F296363

General Info

Members Datasets Scaffolds Average Seq Length
192 134 180 197

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_005228|Ga0500661_005228_586_1245
Length 219
Sequence LIIILFVELVEYVFASLYFQHSMNNHMSRESILAAIKGNQPSAEVLPDIEGFSTGTPGDPAAFRKVVETLGGEVIDIVQYADITAFIQTHYTEHSRIVAVNPAFYPGGMTDWQTGDGRQLEQVDLAIVPGQLGVAENGAVWVTEKEIVVRALPFIAQHLAIVLSAATILPTMHDAYNRIGGPETGFGVFIAGPSKTADIEQSLVLGAHGAKSLTIFLLP

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367656 Pedobacter sp. CF523 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
116 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
117 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
118 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
121 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
134 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.33
Nodule 0
Rhizoplane 1.04
Rhizosphere 52.6
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000446 3300001979 Bacteria 17682
2 JGI24739J22299_10010642 3300001989 Bacteria 3413
3 JGI24739J22299_10015448 3300001989 Bacteria 2774
4 JGI24737J22298_10010942 3300001990 Bacteria 2979
5 JGI24735J21928_10000016 3300002067 Bacteria 157028
6 JGI25162J39368_1000017 3300002737 Bacteria 281385
7 JGI25154J39366_1000072 3300002738 Bacteria 93790
8 JGI25152J39213_1008709 3300002773 Bacteria 2490
9 JGI25150J39212_1000057 3300002774 Bacteria 66456
10 JGI25151J46595_10000229 3300003187 Bacteria 66456
11 JGI25153J46596_10000164 3300003215 Bacteria 66576
12 JGI25153J46596_10000565 3300003215 Bacteria 22884
13 JGI25153J46596_10000777 3300003215 Bacteria 19573
14 JGI25153J46596_10017467 3300003215 Bacteria 2825
15 JGI25153J46596_10055775 3300003215 Bacteria 1103
16 rootH1_10015988 3300003316 Bacteria 11335
17 rootH2_10029213 3300003320 Bacteria 1975
18 rootH2_10245870 3300003320 Bacteria 2067
19 rootL2_10017751 3300003322 Bacteria 6232
20 rootL2_10023413 3300003322 Bacteria 21325
21 rootL2_10090280 3300003322 Bacteria 5922
22 rootL2_10167647 3300003322 Bacteria 2585
23 rootL2_10199779 3300003322 Bacteria 1810
24 rootH1_10275721 3300003323 Bacteria 2393
25 JGI25160J50197_1002167 3300003354 Bacteria 9284
26 JGI25160J50197_1016153 3300003354 Bacteria 2416
27 Ga0055542_1006207 3300003762 Bacteria 2584
28 Ga0055526_1020722 3300003771 Bacteria 2321
29 Ga0055528_1000312 3300003790 Bacteria 41028
30 Ga0055530_10000372 3300003791 Bacteria 40539
31 Ga0055531_10000349 3300003794 Bacteria 45177
32 Ga0055531_10033634 3300003794 Bacteria 1646
33 Ga0065165_1000056 3300005262 Bacteria 186730
34 Ga0065165_1020151 3300005262 Bacteria 2357
35 Ga0070671_100000813 3300005355 Bacteria 22610
36 Ga0070659_100001662 3300005366 Bacteria 15981
37 Ga0068855_100078883 3300005563 Bacteria 3820
38 Ga0068855_100261962 3300005563 Bacteria 1925
39 Ga0068852_100533407 3300005616 Bacteria 1172
40 Ga0068862_100791463 3300005844 Bacteria 925
41 Ga0075366_10043663 3300006195 Bacteria 2655
42 Ga0075366_10054402 3300006195 Bacteria 2377
43 Ga0105245_10575813 3300009098 Unclassified 1150
44 Ga0105243_10067467 3300009148 Bacteria 2880
45 Ga0105237_10018872 3300009545 Bacteria 7131
46 Ga0105239_10005303 3300010375 Bacteria 15143
47 Ga0105239_10043383 3300010375 Bacteria 4929
