Ga0207707_100453255 182
53 3300025912 Ga0207707_10690353 Ga0207707_106903531 182
54 3300025913 Ga0207695_10006455 Ga0207695_100064556 182
55 3300025917 Ga0207660_10074151 Ga0207660_100741513 182
56 3300025919 Ga0207657_10327874 Ga0207657_103278742 182
57 3300025921 Ga0207652_10019356 Ga0207652_100193566 182
58 3300025924 Ga0207694_10046951 Ga0207694_100469513 182
59 3300025949 Ga0207667_10103199 Ga0207667_101031993 182
60 3300025981 Ga0207640_10354163 Ga0207640_103541633 182
61 3300026041 Ga0207639_11096381 Ga0207639_110963811 182
62 3300026067 Ga0207678_11016800 Ga0207678_110168001 182
63 3300026078 Ga0207702_10672904 Ga0207702_106729042 182
64 3300027357 Ga0209589_1000002 Ga0209589_1000002632 182
65 3300027361 Ga0209489_100002 Ga0209489_100002632 182
66 3300027363 Ga0209700_100002 Ga0209700_100002632 182
67 3300032004 Ga0307414_10296922 Ga0307414_102969221 182
68 3300037312 Ga0395899_0000307 Ga0395899_0000307_8009_8557 182
69 3300037418 Ga0395900_0000976 Ga0395900_0000976_13804_14352 182
70 3300037466 Ga0395898_0000144 Ga0395898_0000144_58443_58991 182
71 3300037466 Ga0395898_0011304 Ga0395898_0011304_4992_5540 182
72 3300037471 Ga0395905_0033369 Ga0395905_0033369_2940_3488 182
73 3300038443 Ga0395901_0244724 Ga0395901_0244724_1222_1776 182
74 3300039450 Ga0436363_0628514 Ga0436363_0628514_372_935 182
75 3300044672 Ga0466982_0394061 Ga0466982_0394061_74_640 182
76 3300044693 Ga0466961_0019411 Ga0466961_0019411_1142_1708 182
77 3300044901 Ga0466960_0009579 Ga0466960_0009579_1298_1864 182
78 3300047317 Ga0495604_0046854 Ga0495604_0046854_623_1171 182
79 3300047319 Ga0495674_0225210 Ga0495674_0225210_510_1058 182
80 3300049568 Ga0501031_0001929 Ga0501031_0001929_3324_3875 182
81 3300049568 Ga0501031_0037753 Ga0501031_0037753_1925_2473 182
82 3300049568 Ga0501031_0183211 Ga0501031_0183211_129_689 182
83 3300049569 Ga0501032_0000520 Ga0501032_0000520_15679_16230 182
84 3300049569 Ga0501032_0088459 Ga0501032_0088459_44_592 182
85 3300049569 Ga0501032_0095068 Ga0501032_0095068_888_1460 182
86 3300049570 Ga0501033_0000192 Ga0501033_0000192_5412_5963 182
87 3300049570 Ga0501033_0048867 Ga0501033_0048867_138_686 182
88 3300049570 Ga0501033_0507429 Ga0501033_0507429_115_663 182
89 3300049571 Ga0501034_0002321 Ga0501034_0002321_7646_8197 182
90 3300049571 Ga0501034_0081134 Ga0501034_0081134_1158_1706 182
91 3300049571 Ga0501034_0281010 Ga0501034_0281010_46_606 182
92 3300049571 Ga0501034_0494695 Ga0501034_0494695_361_909 182
93 3300049572 Ga0501036_0000152 Ga0501036_0000152_15743_16294 182
94 3300049572 Ga0501036_0352708 Ga0501036_0352708_253_801 182
95 3300049573 Ga0501037_0000029 Ga0501037_0000029_87195_87746 182
96 3300049573 Ga0501037_0041194 Ga0501037_0041194_130_678 182
97 3300049573 Ga0501037_0191427 Ga0501037_0191427_445_1005 182
98 3300049573 Ga0501037_0344309 Ga0501037_0344309_34_582 182
99 3300049574 Ga0501038_0000263 Ga0501038_0000263_15551_16102 182
100 3300049574 Ga0501038_0137444 Ga0501038_0137444_243_791 182
101 3300049575 Ga0501039_0000043 Ga0501039_0000043_87183_87734 182
102 3300049577 Ga0501041_0339601 Ga0501041_0339601_293_844 182
103 3300049578 Ga0501042_0434864 Ga0501042_0434864_76_627 182
104 3300049579 Ga0501043_0000260 Ga0501043_0000260_21317_21868 182
105 3300049579 Ga0501043_0173830 Ga0501043_0173830_436_996 182
106 3300049580 Ga0501046_0184266 Ga0501046_0184266_840_1391 182
