F295239

General Info

Members Datasets Scaffolds Average Seq Length
192 146 178 108

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_101228906|Ga0070705_1012289061
Length 107
Sequence MPFLHLVAWFFGGAFLANAVPHLVMGTIGRPFPTPFASPPGKGESSAVVNVLWGFANLVVGLALARAGDQWQPFAVSGVATGAGFLLMAIFVAVHFSRNDQGPTRGS

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
3 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
4 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
5 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
6 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
7 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
8 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
9 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
10 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
11 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
12 2919085039 Luteibacter sp. 1214 Isolate Unclassified
13 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
127 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
134 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
139 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
140 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
141 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
142 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0
Isolates 7.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 0
Rhizoplane 2.08
Rhizosphere 57.29
Stem 0
Stem Tuber 0
Unclassified 20.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1005900 3300003752 Bacteria 1578
2 Ga0070666_11195280 3300005335 Bacteria 566
3 Ga0070688_100059520 3300005365 Bacteria 2409
4 Ga0070659_100037559 3300005366 Bacteria 3776
5 Ga0070667_100000064 3300005367 Bacteria 135609
6 Ga0070713_100112304 3300005436 Bacteria 2378
7 Ga0070705_101228906 3300005440 Bacteria 618
8 Ga0070708_100060663 3300005445 Bacteria 3376
9 Ga0070663_100000724 3300005455 Bacteria 17796
10 Ga0070663_100404011 3300005455 Bacteria 1117
11 Ga0070685_10023001 3300005466 Bacteria 3406
12 Ga0070696_100476272 3300005546 Bacteria 989
13 Ga0070665_100723510 3300005548 Unclassified 1008
14 Ga0068855_100648613 3300005563 Bacteria 1134
15 Ga0068852_100175670 3300005616 Bacteria 2011
16 Ga0075369_10231483 3300006186 Bacteria 856
17 Ga0075370_10008511 3300006353 Bacteria 5284
18 Ga0105250_10000768 3300009092 Bacteria 19458
19 Ga0105240_10000005 3300009093 Bacteria 702630
20 Ga0105240_10003377 3300009093 Bacteria 24820
21 Ga0105240_10139141 3300009093 Bacteria 2904
22 Ga0105247_11812814 3300009101 Bacteria 508
23 Ga0105248_10018549 3300009177 Bacteria 7691
24 Ga0105237_10014974 3300009545 Bacteria 8083
25 Ga0105238_10001786 3300009551 Bacteria 21522
26 Ga0105249_10000147 3300009553 Bacteria 89436
27 Ga0105239_10002672 3300010375 Bacteria 22471
28 Ga0105239_10038228 3300010375 Bacteria 5259
29 Ga0105239_10234849 3300010375 Bacteria 2058
30 Ga0157370_10000163 3300013104 Bacteria 81428
31 Ga0157369_10709743 3300013105 Bacteria 1035