48 Ga0105239_10094979 3300010375 Bacteria 3294
49 Ga0105239_10127777 3300010375 Bacteria 2826
50 Ga0105239_10130991 3300010375 Bacteria 2790
51 Ga0105239_11741103 3300010375 Bacteria 722
52 Ga0105246_10322589 3300011119 Bacteria 1256
53 Ga0157378_10012302 3300013297 Bacteria 7493
54 Ga0163162_10012979 3300013306 Bacteria 8128
55 Ga0163162_11072470 3300013306 Bacteria 912
56 Ga0157372_10019705 3300013307 Bacteria 7271
57 Ga0182005_1000053 3300015265 Bacteria 113111
58 Ga0209436_102821 3300025208 Bacteria 4937
59 Ga0209437_100024 3300025233 Bacteria 592878
60 Ga0209258_100303 3300025242 Bacteria 79506
61 Ga0207425_1000007 3300025245 Bacteria 777411
62 Ga0209646_1000037 3300025246 Bacteria 355116
63 Ga0209026_1001067 3300025250 Bacteria 13292
64 Ga0209148_1000519 3300025254 Bacteria 38142
65 Ga0209129_1000006 3300025258 Bacteria 777761
66 Ga0209673_1000014 3300025273 Bacteria 537082
67 Ga0209025_1000025 3300025294 Bacteria 524454
68 Ga0209758_1000016 3300025297 Bacteria 778557
69 Ga0209758_1001126 3300025297 Bacteria 34321
70 Ga0209758_1006838 3300025297 Bacteria 7989
71 Ga0209758_1010043 3300025297 Bacteria 5744
72 Ga0209050_1000838 3300025298 Bacteria 42361
73 Ga0207426_1000193 3300025302 Bacteria 151669
74 Ga0207426_1000786 3300025302 Bacteria 34729
75 Ga0207426_1004279 3300025302 Bacteria 7072
76 Ga0209051_1035712 3300025303 Bacteria 1845
77 Ga0209257_1000008 3300025304 Bacteria 1294570
78 Ga0209257_1009803 3300025304 Bacteria 5014
79 Ga0207647_10035081 3300025904 Bacteria 3199
80 Ga0207671_10005597 3300025914 Bacteria 11537
81 Ga0207671_10006786 3300025914 Bacteria 10117
82 Ga0207644_10008722 3300025931 Bacteria 6637
83 Ga0207690_10000123 3300025932 Bacteria 64409
84 Ga0207709_10162856 3300025935 Bacteria 1557
85 Ga0207667_10186898 3300025949 Bacteria 2127
86 Ga0207667_10220377 3300025949 Bacteria 1944
87 Ga0207640_10469750 3300025981 Unclassified 1041
88 Ga0307515_10002884 3300028794 Bacteria 36561
89 Ga0307515_10006659 3300028794 Bacteria 23030
90 Ga0307507_10000036 3300033179 Bacteria 187512
91 Ga0316574_0131017 3300035398 Bacteria 1614
92 Ga0451793_1884457 3300041452 Bacteria 907
93 Ga0439449_0154468 3300042007 Bacteria 856
94 Ga0453683_0008472 3300044673 Bacteria 6898
95 Ga0466965_0272276 3300044683 Bacteria 913
96 Ga0453684_0167829 3300044712 Bacteria 2589
97 Ga0451576_0004668 3300045051 Bacteria 17653
98 Ga0495627_021555 3300046453 Bacteria 2134
99 Ga0495650_0000127 3300046471 Bacteria 177276
100 Ga0495650_0115525 3300046471 Bacteria 992
101 Ga0495585_0000088 3300046492 Bacteria 96490
102 Ga0495585_0009559 3300046492 Bacteria 5804
103 Ga0495583_0146379 3300046506 Bacteria 981
104 Ga0495606_0000033 3300046507 Bacteria 247739
105 Ga0495606_0011985 3300046507 Bacteria 7003
106 Ga0495606_0101016 3300046507 Bacteria 1756
107 Ga0495606_0238994 3300046507 Bacteria 1014
108 Ga0495606_0287711 3300046507 Bacteria 896
109 Ga0495610_0001633 3300046512 Bacteria 19730
110 Ga0495610_0117781 3300046512 Bacteria 1168
111 Ga0495616_0002643 3300046513 Bacteria 11783
112 Ga0495631_0166343 3300046518 Bacteria 946
113 Ga0495632_0054205 3300046519 Bacteria 1966
114 Ga0495637_0067076 3300046520 Bacteria 1457
115 Ga0495648_0016727 3300046524 Bacteria 5276
116 Ga0495652_0122467 3300046529 Bacteria 2072
