F299349

General Info

Members Datasets Scaffolds Average Seq Length
194 130 194 291

Family's Representative Sequence

Representative Sequence 3300053727|Ga0500611_000022|Ga0500611_000022_57498_58469
Length 323
Sequence LNIEHLSLNSYYFAPAMSSLIHYTHCPVCGSTAIAPVLSAKDHTVSGELFPVVACTDCTLRFTQDVPDAEAIGPYYKSEDYISHTNTSKGLINRLYQAVRKRTIAGKRRLIIRQTGKQKGSLLDVGSGVGTFAHTMKQNGWEVTGLEPDADARSVAKQLYAIELEDTSRFQQLTPGSFDAITLWHVLEHIHELQAYIQQLKRLLKDDGCLFIAVPNYTSLDASVYKEWWAAYDVPRHLYHFSPRSIEVLMGKNGLKVIRHRPMWYDSFYISMLSSKYKNGKTNMITAVWNGLCSNLKALGNTDKCSSVIYIVRKSESPLREFT

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
128 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 0
Rhizosphere 92.27
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001257 3300002459 Bacteria 5356
2 rootH1_10181169 3300003316 Bacteria 2252
3 Ga0065707_10096135 3300005295 Bacteria 3301
4 Ga0070676_10003259 3300005328 Bacteria 8428
5 Ga0070683_100022412 3300005329 Bacteria 5645
6 Ga0070670_100021945 3300005331 Bacteria 5493
7 Ga0070677_10023130 3300005333 Unclassified 2298
8 Ga0068869_100042265 3300005334 Unclassified 3267
9 Ga0068869_100074536 3300005334 Bacteria 2519
10 Ga0070666_10021527 3300005335 Bacteria 4181
11 Ga0068868_100008240 3300005338 Bacteria 7460
12 Ga0070691_10067731 3300005341 Bacteria 1727
13 Ga0070675_100041406 3300005354 Unclassified 3763
14 Ga0070674_100084423 3300005356 Bacteria 2277
15 Ga0070667_100228531 3300005367 Unclassified 1658
16 Ga0070700_100040417 3300005441 Bacteria 2855
17 Ga0070678_100017168 3300005456 Unclassified 4652
18 Ga0070662_100359811 3300005457 Unclassified 1194
19 Ga0070681_10021081 3300005458 Bacteria 6529
20 Ga0068867_100019215 3300005459 Unclassified 4868
21 Ga0070684_100001699 3300005535 Bacteria 16028
22 Ga0068853_100042914 3300005539 Bacteria 3869
23 Ga0068853_100134842 3300005539 Unclassified 2212
24 Ga0070672_100100414 3300005543 Unclassified 2347
25 Ga0070665_100011862 3300005548 Bacteria 8802
26 Ga0068855_100000089 3300005563 Bacteria 110845
27 Ga0068855_100021393 3300005563 Bacteria 7756
28 Ga0068857_100010174 3300005577 Bacteria 8177
29 Ga0068857_100010879 3300005577 Bacteria 7917
30 Ga0068854_100031561 3300005578 Unclassified 3683
31 Ga0068856_100008851 3300005614 Bacteria 9797
32 Ga0068856_100058023 3300005614 Bacteria 3823
33 Ga0068856_100142743 3300005614 Bacteria 2402
34 Ga0068852_100000488 3300005616 Bacteria 25890
35 Ga0068852_100105597 3300005616 Bacteria 2552
36 Ga0068864_100075065 3300005618 Unclassified 2951
37 Ga0068864_100106423 3300005618 Unclassified 2494
38 Ga0068866_10010029 3300005718 Unclassified 4048
39 Ga0068861_100054649 3300005719 Unclassified 3043
40 Ga0068863_100154684 3300005841 Unclassified 2195
41 Ga0068860_100000111 3300005843 Bacteria 131004
42 Ga0068860_100044956 3300005843 Unclassified 4209
43 Ga0068860_100050158 3300005843 Unclassified 3974
44 Ga0068860_100265544 3300005843 Bacteria 1674
45 Ga0081539_10012393 3300005985 Bacteria 6578
46 Ga0097621_100027438 3300006237 Unclassified 4478
47 Ga0068871_100455534 3300006358 Bacteria 1147
48 Ga0075428_100020017 3300006844 Bacteria 7411
49 Ga0075428_100069579 3300006844 Bacteria 3848