107 3300049580 Ga0501046_0208195 Ga0501046_0208195_655_1215 182
108 3300049581 Ga0501047_0497766 Ga0501047_0497766_101_661 182
109 3300049583 Ga0501067_0084680 Ga0501067_0084680_167_715 182
110 3300049586 Ga0501070_0144130 Ga0501070_0144130_1128_1688 182
111 3300049588 Ga0501072_0819124 Ga0501072_0819124_118_666 182
112 3300049589 Ga0501073_0146741 Ga0501073_0146741_971_1531 182
113 3300049591 Ga0501075_0201169 Ga0501075_0201169_916_1473 182
114 3300049592 Ga0501076_0153971 Ga0501076_0153971_55_603 182
115 3300049592 Ga0501076_0393097 Ga0501076_0393097_275_832 182
116 3300049592 Ga0501076_0877083 Ga0501076_0877083_169_717 182
117 3300049741 Ga0501079_0078369 Ga0501079_0078369_234_791 182
118 3300049742 Ga0501080_0084333 Ga0501080_0084333_1146_1706 182
119 3300049742 Ga0501080_0228136 Ga0501080_0228136_601_1158 182
120 3300049742 Ga0501080_0248864 Ga0501080_0248864_299_871 182
121 3300049743 Ga0501081_0137616 Ga0501081_0137616_538_1095 182
122 3300049744 Ga0501083_0337009 Ga0501083_0337009_47_595 182
123 3300049822 Ga0501035_0000057 Ga0501035_0000057_87175_87726 182
124 3300049822 Ga0501035_0050783 Ga0501035_0050783_2780_3328 182
125 3300049822 Ga0501035_0066318 Ga0501035_0066318_1975_2523 182
126 3300049823 Ga0501044_0000140 Ga0501044_0000140_36074_36622 182
127 3300049823 Ga0501044_0009678 Ga0501044_0009678_7487_8038 182
128 3300049823 Ga0501044_0225725 Ga0501044_0225725_1107_1655 182
129 3300049823 Ga0501044_0332228 Ga0501044_0332228_313_861 182
130 3300049823 Ga0501044_0342308 Ga0501044_0342308_775_1323 182
131 3300049823 Ga0501044_0377318 Ga0501044_0377318_362_922 182
132 3300049823 Ga0501044_0478157 Ga0501044_0478157_32_580 182
133 3300049824 Ga0501045_0337153 Ga0501045_0337153_494_1045 182
134 3300060353 Ga0501082_0196576 Ga0501082_0196576_806_1354 182
135 3300049571 Ga0501034_0000161 Ga0501034_0000161_123808_124365 183
136 iso_pu_bacteria 2513237096 2513656354 183
137 iso_pu_bacteria 2513237137 2513857051 183
138 iso_pu_bacteria 2513237145 2513917467 183
139 iso_pu_bacteria 2517572143 2517887855 183
140 iso_pu_bacteria 2791355197 2793070650 183
141 iso_pu_bacteria 2904699407 2904709983 183
142 iso_pu_bacteria 2906660503 2906663065 183
143 iso_pu_bacteria 3005474847 3005482956 183
144 iso_pu_bacteria 8019555841 8019563385 183
145 iso_pu_bacteria 8019565922 8019573469 183
146 3300005577 Ga0068857_101379567 Ga0068857_1013795671 184
147 3300049588 Ga0501072_0336093 Ga0501072_0336093_548_1117 184
148 3300049822 Ga0501035_0105192 Ga0501035_0105192_700_1254 184
149 3300049823 Ga0501044_0269161 Ga0501044_0269161_285_839 184
150 3300009545 Ga0105237_10737738 Ga0105237_107377382 185
151 3300010375 Ga0105239_10465060 Ga0105239_104650602 185
152 3300025261 Ga0209233_1003505 Ga0209233_10035055 185
153 3300037466 Ga0395898_0165168 Ga0395898_0165168_899_1456 185
154 3300038443 Ga0395901_0464093 Ga0395901_0464093_193_750 185
155 3300048903 Ga0496100_0438067 Ga0496100_0438067_233_796 185
156 3300048905 Ga0496102_0124321 Ga0496102_0124321_1593_2156 185
157 3300048924 Ga0496121_0124043 Ga0496121_0124043_929_1492 185
158 3300049569 Ga0501032_0020215 Ga0501032_0020215_2100_2657 185
159 3300049571 Ga0501034_0492268 Ga0501034_0492268_419_976 185
160 3300049572 Ga0501036_0025763 Ga0501036_0025763_3988_4545 185
161 3300049574 Ga0501038_0146121 Ga0501038_0146121_955_1512 185
162 3300049575 Ga0501039_0004465 Ga0501039_0004465_5730_6287 185