117 Ga0495654_0048686 3300046530 Bacteria 2078
118 Ga0495609_0041118 3300046538 Bacteria 2079
119 Ga0495609_0095831 3300046538 Bacteria 1288
120 Ga0495633_0000019 3300046558 Bacteria 233769
121 Ga0495633_0000067 3300046558 Bacteria 139122
122 Ga0495633_0009344 3300046558 Bacteria 5424
123 Ga0495668_0000069 3300046616 Bacteria 174287
124 Ga0495668_0000670 3300046616 Bacteria 41268
125 Ga0495625_0000048 3300046660 Bacteria 198976
126 Ga0495625_0000419 3300046660 Bacteria 63844
127 Ga0495625_0002288 3300046660 Bacteria 20992
128 Ga0495625_0016683 3300046660 Bacteria 5769
129 Ga0495625_0016961 3300046660 Bacteria 5713
130 Ga0495625_0068940 3300046660 Bacteria 2485
131 Ga0495625_0128623 3300046660 Bacteria 1717
132 Ga0495625_0256958 3300046660 Bacteria 1132
133 Ga0495661_0002260 3300046665 Bacteria 14910
134 Ga0495661_0031421 3300046665 Bacteria 3370
135 Ga0495661_0034449 3300046665 Bacteria 3186
136 Ga0495661_0393457 3300046665 Bacteria 675
137 Ga0495658_0010389 3300046683 Bacteria 4657
138 Ga0495649_0000146 3300046694 Bacteria 61862
139 Ga0495660_0002884 3300046810 Bacteria 10808
140 Ga0495660_0300370 3300046810 Bacteria 728
141 Ga0495683_0112689 3300047323 Bacteria 1297
142 Ga0495687_001622 3300047443 Bacteria 20265
143 Ga0495686_0000052 3300047472 Bacteria 262622
144 Ga0495686_0021810 3300047472 Bacteria 4247
145 Ga0495686_0043720 3300047472 Bacteria 2839
146 Ga0495614_0035359 3300048089 Bacteria 2146
147 Ga0496121_0000026 3300048924 Bacteria 450157
148 Ga0495678_007153 3300049459 Bacteria 5828
149 Ga0495682_0005522 3300049460 Bacteria 5238
150 Ga0501034_0729020 3300049571 Unclassified 888
151 Ga0501036_0912173 3300049572 Unclassified 721
152 Ga0501037_0106017 3300049573 Bacteria 2026
153 Ga0501047_0050626 3300049581 Bacteria 4011
154 Ga0501269_001095 3300049766 Unclassified 3763
155 Ga0501035_0633156 3300049822 Unclassified 869
156 Ga0501044_0084329 3300049823 Bacteria 3212
157 nmdc:mga0k408_128529_c1 3300050493 Bacteria 1503
158 nmdc:mga0k408_182077_c1 3300050493 Bacteria 1253
159 nmdc:mga0k408_402_c1 3300050493 Bacteria 23586
160 Ga0500644_0000237 3300053088 Bacteria 31377
161 Ga0500646_0007246 3300053090 Unclassified 2831
162 Ga0500647_0102585 3300053091 Bacteria 1365
163 Ga0500651_0061701 3300053093 Bacteria 2341
164 Ga0500556_0034675 3300053104 Bacteria 1738
165 Ga0500569_006019 3300053109 Bacteria 2639
166 Ga0500608_122676 3300053122 Bacteria 1176
167 Ga0500618_000073 3300053125 Bacteria 81706
168 Ga0500652_032549 3300053131 Bacteria 2055
169 Ga0500658_0091768 3300053134 Unclassified 1314
170 Ga0500559_0033898 3300053136 Bacteria 2200
171 Ga0500561_0005280 3300053137 Bacteria 2388
172 Ga0500568_0093430 3300053139 Bacteria 1133
173 Ga0500577_0002623 3300053142 Bacteria 4606
174 Ga0500616_0001824 3300053153 Bacteria 19305
175 Ga0500622_0000282 3300053156 Bacteria 51868
176 Ga0500622_0002870 3300053156 Bacteria 12047
177 Ga0500622_0068885 3300053156 Bacteria 1793
178 Ga0500627_0001625 3300053158 Bacteria 6347
179 Ga0500636_0047772 3300053177 Bacteria 2521
180 Ga0500661_005228 3300055283 Bacteria 2428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0115525 Ga0495650_0115525_422_946 171
2 3300046683 Ga0495658_0010389 Ga0495658_0010389_14_550 175