50 Ga0075429_100001269 3300006880 Bacteria 20542
51 Ga0068865_100017131 3300006881 Unclassified 4653
52 Ga0105240_10000074 3300009093 Bacteria 199611
53 Ga0105240_10003016 3300009093 Bacteria 26478
54 Ga0105240_10009614 3300009093 Bacteria 13677
55 Ga0105240_10023848 3300009093 Bacteria 8081
56 Ga0105240_10136308 3300009093 Bacteria 2939
57 Ga0105240_10292606 3300009093 Bacteria 1866
58 Ga0111539_10061083 3300009094 Bacteria 4465
59 Ga0105243_10063094 3300009148 Unclassified 2969
60 Ga0105241_10000411 3300009174 Bacteria 32325
61 Ga0105241_10190199 3300009174 Bacteria 1708
62 Ga0105242_10038203 3300009176 Unclassified 3860
63 Ga0105242_10043388 3300009176 Bacteria 3638
64 Ga0105237_10004335 3300009545 Bacteria 16445
65 Ga0105237_10008089 3300009545 Bacteria 11432
66 Ga0105237_10025072 3300009545 Bacteria 6100
67 Ga0105237_10126888 3300009545 Bacteria 2546
68 Ga0105238_10048697 3300009551 Unclassified 4270
69 Ga0105238_10058171 3300009551 Bacteria 3875
70 Ga0105238_10283338 3300009551 Bacteria 1639
71 Ga0105249_10006143 3300009553 Bacteria 10418
72 Ga0105249_10012155 3300009553 Bacteria 7580
73 Ga0105239_10000529 3300010375 Bacteria 55233
74 Ga0105239_10002298 3300010375 Bacteria 24404
75 Ga0105239_10022839 3300010375 Bacteria 6896
76 Ga0105239_10040560 3300010375 Bacteria 5100
77 Ga0105246_10043876 3300011119 Bacteria 3036
78 Ga0105246_10214673 3300011119 Bacteria 1504
79 Ga0157370_10017131 3300013104 Bacteria 7316
80 Ga0157370_10019516 3300013104 Bacteria 6798
81 Ga0157369_10027025 3300013105 Bacteria 6364
82 Ga0157369_10046959 3300013105 Bacteria 4691
83 Ga0157378_10034428 3300013297 Unclassified 4479
84 Ga0163162_10000448 3300013306 Bacteria 38173
85 Ga0163162_10418965 3300013306 Unclassified 1471
86 Ga0157372_10001519 3300013307 Bacteria 25228
87 Ga0157372_10007665 3300013307 Bacteria 11480
88 Ga0157372_10173959 3300013307 Unclassified 2491
89 Ga0157375_10090201 3300013308 Unclassified 3123
90 Ga0163163_10091052 3300014325 Bacteria 3063
91 Ga0207688_10009731 3300025901 Bacteria 5231
92 Ga0207647_10006347 3300025904 Bacteria 8597
93 Ga0207645_10001795 3300025907 Bacteria 17324
94 Ga0207643_10040296 3300025908 Unclassified 2629
95 Ga0207643_10074173 3300025908 Unclassified 1962
96 Ga0207707_10015216 3300025912 Bacteria 6699
97 Ga0207695_10000071 3300025913 Bacteria 315568
98 Ga0207695_10002454 3300025913 Bacteria 27411
99 Ga0207695_10008205 3300025913 Bacteria 13116
100 Ga0207695_10021754 3300025913 Bacteria 7306
101 Ga0207671_10002216 3300025914 Bacteria 21092
102 Ga0207671_10025208 3300025914 Bacteria 4467
103 Ga0207671_10073019 3300025914 Bacteria 2562
104 Ga0207662_10200850 3300025918 Unclassified 1290
105 Ga0207681_10176175 3300025923 Unclassified 1625
106 Ga0207686_10024979 3300025934 Unclassified 3469
107 Ga0207709_10052796 3300025935 Unclassified 2498
108 Ga0207669_10022422 3300025937 Unclassified 3354
109 Ga0207704_10319470 3300025938 Unclassified 1197
110 Ga0207691_10021206 3300025940 Bacteria 6138
111 Ga0207689_10003973 3300025942 Bacteria 13451
112 Ga0207689_10128668 3300025942 Bacteria 2083
113 Ga0207689_10321954 3300025942 Bacteria 1283