32 Ga0163162_11365270 3300013306 Bacteria 806
33 Ga0157372_11949418 3300013307 Bacteria 675
34 Ga0157376_11494596 3300014969 Bacteria 708
35 Ga0182007_10026148 3300015262 Bacteria 2026
36 Ga0182005_1056301 3300015265 Bacteria 1072
37 Ga0213876_10108181 3300021384 Bacteria 1475
38 Ga0207427_109242 3300025231 Bacteria 1069
39 Ga0209233_1002134 3300025261 Bacteria 7435
40 Ga0209455_1018653 3300025272 Bacteria 1419
41 Ga0207696_1000841 3300025711 Bacteria 19486
42 Ga0207680_10386958 3300025903 Bacteria 987
43 Ga0207695_10000011 3300025913 Bacteria 910221
44 Ga0207695_10001154 3300025913 Bacteria 45767
45 Ga0207695_10215336 3300025913 Bacteria 1830
46 Ga0207671_10033403 3300025914 Bacteria 3828
47 Ga0207694_10000708 3300025924 Bacteria 29982
48 Ga0207700_10341635 3300025928 Bacteria 1302
49 Ga0207690_10287768 3300025932 Bacteria 1282
50 Ga0207711_10000963 3300025941 Bacteria 27544
51 Ga0207667_10805475 3300025949 Bacteria 936
52 Ga0207667_11636828 3300025949 Bacteria 612
53 Ga0207712_10000090 3300025961 Bacteria 104492
54 Ga0207658_10000182 3300025986 Bacteria 67625
55 Ga0207678_10000849 3300026067 Bacteria 28043
56 Ga0207678_10386183 3300026067 Bacteria 1211
57 Ga0207698_10138791 3300026142 Bacteria 2090
58 Ga0209371_1000387 3300027312 Bacteria 46537
59 Ga0268266_10685659 3300028379 Unclassified 987
60 Ga0265337_1105451 3300028556 Bacteria 766
61 Ga0265334_10005799 3300028573 Bacteria 5380
62 Ga0265323_10035689 3300028653 Bacteria 1832
63 Ga0265338_10003658 3300028800 Bacteria 21412
64 Ga0265338_10060622 3300028800 Bacteria 3322
65 Ga0265338_10082811 3300028800 Bacteria 2685
66 Ga0268256_1000420 3300030500 Bacteria 38284
67 Ga0265330_10018934 3300031235 Bacteria 3159
68 Ga0265325_10007531 3300031241 Bacteria 6509
69 Ga0265325_10068611 3300031241 Bacteria 1784
70 Ga0265339_10011419 3300031249 Bacteria 5466
71 Ga0265316_10987970 3300031344 Unclassified 586
72 Ga0265313_10307556 3300031595 Bacteria 635
73 Ga0265314_10023233 3300031711 Bacteria 4733
74 Ga0265314_10597037 3300031711 Bacteria 569
75 Ga0307412_10756339 3300031911 Unclassified 839
76 Ga0373923_0361084 3300035111 Bacteria 695
77 Ga0373937_0653910 3300036401 Bacteria 997
78 Ga0395899_0371506 3300037312 Bacteria 952
79 Ga0395900_0055920 3300037418 Bacteria 4062
80 Ga0395898_0299063 3300037466 Bacteria 1535
81 Ga0395905_0033712 3300037471 Bacteria 4809
82 Ga0395901_0053456 3300038443 Bacteria 4196
83 Ga0436365_0107761 3300039437 Bacteria 1167
84 Ga0436365_1912582 3300039437 Bacteria 6353
85 Ga0436360_0493342 3300039438 Bacteria 1582
86 Ga0495627_002012 3300046453 Bacteria 10447
87 Ga0495591_001044 3300046458 Bacteria 18656
88 Ga0495607_0029502 3300046501 Bacteria 3374
89 Ga0495583_0000038 3300046506 Bacteria 243395
90 Ga0495606_0000725 3300046507 Bacteria 50954
91 Ga0495616_0204223 3300046513 Bacteria 867
92 Ga0495630_1459255 3300046517 Bacteria 514
93 Ga0495632_0000275 3300046519 Bacteria 50568
94 Ga0495643_0178208 3300046522 Bacteria 1034
95 Ga0495643_0216098 3300046522 Bacteria 912