3 3300050493 nmdc:mga0k408_182077_c1 nmdc:mga0k408_182077_c1_687_1229 177
4 iso_pu_bacteria 2818991442 2819575839 185
5 iso_pu_bacteria 2821136567 2821138393 185
6 iso_pu_bacteria 2904467357 2904469189 185
7 iso_pu_bacteria 2739367656 2739615773 188
8 3300005262 Ga0065165_1020151 Ga0065165_10201513 189
9 3300015265 Ga0182005_1000053 Ga0182005_10000539 189
10 3300025208 Ga0209436_102821 Ga0209436_1028212 189
11 3300025302 Ga0207426_1004279 Ga0207426_10042796 189
12 3300048924 Ga0496121_0000026 Ga0496121_0000026_272938_273510 189
13 3300044673 Ga0453683_0008472 Ga0453683_0008472_4107_4682 190
14 3300045051 Ga0451576_0004668 Ga0451576_0004668_15259_15834 190
15 3300053088 Ga0500644_0000237 Ga0500644_0000237_12485_13069 190
16 3300053136 Ga0500559_0033898 Ga0500559_0033898_852_1430 190
17 3300053177 Ga0500636_0047772 Ga0500636_0047772_1453_2031 190
18 iso_pu_bacteria 2599185184 2599478880 190
19 iso_pu_bacteria 2919437846 2919438675 190
20 iso_pu_bacteria 2928078545 2928082894 190
21 iso_pu_bacteria 2928147474 2928149912 190
22 iso_pu_bacteria 2932082852 2932086215 190
23 3300003762 Ga0055542_1006207 Ga0055542_10062072 191
24 3300025242 Ga0209258_100303 Ga0209258_10030360 191
25 3300025254 Ga0209148_1000519 Ga0209148_100051913 191
26 3300044712 Ga0453684_0167829 Ga0453684_0167829_130_729 191
27 3300046660 Ga0495625_0256958 Ga0495625_0256958_427_1017 191
28 3300053090 Ga0500646_0007246 Ga0500646_0007246_280_870 191
29 3300053109 Ga0500569_006019 Ga0500569_006019_466_1056 191
30 3300053134 Ga0500658_0091768 Ga0500658_0091768_343_933 191
31 3300053142 Ga0500577_0002623 Ga0500577_0002623_1892_2482 191
32 3300002773 JGI25152J39213_1008709 JGI25152J39213_10087092 192
33 3300002774 JGI25150J39212_1000057 JGI25150J39212_100005721 192
34 3300003187 JGI25151J46595_10000229 JGI25151J46595_1000022921 192
35 3300003215 JGI25153J46596_10000164 JGI25153J46596_1000016425 192
36 3300025245 Ga0207425_1000007 Ga0207425_1000007193 192
37 3300025258 Ga0209129_1000006 Ga0209129_1000006193 192
38 3300025294 Ga0209025_1000025 Ga0209025_100002523 192
39 3300025297 Ga0209758_1000016 Ga0209758_1000016193 192
40 3300041452 Ga0451793_1884457 Ga0451793_1884457_41_628 192
41 iso_pu_bacteria 2929921140 2929926018 192
42 iso_pu_bacteria 8003151029 8003153027 192
43 3300003322 rootL2_10023413 rootL2_1002341312 193
44 3300003322 rootL2_10090280 rootL2_100902805 193
45 3300003322 rootL2_10167647 rootL2_101676473 193
46 3300003322 rootL2_10199779 rootL2_101997792 193
47 3300003794 Ga0055531_10000349 Ga0055531_1000034922 193
48 3300010375 Ga0105239_10127777 Ga0105239_101277774 193
49 3300025304 Ga0209257_1000008 Ga0209257_1000008151 193
50 3300035398 Ga0316574_0131017 Ga0316574_0131017_30_623 193
51 3300042007 Ga0439449_0154468 Ga0439449_0154468_10_603 193
52 3300046453 Ga0495627_021555 Ga0495627_021555_1427_2008 193
53 3300046558 Ga0495633_0000019 Ga0495633_0000019_174635_175216 193
54 3300047443 Ga0495687_001622 Ga0495687_001622_13351_13941 193
55 3300053093 Ga0500651_0061701 Ga0500651_0061701_330_911 193
56 3300053156 Ga0500622_0000282 Ga0500622_0000282_2076_2669 193
57 3300001989 JGI24739J22299_10010642 JGI24739J22299_100106422 194
58 3300001990 JGI24737J22298_10010942 JGI24737J22298_100109422 194