163 3300049578 Ga0501042_0170338 Ga0501042_0170338_560_1117 185
164 3300049579 Ga0501043_0016378 Ga0501043_0016378_2393_2950 185
165 3300049580 Ga0501046_0028292 Ga0501046_0028292_3563_4120 185
166 3300049581 Ga0501047_0294612 Ga0501047_0294612_609_1178 185
167 3300049582 Ga0501048_0084120 Ga0501048_0084120_1178_1735 185
168 3300049584 Ga0501068_0112247 Ga0501068_0112247_720_1277 185
169 3300049585 Ga0501069_0019659 Ga0501069_0019659_2651_3208 185
170 3300049586 Ga0501070_0021605 Ga0501070_0021605_2122_2679 185
171 3300049587 Ga0501071_0049356 Ga0501071_0049356_672_1229 185
172 3300049588 Ga0501072_0186083 Ga0501072_0186083_165_722 185
173 3300049589 Ga0501073_0025251 Ga0501073_0025251_1757_2314 185
174 3300049590 Ga0501074_0015045 Ga0501074_0015045_671_1228 185
175 3300049741 Ga0501079_0225379 Ga0501079_0225379_616_1173 185
176 3300049742 Ga0501080_0012496 Ga0501080_0012496_3007_3564 185
177 3300049744 Ga0501083_0024817 Ga0501083_0024817_3394_3951 185
178 3300049823 Ga0501044_0067771 Ga0501044_0067771_2719_3276 185
179 3300002737 JGI25162J39368_1000335 JGI25162J39368_100033540 186
180 3300003214 JGI25165J46597_1000649 JGI25165J46597_100064915 186
181 3300025233 Ga0209437_100301 Ga0209437_10030113 186
182 3300025261 Ga0209233_1000285 Ga0209233_100028513 186
183 3300045836 Ga0466958_0253130 Ga0466958_0253130_310_879 186
184 3300049572 Ga0501036_0000242 Ga0501036_0000242_13561_14145 186
185 3300049574 Ga0501038_0101377 Ga0501038_0101377_315_899 186
186 3300049579 Ga0501043_0005561 Ga0501043_0005561_8776_9360 186
187 3300049581 Ga0501047_0000073 Ga0501047_0000073_40234_40818 186
188 3300049582 Ga0501048_0000014 Ga0501048_0000014_52605_53189 186
189 3300049586 Ga0501070_0006639 Ga0501070_0006639_8881_9465 186
190 3300049590 Ga0501074_0038668 Ga0501074_0038668_1573_2157 186
191 3300049742 Ga0501080_0000187 Ga0501080_0000187_8682_9266 186
192 3300049744 Ga0501083_0000139 Ga0501083_0000139_45455_46039 186
193 3300049823 Ga0501044_0002061 Ga0501044_0002061_15805_16389 186
194 3300049824 Ga0501045_0266196 Ga0501045_0266196_104_688 186
195 iso_pu_bacteria 2903748898 2903754525 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

58

183

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.675 11 147
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.6483 1 147
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.6358 6 147
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.6305 1 147
2po3-assembly1.cif.gz_B crystal structure analysis of desi in the presence of its tdp-sugar product 0.6277 20 67
ID Description Score Start End Superfamily
af_Q2G0A6_1_127_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.795 18 67 3.40.50.620
5himA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6594 13 67 3.40.50.150
af_Q9XXK8_1_167_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6586 9 146 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6515 1 147 3.90.190.10
1a4iA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.6472 31 67 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A1G5NK27-F1-model_v4 deleted 0.9884 81 184
AF-A0A6P2Z901-F1-model_v4 PF04343 family protein 0.9832 5 181
AF-A0A0L8EV09-F1-model_v4 deleted 0.9824 5 179
AF-A0A158DNL2-F1-model_v4 PF04343 family protein 0.982 5 185
AF-D7B1X3-F1-model_v4 DNA repair protein 0.981 5 180

Feature Viewer

pLDDT pTM Quality
89.95 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map