114 Ga0207661_10015277 3300025944 Bacteria 5645
115 Ga0207667_10000177 3300025949 Bacteria 92852
116 Ga0207667_10001238 3300025949 Bacteria 32040
117 Ga0207667_10048848 3300025949 Bacteria 4473
118 Ga0207651_10614607 3300025960 Unclassified 951
119 Ga0207712_10005769 3300025961 Bacteria 7800
120 Ga0207640_10066291 3300025981 Bacteria 2412
121 Ga0207658_10192670 3300025986 Unclassified 1696
122 Ga0207639_10035325 3300026041 Bacteria 3698
123 Ga0207639_10086516 3300026041 Bacteria 2496
124 Ga0207639_10096663 3300026041 Unclassified 2377
125 Ga0207639_10480718 3300026041 Unclassified 1132
126 Ga0207708_10095641 3300026075 Bacteria 2294
127 Ga0207702_10039564 3300026078 Bacteria 3952
128 Ga0207702_10185684 3300026078 Unclassified 1917
129 Ga0207641_10170101 3300026088 Unclassified 1988
130 Ga0207676_10075783 3300026095 Unclassified 2715
131 Ga0207676_10481869 3300026095 Unclassified 1175
132 Ga0207674_10015724 3300026116 Bacteria 8303
133 Ga0207674_10022778 3300026116 Bacteria 6722
134 Ga0207674_10101183 3300026116 Bacteria 2863
135 Ga0207675_100082852 3300026118 Unclassified 3008
136 Ga0207683_10002179 3300026121 Bacteria 17204
137 Ga0207698_10001818 3300026142 Bacteria 12462
138 Ga0207698_10224627 3300026142 Bacteria 1700
139 Ga0209999_1012409 3300027543 Bacteria 1543
140 Ga0268266_10000038 3300028379 Bacteria 325729
141 Ga0268264_10000167 3300028381 Bacteria 146190
142 Ga0268264_10015904 3300028381 Bacteria 6163
143 Ga0268264_10033114 3300028381 Unclassified 4243
144 Ga0307513_10295882 3300031456 Bacteria 1388
145 Ga0307509_10124457 3300031507 Bacteria 2548
146 Ga0307508_10125169 3300031616 Bacteria 2173
147 Ga0307516_10001231 3300031730 Bacteria 35640
148 Ga0307507_10199883 3300033179 Unclassified 1385
149 Ga0373946_0061242 3300035171 Unclassified 1602
150 Ga0373927_0034385 3300035695 Bacteria 3297
151 Ga0395899_0091043 3300037312 Bacteria 2210
152 Ga0395899_0246871 3300037312 Bacteria 1226
153 Ga0395900_0004734 3300037418 Bacteria 14355
154 Ga0395900_0096485 3300037418 Bacteria 3038
155 Ga0395900_0238209 3300037418 Bacteria 1826
156 Ga0395900_0604866 3300037418 Bacteria 1036
157 Ga0395898_0005280 3300037466 Bacteria 13966
158 Ga0395898_0320940 3300037466 Bacteria 1477
159 Ga0395905_0095927 3300037471 Bacteria 2784
160 Ga0395901_0319241 3300038443 Bacteria 1607
161 Ga0395901_0451021 3300038443 Bacteria 1315
162 Ga0395901_0607198 3300038443 Unclassified 1102
163 Ga0451577_0016786 3300042876 Bacteria 6770
164 Ga0466969_0000746 3300044656 Bacteria 17610
165 Ga0453684_0014572 3300044712 Bacteria 12555
166 Ga0453684_0171855 3300044712 Bacteria 2553
167 Ga0466968_0056519 3300044735 Bacteria 1686
168 Ga0466959_0000056 3300045049 Bacteria 78465
169 Ga0451576_0018049 3300045051 Bacteria 7742
170 Ga0495650_0007769 3300046471 Bacteria 6382
171 Ga0495662_0089129 3300046476 Bacteria 1503
172 Ga0495648_0001092 3300046524 Bacteria 27599
173 Ga0495668_0008190 3300046616 Bacteria 6566
174 Ga0495672_0016321 3300047320 Bacteria 5009
175 Ga0495687_000001 3300047443 Bacteria 1215582
176 Ga0495686_0094958 3300047472 Unclassified 1806
177 Ga0495686_0163136 3300047472 Unclassified 1301