59 3300002067 JGI24735J21928_10000016 JGI24735J21928_100000165 194
60 3300002737 JGI25162J39368_1000017 JGI25162J39368_1000017167 194
61 3300003316 rootH1_10015988 rootH1_100159883 194
62 3300003320 rootH2_10029213 rootH2_100292132 194
63 3300003323 rootH1_10275721 rootH1_102757213 194
64 3300005563 Ga0068855_100078883 Ga0068855_1000788835 194
65 3300005563 Ga0068855_100261962 Ga0068855_1002619622 194
66 3300006195 Ga0075366_10043663 Ga0075366_100436631 194
67 3300009545 Ga0105237_10018872 Ga0105237_100188722 194
68 3300010375 Ga0105239_10005303 Ga0105239_100053032 194
69 3300010375 Ga0105239_10043383 Ga0105239_100433832 194
70 3300010375 Ga0105239_10130991 Ga0105239_101309912 194
71 3300010375 Ga0105239_11741103 Ga0105239_117411032 194
72 3300013306 Ga0163162_10012979 Ga0163162_100129791 194
73 3300013306 Ga0163162_11072470 Ga0163162_110724702 194
74 3300013307 Ga0157372_10019705 Ga0157372_100197054 194
75 3300025233 Ga0209437_100024 Ga0209437_100024148 194
76 3300025904 Ga0207647_10035081 Ga0207647_100350813 194
77 3300025914 Ga0207671_10005597 Ga0207671_100055975 194
78 3300025914 Ga0207671_10006786 Ga0207671_100067867 194
79 3300025949 Ga0207667_10186898 Ga0207667_101868982 194
80 3300025949 Ga0207667_10220377 Ga0207667_102203772 194
81 3300025981 Ga0207640_10469750 Ga0207640_104697501 194
82 3300046471 Ga0495650_0000127 Ga0495650_0000127_3964_4557 194
83 3300046492 Ga0495585_0000088 Ga0495585_0000088_23653_24246 194
84 3300046506 Ga0495583_0146379 Ga0495583_0146379_152_745 194
85 3300046507 Ga0495606_0000033 Ga0495606_0000033_27561_28154 194
86 3300046507 Ga0495606_0011985 Ga0495606_0011985_2466_3059 194
87 3300046507 Ga0495606_0101016 Ga0495606_0101016_489_1082 194
88 3300046507 Ga0495606_0238994 Ga0495606_0238994_49_642 194
89 3300046512 Ga0495610_0001633 Ga0495610_0001633_4930_5523 194
90 3300046512 Ga0495610_0117781 Ga0495610_0117781_275_868 194
91 3300046513 Ga0495616_0002643 Ga0495616_0002643_1683_2276 194
92 3300046519 Ga0495632_0054205 Ga0495632_0054205_1357_1950 194
93 3300046520 Ga0495637_0067076 Ga0495637_0067076_764_1357 194
94 3300046529 Ga0495652_0122467 Ga0495652_0122467_932_1525 194
95 3300046558 Ga0495633_0009344 Ga0495633_0009344_443_1036 194
96 3300046616 Ga0495668_0000670 Ga0495668_0000670_24377_24961 194
97 3300046660 Ga0495625_0000048 Ga0495625_0000048_103385_103978 194
98 3300046665 Ga0495661_0002260 Ga0495661_0002260_7538_8131 194
99 3300046665 Ga0495661_0031421 Ga0495661_0031421_954_1541 194
100 3300046665 Ga0495661_0034449 Ga0495661_0034449_1524_2117 194
101 3300046694 Ga0495649_0000146 Ga0495649_0000146_4661_5254 194
102 3300046810 Ga0495660_0002884 Ga0495660_0002884_7125_7718 194
103 3300047323 Ga0495683_0112689 Ga0495683_0112689_255_848 194
104 3300047472 Ga0495686_0000052 Ga0495686_0000052_114746_115339 194
105 3300049766 Ga0501269_001095 Ga0501269_001095_2755_3339 194
106 3300053104 Ga0500556_0034675 Ga0500556_0034675_941_1525 194
107 3300053153 Ga0500616_0001824 Ga0500616_0001824_5591_6175 194
108 3300053156 Ga0500622_0068885 Ga0500622_0068885_684_1277 194
109 3300053158 Ga0500627_0001625 Ga0500627_0001625_5527_6111 194
110 3300055283 Ga0500661_005228 Ga0500661_005228_586_1245 194