96 Ga0495648_0004103 3300046524 Bacteria 12545
97 Ga0495597_0124982 3300046542 Bacteria 1070
98 Ga0495611_0162179 3300046648 Bacteria 1045
99 Ga0495661_0000328 3300046665 Bacteria 51600
100 Ga0495661_0216926 3300046665 Bacteria 993
101 Ga0495670_0023999 3300046691 Bacteria 3011
102 Ga0495589_0053902 3300046794 Bacteria 1984
103 Ga0495672_0236565 3300047320 Bacteria 894
104 Ga0495673_0004400 3300047469 Bacteria 8832
105 Ga0495673_0349141 3300047469 Bacteria 522
106 Ga0495681_0002465 3300047470 Bacteria 13203
107 Ga0495681_0015794 3300047470 Bacteria 4262
108 Ga0495686_0007211 3300047472 Bacteria 8372
109 Ga0495686_0081601 3300047472 Bacteria 1974
110 Ga0495686_0205769 3300047472 Bacteria 1127
111 Ga0496102_0109495 3300048905 Bacteria 2574
112 Ga0496102_0210627 3300048905 Bacteria 1833
113 Ga0496102_1054488 3300048905 Bacteria 733
114 Ga0496114_0694126 3300048917 Bacteria 893
115 Ga0496116_0142188 3300048919 Bacteria 1347
116 Ga0496117_0001631 3300048920 Bacteria 31639
117 Ga0496117_0109879 3300048920 Bacteria 1720
118 Ga0496117_0132737 3300048920 Bacteria 1506
119 Ga0496117_0190933 3300048920 Bacteria 1167
120 Ga0496117_0352686 3300048920 Bacteria 759
121 Ga0496118_0012654 3300048921 Bacteria 8073
122 Ga0496118_0014969 3300048921 Bacteria 7216
123 Ga0496118_0077712 3300048921 Bacteria 2353
124 Ga0496118_0368996 3300048921 Bacteria 758
125 Ga0496119_0004615 3300048922 Bacteria 13601
126 Ga0496119_0332913 3300048922 Bacteria 740
127 Ga0496120_0064144 3300048923 Bacteria 2040
128 Ga0496121_0002148 3300048924 Bacteria 30905
129 Ga0496121_0031651 3300048924 Bacteria 4828
130 Ga0496121_0056251 3300048924 Bacteria 3268
131 Ga0496121_0259768 3300048924 Bacteria 1200
132 Ga0496122_0001612 3300048925 Bacteria 35277
133 Ga0496122_0001717 3300048925 Bacteria 33994
134 Ga0496123_0000211 3300048926 Bacteria 118697
135 Ga0496123_0000674 3300048926 Bacteria 56408
136 Ga0496124_0001697 3300048927 Bacteria 31139
137 Ga0496125_0005040 3300048928 Bacteria 14904
138 Ga0496125_0076158 3300048928 Bacteria 2592
139 Ga0496126_0000105 3300048929 Bacteria 198893
140 Ga0496126_0103478 3300048929 Bacteria 2488
141 Ga0496126_0127562 3300048929 Bacteria 2201
142 Ga0496126_0246561 3300048929 Bacteria 1490
143 Ga0496126_0414353 3300048929 Bacteria 1090
144 Ga0495682_0016227 3300049460 Bacteria 2819
145 Ga0501073_0063938 3300049589 Bacteria 2566
146 nmdc:mga0sz30_253613_c1 3300050516 Bacteria 783
147 Ga0500643_000150 3300053087 Bacteria 71016
148 Ga0500643_200739 3300053087 Bacteria 535
149 Ga0500583_0159990 3300053092 Bacteria 1122
150 Ga0500651_0003766 3300053093 Bacteria 8360
151 Ga0500651_0387317 3300053093 Bacteria 787
152 Ga0500641_0144210 3300053096 Bacteria 1029
153 Ga0500650_0291624 3300053098 Bacteria 724
154 Ga0500555_000264 3300053103 Bacteria 22935
155 Ga0500572_000146 3300053111 Bacteria 24329
156 Ga0500594_0017076 3300053118 Bacteria 1771
157 Ga0500595_053730 3300053119 Bacteria 1239
158 Ga0500595_203435 3300053119 Bacteria 546
159 Ga0500608_279153 3300053122 Bacteria 633