178 Ga0496125_0269545 3300048928 Bacteria 1062
179 Ga0501037_0151626 3300049573 Bacteria 1656
180 Ga0501038_0014512 3300049574 Bacteria 7179
181 Ga0501039_0010250 3300049575 Bacteria 7143
182 Ga0501219_000466 3300049703 Bacteria 6405
183 Ga0501035_0179258 3300049822 Bacteria 1826
184 Ga0501044_0020724 3300049823 Bacteria 7017
185 Ga0501284_00029 3300050005 Bacteria 74818
186 nmdc:mga0k408_137388_c1 3300050493 Bacteria 1453
187 nmdc:mga0k408_17461_c1 3300050493 Bacteria 3416
188 nmdc:mga09592_5751_c1 3300050508 Bacteria 10111
189 Ga0500642_0024078 3300053130 Bacteria 2454
190 Ga0500568_0004384 3300053139 Bacteria 7555
191 Ga0500590_213691 3300053148 Bacteria 803
192 Ga0500604_0010993 3300053151 Unclassified 2427
193 Ga0500622_0002825 3300053156 Bacteria 12178
194 Ga0500611_000022 3300053727 Bacteria 102349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053148 Ga0500590_213691 Ga0500590_213691_15_767 249
2 3300014325 Ga0163163_10091052 Ga0163163_100910523 258
3 3300005328 Ga0070676_10003259 Ga0070676_100032594 259
4 3300005333 Ga0070677_10023130 Ga0070677_100231303 259
5 3300005334 Ga0068869_100042265 Ga0068869_1000422652 259
6 3300005338 Ga0068868_100008240 Ga0068868_1000082404 259
7 3300005354 Ga0070675_100041406 Ga0070675_1000414063 259
8 3300005356 Ga0070674_100084423 Ga0070674_1000844233 259
9 3300005456 Ga0070678_100017168 Ga0070678_1000171684 259
10 3300005459 Ga0068867_100019215 Ga0068867_1000192152 259
11 3300005539 Ga0068853_100134842 Ga0068853_1001348422 259
12 3300005543 Ga0070672_100100414 Ga0070672_1001004142 259
13 3300005548 Ga0070665_100011862 Ga0070665_1000118624 259
14 3300005618 Ga0068864_100075065 Ga0068864_1000750653 259
15 3300005718 Ga0068866_10010029 Ga0068866_100100293 259
16 3300005719 Ga0068861_100054649 Ga0068861_1000546493 259
17 3300005843 Ga0068860_100050158 Ga0068860_1000501583 259
18 3300006237 Ga0097621_100027438 Ga0097621_1000274382 259
19 3300006881 Ga0068865_100017131 Ga0068865_1000171314 259
20 3300025901 Ga0207688_10009731 Ga0207688_100097314 259
21 3300025907 Ga0207645_10001795 Ga0207645_100017955 259
22 3300025908 Ga0207643_10040296 Ga0207643_100402962 259
23 3300025934 Ga0207686_10024979 Ga0207686_100249793 259
24 3300025937 Ga0207669_10022422 Ga0207669_100224223 259
25 3300025938 Ga0207704_10319470 Ga0207704_103194702 259
26 3300025940 Ga0207691_10021206 Ga0207691_100212064 259
27 3300025942 Ga0207689_10003973 Ga0207689_1000397311 259
28 3300025960 Ga0207651_10614607 Ga0207651_106146072 259
29 3300026041 Ga0207639_10096663 Ga0207639_100966632 259
30 3300026121 Ga0207683_10002179 Ga0207683_1000217912 259
31 3300028381 Ga0268264_10015904 Ga0268264_100159043 259
32 3300053139 Ga0500568_0004384 Ga0500568_0004384_2237_3025 262
33 3300005841 Ga0068863_100154684 Ga0068863_1001546842 277
34 3300026088 Ga0207641_10170101 Ga0207641_101701012 277
35 3300005334 Ga0068869_100074536 Ga0068869_1000745363 278
36 3300009093 Ga0105240_10136308 Ga0105240_101363083 278
37 3300009545 Ga0105237_10126888 Ga0105237_101268883 278
38 3300010375 Ga0105239_10002298 Ga0105239_100022989 278
39 3300011119 Ga0105246_10214673 Ga0105246_102146731 278