111 3300001989 JGI24739J22299_10015448 JGI24739J22299_100154482 195
112 3300003215 JGI25153J46596_10017467 JGI25153J46596_100174674 195
113 3300003215 JGI25153J46596_10055775 JGI25153J46596_100557752 195
114 3300003322 rootL2_10017751 rootL2_100177516 195
115 3300003354 JGI25160J50197_1002167 JGI25160J50197_10021677 195
116 3300003771 Ga0055526_1020722 Ga0055526_10207223 195
117 3300003790 Ga0055528_1000312 Ga0055528_10003122 195
118 3300003791 Ga0055530_10000372 Ga0055530_100003722 195
119 3300003794 Ga0055531_10033634 Ga0055531_100336342 195
120 3300005262 Ga0065165_1000056 Ga0065165_1000056104 195
121 3300005355 Ga0070671_100000813 Ga0070671_1000008136 195
122 3300005366 Ga0070659_100001662 Ga0070659_1000016627 195
123 3300005616 Ga0068852_100533407 Ga0068852_1005334072 195
124 3300006195 Ga0075366_10054402 Ga0075366_100544024 195
125 3300009098 Ga0105245_10575813 Ga0105245_105758132 195
126 3300009148 Ga0105243_10067467 Ga0105243_100674673 195
127 3300013297 Ga0157378_10012302 Ga0157378_100123028 195
128 3300025273 Ga0209673_1000014 Ga0209673_100001448 195
129 3300025297 Ga0209758_1006838 Ga0209758_10068384 195
130 3300025297 Ga0209758_1010043 Ga0209758_10100435 195
131 3300025298 Ga0209050_1000838 Ga0209050_100083834 195
132 3300025302 Ga0207426_1000786 Ga0207426_10007866 195
133 3300025303 Ga0209051_1035712 Ga0209051_10357123 195
134 3300025304 Ga0209257_1009803 Ga0209257_10098035 195
135 3300025931 Ga0207644_10008722 Ga0207644_100087224 195
136 3300025932 Ga0207690_10000123 Ga0207690_100001235 195
137 3300025935 Ga0207709_10162856 Ga0207709_101628562 195
138 3300028794 Ga0307515_10002884 Ga0307515_1000288422 195
139 3300028794 Ga0307515_10006659 Ga0307515_1000665913 195
140 3300033179 Ga0307507_10000036 Ga0307507_100000368 195
141 3300044683 Ga0466965_0272276 Ga0466965_0272276_284_880 195
142 3300046507 Ga0495606_0287711 Ga0495606_0287711_195_785 195
143 3300046530 Ga0495654_0048686 Ga0495654_0048686_1468_2064 195
144 3300046558 Ga0495633_0000067 Ga0495633_0000067_17872_18468 195
145 3300046660 Ga0495625_0002288 Ga0495625_0002288_2701_3297 195
146 3300046660 Ga0495625_0128623 Ga0495625_0128623_41_664 195
147 3300046665 Ga0495661_0393457 Ga0495661_0393457_27_623 195
148 3300048089 Ga0495614_0035359 Ga0495614_0035359_1540_2136 195
149 3300050493 nmdc:mga0k408_128529_c1 nmdc:mga0k408_128529_c1_306_902 195
150 3300050493 nmdc:mga0k408_402_c1 nmdc:mga0k408_402_c1_9287_9877 195
151 3300053122 Ga0500608_122676 Ga0500608_122676_55_678 195
152 3300053125 Ga0500618_000073 Ga0500618_000073_65829_66425 195
153 3300053156 Ga0500622_0002870 Ga0500622_0002870_249_887 195
154 iso_pu_bacteria 2929239360 2929244027 195
155 3300001979 JGI24740J21852_10000446 JGI24740J21852_100004466 196
156 3300002738 JGI25154J39366_1000072 JGI25154J39366_100007264 196
157 3300003215 JGI25153J46596_10000565 JGI25153J46596_100005659 196
158 3300003215 JGI25153J46596_10000777 JGI25153J46596_100007774 196
159 3300003320 rootH2_10245870 rootH2_102458702 196
160 3300003354 JGI25160J50197_1016153 JGI25160J50197_10161532 196
161 3300005844 Ga0068862_100791463 Ga0068862_1007914631 196
162 3300010375 Ga0105239_10094979 Ga0105239_100949792 196
163 3300011119 Ga0105246_10322589 Ga0105246_103225892 196