160 Ga0500608_325567 3300053122 Bacteria 557
161 Ga0500642_0018992 3300053130 Bacteria 2671
162 Ga0500559_0002979 3300053136 Bacteria 8498
163 Ga0500559_0004555 3300053136 Bacteria 6554
164 Ga0500568_0001583 3300053139 Bacteria 14393
165 Ga0500573_0056595 3300053140 Bacteria 2251
166 Ga0500588_0061623 3300053146 Bacteria 1204
167 Ga0500604_0109031 3300053151 Bacteria 918
168 Ga0500616_0002658 3300053153 Bacteria 14536
169 Ga0500622_0066789 3300053156 Bacteria 1825
170 Ga0500627_0295555 3300053158 Bacteria 708
171 Ga0500634_0069112 3300053161 Bacteria 1853
172 Ga0500634_0275109 3300053161 Bacteria 683
173 Ga0500638_216579 3300053162 Bacteria 798
174 Ga0500639_277199 3300053163 Bacteria 649
175 Ga0500636_0134026 3300053177 Bacteria 1377
176 Ga0500637_0187256 3300053178 Bacteria 1184
177 Ga0500596_019203 3300053735 Bacteria 1026
178 Ga0501084_1149343 3300054114 Bacteria 651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025231 Ga0207427_109242 Ga0207427_1092422 93
2 3300053177 Ga0500636_0134026 Ga0500636_0134026_168_497 94
3 3300005436 Ga0070713_100112304 Ga0070713_1001123043 95
4 3300025928 Ga0207700_10341635 Ga0207700_103416351 95
5 3300039437 Ga0436365_1912582 Ga0436365_1912582_2463_2765 100
6 3300039438 Ga0436360_0493342 Ga0436360_0493342_889_1191 100
7 3300010375 Ga0105239_10038228 Ga0105239_100382284 101
8 3300028556 Ga0265337_1105451 Ga0265337_11054511 103
9 3300028653 Ga0265323_10035689 Ga0265323_100356892 103
10 3300039437 Ga0436365_0107761 Ga0436365_0107761_279_590 103
11 iso_pu_bacteria 2510917022 2511137302 105
12 iso_pu_bacteria 2582581307 2585274130 105
13 iso_pu_bacteria 2585427531 2585560579 105
14 iso_pu_bacteria 2585427609 2585903623 105
15 iso_pu_bacteria 2585428125 2587981257 105
16 iso_pu_bacteria 2824617872 2824625235 105
17 iso_pu_bacteria 2824626560 2824634044 105
18 iso_pu_bacteria 2824635225 2824641165 105
19 iso_pu_bacteria 2824644064 2824648344 105
20 iso_pu_bacteria 2824714736 2824718256 105
21 iso_pu_bacteria 2824723954 2824728526 105
22 iso_pu_bacteria 2919085039 2919085890 105
23 iso_pu_bacteria 2945961074 2945962408 105
24 iso_pu_bacteria 643348555 643392323 105
25 3300048929 Ga0496126_0127562 Ga0496126_0127562_336_671 106
26 3300005440 Ga0070705_101228906 Ga0070705_1012289061 107
27 3300005445 Ga0070708_100060663 Ga0070708_1000606633 107
28 3300005546 Ga0070696_100476272 Ga0070696_1004762722 107
29 3300005548 Ga0070665_100723510 Ga0070665_1007235102 107
30 3300028379 Ga0268266_10685659 Ga0268266_106856592 107
31 3300013306 Ga0163162_11365270 Ga0163162_113652701 108
32 3300025261 Ga0209233_1002134 Ga0209233_10021344 108
33 3300031241 Ga0265325_10007531 Ga0265325_100075314 108
34 3300031344 Ga0265316_10987970 Ga0265316_109879701 108
35 3300031595 Ga0265313_10307556 Ga0265313_103075561 108
36 3300046648 Ga0495611_0162179 Ga0495611_0162179_508_834 108
37 3300003752 Ga0055539_1005900 Ga0055539_10059002 109
38 3300005335 Ga0070666_11195280 Ga0070666_111952801 109
39 3300005365 Ga0070688_100059520 Ga0070688_1000595204 109