40 3300025942 Ga0207689_10128668 Ga0207689_101286682 278
41 3300026095 Ga0207676_10481869 Ga0207676_104818691 278
42 3300006844 Ga0075428_100069579 Ga0075428_1000695793 279
43 3300009094 Ga0111539_10061083 Ga0111539_100610833 279
44 3300009148 Ga0105243_10063094 Ga0105243_100630943 279
45 3300025935 Ga0207709_10052796 Ga0207709_100527962 279
46 3300026116 Ga0207674_10101183 Ga0207674_101011832 279
47 3300048928 Ga0496125_0269545 Ga0496125_0269545_163_1008 280
48 3300005295 Ga0065707_10096135 Ga0065707_100961353 281
49 3300005441 Ga0070700_100040417 Ga0070700_1000404172 281
50 3300026075 Ga0207708_10095641 Ga0207708_100956413 281
51 3300006844 Ga0075428_100020017 Ga0075428_1000200174 282
52 3300006880 Ga0075429_100001269 Ga0075429_1000012695 282
53 3300050508 nmdc:mga09592_5751_c1 nmdc:mga09592_5751_c1_4876_5772 282
54 3300047320 Ga0495672_0016321 Ga0495672_0016321_180_1061 284
55 3300027543 Ga0209999_1012409 Ga0209999_10124092 290
56 3300044712 Ga0453684_0171855 Ga0453684_0171855_1279_2175 291
57 3300045051 Ga0451576_0018049 Ga0451576_0018049_1732_2628 291
58 3300037418 Ga0395900_0096485 Ga0395900_0096485_531_1409 292
59 3300003316 rootH1_10181169 rootH1_101811693 296
60 3300005985 Ga0081539_10012393 Ga0081539_100123933 296
61 3300025942 Ga0207689_10321954 Ga0207689_103219542 296
62 3300037312 Ga0395899_0091043 Ga0395899_0091043_831_1721 296
63 3300037312 Ga0395899_0246871 Ga0395899_0246871_24_914 296
64 3300037418 Ga0395900_0238209 Ga0395900_0238209_896_1786 296
65 3300037418 Ga0395900_0604866 Ga0395900_0604866_41_931 296
66 3300037466 Ga0395898_0005280 Ga0395898_0005280_41_931 296
67 3300037466 Ga0395898_0320940 Ga0395898_0320940_275_1165 296
68 3300037471 Ga0395905_0095927 Ga0395905_0095927_981_1871 296
69 3300038443 Ga0395901_0319241 Ga0395901_0319241_35_925 296
70 3300038443 Ga0395901_0451021 Ga0395901_0451021_276_1166 296
71 3300038443 Ga0395901_0607198 Ga0395901_0607198_28_918 296
72 3300005329 Ga0070683_100022412 Ga0070683_1000224124 297
73 3300005341 Ga0070691_10067731 Ga0070691_100677312 297
74 3300005457 Ga0070662_100359811 Ga0070662_1003598111 297
75 3300005458 Ga0070681_10021081 Ga0070681_100210813 297
76 3300005535 Ga0070684_100001699 Ga0070684_10000169916 297
77 3300005563 Ga0068855_100000089 Ga0068855_10000008967 297
78 3300006358 Ga0068871_100455534 Ga0068871_1004555342 297
79 3300009093 Ga0105240_10003016 Ga0105240_100030168 297
80 3300009176 Ga0105242_10038203 Ga0105242_100382033 297
81 3300009176 Ga0105242_10043388 Ga0105242_100433883 297
82 3300010375 Ga0105239_10022839 Ga0105239_100228394 297
83 3300010375 Ga0105239_10040560 Ga0105239_100405604 297
84 3300011119 Ga0105246_10043876 Ga0105246_100438763 297
85 3300013105 Ga0157369_10046959 Ga0157369_100469594 297
86 3300013297 Ga0157378_10034428 Ga0157378_100344284 297
87 3300013307 Ga0157372_10173959 Ga0157372_101739593 297
88 3300013308 Ga0157375_10090201 Ga0157375_100902012 297
89 3300025912 Ga0207707_10015216 Ga0207707_100152164 297
90 3300025913 Ga0207695_10000071 Ga0207695_10000071171 297
91 3300025923 Ga0207681_10176175 Ga0207681_101761752 297
92 3300025944 Ga0207661_10015277 Ga0207661_100152774 297