164 3300025246 Ga0209646_1000037 Ga0209646_1000037291 196
165 3300025250 Ga0209026_1001067 Ga0209026_10010677 196
166 3300025297 Ga0209758_1001126 Ga0209758_10011266 196
167 3300025302 Ga0207426_1000193 Ga0207426_100019377 196
168 3300046492 Ga0495585_0009559 Ga0495585_0009559_908_1534 196
169 3300046518 Ga0495631_0166343 Ga0495631_0166343_50_676 196
170 3300046524 Ga0495648_0016727 Ga0495648_0016727_1202_1828 196
171 3300046538 Ga0495609_0041118 Ga0495609_0041118_387_1013 196
172 3300046538 Ga0495609_0095831 Ga0495609_0095831_569_1195 196
173 3300046616 Ga0495668_0000069 Ga0495668_0000069_96925_97551 196
174 3300046660 Ga0495625_0000419 Ga0495625_0000419_3893_4519 196
175 3300046660 Ga0495625_0016683 Ga0495625_0016683_4337_4963 196
176 3300046660 Ga0495625_0016961 Ga0495625_0016961_3829_4455 196
177 3300046660 Ga0495625_0068940 Ga0495625_0068940_254_880 196
178 3300046810 Ga0495660_0300370 Ga0495660_0300370_56_682 196
179 3300047472 Ga0495686_0021810 Ga0495686_0021810_1563_2189 196
180 3300047472 Ga0495686_0043720 Ga0495686_0043720_1007_1633 196
181 3300049459 Ga0495678_007153 Ga0495678_007153_2897_3523 196
182 3300049460 Ga0495682_0005522 Ga0495682_0005522_3154_3780 196
183 3300049571 Ga0501034_0729020 Ga0501034_0729020_166_759 196
184 3300049572 Ga0501036_0912173 Ga0501036_0912173_92_685 196
185 3300049573 Ga0501037_0106017 Ga0501037_0106017_175_768 196
186 3300049581 Ga0501047_0050626 Ga0501047_0050626_2288_2881 196
187 3300049822 Ga0501035_0633156 Ga0501035_0633156_188_781 196
188 3300049823 Ga0501044_0084329 Ga0501044_0084329_957_1550 196
189 3300053091 Ga0500647_0102585 Ga0500647_0102585_334_960 196
190 3300053131 Ga0500652_032549 Ga0500652_032549_1191_1781 196
191 3300053137 Ga0500561_0005280 Ga0500561_0005280_1081_1707 196
192 3300053139 Ga0500568_0093430 Ga0500568_0093430_204_794 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02589

LUD_dom

LUD domain

63

218

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.7969 36 196
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.7611 36 196
4nml-assembly1.cif.gz_A 2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid 0.5876 54 147
3env-assembly1.cif.gz_B substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016 0.585 53 147
1o8b-assembly1.cif.gz_A structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate. 0.5708 71 147
ID Description Score Start End Superfamily
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7969 36 196 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7671 37 194 3.40.50.10420
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7611 36 196 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.6527 37 194 3.40.50.10420
af_P39361_78_236_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6145 100 150 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A836VSD4-F1-model_v4 LUD domain-containing protein 0.8887 20 195
AF-A0A2V6ZSQ4-F1-model_v4 LUD domain-containing protein 0.8793 93 195
AF-A0A2D5PZ25-F1-model_v4 deleted 0.8754 42 195
AF-A0A523GDH0-F1-model_v4 LUD domain-containing protein 0.8732 59 196
AF-A0A1B1G2H5-F1-model_v4 deleted 0.8704 43 196

Feature Viewer

pLDDT pTM Quality
82.56 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map