93 3300025949 Ga0207667_10000177 Ga0207667_1000017782 297
94 3300026118 Ga0207675_100082852 Ga0207675_1000828522 297
95 3300031456 Ga0307513_10295882 Ga0307513_102958822 297
96 3300031507 Ga0307509_10124457 Ga0307509_101244572 297
97 3300031616 Ga0307508_10125169 Ga0307508_101251692 297
98 3300037418 Ga0395900_0004734 Ga0395900_0004734_12379_13287 297
99 3300046471 Ga0495650_0007769 Ga0495650_0007769_4452_5345 297
100 3300005335 Ga0070666_10021527 Ga0070666_100215273 298
101 3300005367 Ga0070667_100228531 Ga0070667_1002285312 298
102 3300005539 Ga0068853_100042914 Ga0068853_1000429143 298
103 3300005563 Ga0068855_100021393 Ga0068855_1000213935 298
104 3300005577 Ga0068857_100010174 Ga0068857_1000101748 298
105 3300005577 Ga0068857_100010879 Ga0068857_1000108792 298
106 3300005578 Ga0068854_100031561 Ga0068854_1000315613 298
107 3300005614 Ga0068856_100008851 Ga0068856_1000088512 298
108 3300005614 Ga0068856_100058023 Ga0068856_1000580232 298
109 3300005614 Ga0068856_100142743 Ga0068856_1001427433 298
110 3300005616 Ga0068852_100000488 Ga0068852_1000004889 298
111 3300005616 Ga0068852_100105597 Ga0068852_1001055972 298
112 3300005618 Ga0068864_100106423 Ga0068864_1001064233 298
113 3300005843 Ga0068860_100000111 Ga0068860_10000011124 298
114 3300005843 Ga0068860_100044956 Ga0068860_1000449563 298
115 3300005843 Ga0068860_100265544 Ga0068860_1002655442 298
116 3300009093 Ga0105240_10000074 Ga0105240_1000007438 298
117 3300009093 Ga0105240_10009614 Ga0105240_100096145 298
118 3300009093 Ga0105240_10023848 Ga0105240_100238484 298
119 3300009093 Ga0105240_10292606 Ga0105240_102926063 298
120 3300009174 Ga0105241_10000411 Ga0105241_1000041111 298
121 3300009174 Ga0105241_10190199 Ga0105241_101901992 298
122 3300009545 Ga0105237_10004335 Ga0105237_100043357 298
123 3300009545 Ga0105237_10008089 Ga0105237_100080893 298
124 3300009545 Ga0105237_10025072 Ga0105237_100250724 298
125 3300009551 Ga0105238_10048697 Ga0105238_100486974 298
126 3300009551 Ga0105238_10058171 Ga0105238_100581712 298
127 3300009551 Ga0105238_10283338 Ga0105238_102833382 298
128 3300010375 Ga0105239_10000529 Ga0105239_1000052942 298
129 3300013104 Ga0157370_10017131 Ga0157370_100171314 298
130 3300013105 Ga0157369_10027025 Ga0157369_100270254 298
131 3300013306 Ga0163162_10000448 Ga0163162_1000044818 298
132 3300013306 Ga0163162_10418965 Ga0163162_104189651 298
133 3300013307 Ga0157372_10001519 Ga0157372_100015196 298
134 3300013307 Ga0157372_10007665 Ga0157372_100076659 298
135 3300025904 Ga0207647_10006347 Ga0207647_100063472 298
136 3300025913 Ga0207695_10002454 Ga0207695_1000245410 298
137 3300025913 Ga0207695_10008205 Ga0207695_100082054 298
138 3300025913 Ga0207695_10021754 Ga0207695_100217543 298
139 3300025914 Ga0207671_10002216 Ga0207671_100022169 298
140 3300025914 Ga0207671_10025208 Ga0207671_100252082 298
141 3300025914 Ga0207671_10073019 Ga0207671_100730192 298
142 3300025918 Ga0207662_10200850 Ga0207662_102008502 298
143 3300025949 Ga0207667_10001238 Ga0207667_100012383 298
144 3300025949 Ga0207667_10048848 Ga0207667_100488484 298
145 3300025981 Ga0207640_10066291 Ga0207640_100662912 298
146 3300025986 Ga0207658_10192670 Ga0207658_101926702 298
147 3300026041 Ga0207639_10035325 Ga0207639_100353253 298
148 3300026041 Ga0207639_10086516 Ga0207639_100865163 298
149 3300026041 Ga0207639_10480718 Ga0207639_104807182 298
150 3300026078 Ga0207702_10039564 Ga0207702_100395643 298
151 3300026078 Ga0207702_10185684 Ga0207702_101856843 298
152 3300026095 Ga0207676_10075783 Ga0207676_100757832 298
153 3300026116 Ga0207674_10015724 Ga0207674_100157248 298
154 3300026116 Ga0207674_10022778 Ga0207674_100227783 298
155 3300026142 Ga0207698_10001818 Ga0207698_100018187 298
156 3300026142 Ga0207698_10224627 Ga0207698_102246272 298
157 3300028379 Ga0268266_10000038 Ga0268266_1000003826 298
158 3300028381 Ga0268264_10000167 Ga0268264_10000167126 298
159 3300028381 Ga0268264_10033114 Ga0268264_100331143 298
160 3300031730 Ga0307516_10001231 Ga0307516_1000123111 298
161 3300035171 Ga0373946_0061242 Ga0373946_0061242_55_951 298
162 3300035695 Ga0373927_0034385 Ga0373927_0034385_884_1783 298
163 3300044656 Ga0466969_0000746 Ga0466969_0000746_13227_14132 298
164 3300044735 Ga0466968_0056519 Ga0466968_0056519_276_1181 298
165 3300045049 Ga0466959_0000056 Ga0466959_0000056_8901_9806 298
166 3300046476 Ga0495662_0089129 Ga0495662_0089129_102_998 298
167 3300046524 Ga0495648_0001092 Ga0495648_0001092_17795_18697 298
168 3300046616 Ga0495668_0008190 Ga0495668_0008190_4597_5493 298
169 3300047443 Ga0495687_000001 Ga0495687_000001_488417_489319 298
170 3300047472 Ga0495686_0094958 Ga0495686_0094958_207_1103 298
171 3300047472 Ga0495686_0163136 Ga0495686_0163136_35_937 298
172 3300049573 Ga0501037_0151626 Ga0501037_0151626_509_1405 298
173 3300049574 Ga0501038_0014512 Ga0501038_0014512_5273_6169 298
174 3300049575 Ga0501039_0010250 Ga0501039_0010250_403_1299 298
175 3300049703 Ga0501219_000466 Ga0501219_000466_211_1110 298
176 3300049822 Ga0501035_0179258 Ga0501035_0179258_587_1483 298
177 3300049823 Ga0501044_0020724 Ga0501044_0020724_936_1832 298
178 3300050005 Ga0501284_00029 Ga0501284_00029_53086_53985 298
179 3300050493 nmdc:mga0k408_137388_c1 nmdc:mga0k408_137388_c1_271_1167 298
180 3300050493 nmdc:mga0k408_17461_c1 nmdc:mga0k408_17461_c1_1168_2064 298
181 3300053130 Ga0500642_0024078 Ga0500642_0024078_15_917 298
182 3300053151 Ga0500604_0010993 Ga0500604_0010993_626_1522 298
183 3300053156 Ga0500622_0002825 Ga0500622_0002825_8453_9355 298
184 3300025908 Ga0207643_10074173 Ga0207643_100741732 299
185 3300033179 Ga0307507_10199883 Ga0307507_101998832 299
186 3300042876 Ga0451577_0016786 Ga0451577_0016786_4764_5666 299
187 3300044712 Ga0453684_0014572 Ga0453684_0014572_6430_7341 299
188 3300002459 JGI24751J29686_10001257 JGI24751J29686_100012574 300
189 3300005331 Ga0070670_100021945 Ga0070670_1000219454 300
190 3300009553 Ga0105249_10006143 Ga0105249_100061433 300
191 3300009553 Ga0105249_10012155 Ga0105249_100121553 300
192 3300013104 Ga0157370_10019516 Ga0157370_100195164 300
193 3300025961 Ga0207712_10005769 Ga0207712_100057693 300
194 3300053727 Ga0500611_000022 Ga0500611_000022_57498_58469 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

123

212

0.93

PF13649

Methyltransf_25

Methyltransferase domain

122

208

0.87

PF08242

Methyltransf_12

Methyltransferase domain

123

210

0.86

PF13847

Methyltransf_31

Methyltransferase domain

117

258

0.85

PF13489

Methyltransf_23

Methyltransferase domain

96

260

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4krg-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine 0.8407 101 200
2xva-assembly3.cif.gz_C crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin 0.8141 90 200
7pd7-assembly1.cif.gz_A crocagin methyl transferase cgnl 0.8088 78 203
7ux8-assembly1.cif.gz_B crystal structure of mfng, an l- and d-tyrosine o-methyltransferase from the marformycin biosynthesis pathway of streptomyces drozdowiczii, with sah and l-tyrosine bound at 1.4 a resolution (p212121 - form ii) 0.8022 103 244
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.7987 77 201
ID Description Score Start End Superfamily
af_A0A1D8PDB2_246_348_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8552 107 144 3.40.50.150
af_A0A0P0VC63_86_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8535 81 142 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8433 93 205 3.40.50.150
af_A0A1D6GJ57_219_367_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8347 105 196 3.40.50.150
af_Q54VU9_17_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8288 102 197 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C5N317-F1-model_v4 Class I SAM-dependent methyltransferase 0.9787 6 296 GO:0008168
GO:0032259
AF-A0A3D3CVV3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9781 9 300 GO:0008168
GO:0032259
AF-A0A1Q3JRZ2-F1-model_v4 Methyltransferase type 12 0.9728 56 298 GO:0008168
GO:0032259
AF-A0A7C5N317-F1-model_v4 Class I SAM-dependent methyltransferase 0.9623 6 296 GO:0008168
GO:0032259
AF-A0A1Q3JRZ2-F1-model_v4 Methyltransferase type 12 0.9612 56 298 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map