40 3300005366 Ga0070659_100037559 Ga0070659_1000375593 109
41 3300005367 Ga0070667_100000064 Ga0070667_10000006418 109
42 3300005455 Ga0070663_100000724 Ga0070663_10000072416 109
43 3300005455 Ga0070663_100404011 Ga0070663_1004040112 109
44 3300005466 Ga0070685_10023001 Ga0070685_100230013 109
45 3300005563 Ga0068855_100648613 Ga0068855_1006486132 109
46 3300005616 Ga0068852_100175670 Ga0068852_1001756702 109
47 3300006186 Ga0075369_10231483 Ga0075369_102314832 109
48 3300006353 Ga0075370_10008511 Ga0075370_100085117 109
49 3300009092 Ga0105250_10000768 Ga0105250_100007689 109
50 3300009093 Ga0105240_10000005 Ga0105240_10000005149 109
51 3300009093 Ga0105240_10003377 Ga0105240_100033776 109
52 3300009093 Ga0105240_10139141 Ga0105240_101391414 109
53 3300009101 Ga0105247_11812814 Ga0105247_118128142 109
54 3300009177 Ga0105248_10018549 Ga0105248_1001854912 109
55 3300009545 Ga0105237_10014974 Ga0105237_100149745 109
56 3300009551 Ga0105238_10001786 Ga0105238_1000178611 109
57 3300009553 Ga0105249_10000147 Ga0105249_1000014754 109
58 3300010375 Ga0105239_10002672 Ga0105239_1000267214 109
59 3300010375 Ga0105239_10234849 Ga0105239_102348492 109
60 3300013104 Ga0157370_10000163 Ga0157370_1000016377 109
61 3300013105 Ga0157369_10709743 Ga0157369_107097431 109
62 3300013307 Ga0157372_11949418 Ga0157372_119494182 109
63 3300014969 Ga0157376_11494596 Ga0157376_114945962 109
64 3300015262 Ga0182007_10026148 Ga0182007_100261482 109
65 3300015265 Ga0182005_1056301 Ga0182005_10563012 109
66 3300021384 Ga0213876_10108181 Ga0213876_101081813 109
67 3300025272 Ga0209455_1018653 Ga0209455_10186532 109
68 3300025711 Ga0207696_1000841 Ga0207696_10008419 109
69 3300025903 Ga0207680_10386958 Ga0207680_103869581 109
70 3300025913 Ga0207695_10000011 Ga0207695_10000011766 109
71 3300025913 Ga0207695_10001154 Ga0207695_1000115435 109
72 3300025913 Ga0207695_10215336 Ga0207695_102153362 109
73 3300025914 Ga0207671_10033403 Ga0207671_100334035 109
74 3300025924 Ga0207694_10000708 Ga0207694_100007085 109
75 3300025932 Ga0207690_10287768 Ga0207690_102877681 109
76 3300025941 Ga0207711_10000963 Ga0207711_1000096312 109
77 3300025949 Ga0207667_10805475 Ga0207667_108054752 109
78 3300025949 Ga0207667_11636828 Ga0207667_116368282 109
79 3300025961 Ga0207712_10000090 Ga0207712_1000009064 109
80 3300025986 Ga0207658_10000182 Ga0207658_1000018219 109
81 3300026067 Ga0207678_10000849 Ga0207678_1000084916 109
82 3300026067 Ga0207678_10386183 Ga0207678_103861832 109
83 3300026142 Ga0207698_10138791 Ga0207698_101387912 109
84 3300027312 Ga0209371_1000387 Ga0209371_100038738 109
85 3300028573 Ga0265334_10005799 Ga0265334_100057994 109
86 3300028800 Ga0265338_10003658 Ga0265338_100036588 109
87 3300028800 Ga0265338_10060622 Ga0265338_100606222 109
88 3300028800 Ga0265338_10082811 Ga0265338_100828112 109
89 3300030500 Ga0268256_1000420 Ga0268256_10004206 109
90 3300031235 Ga0265330_10018934 Ga0265330_100189341 109
91 3300031241 Ga0265325_10068611 Ga0265325_100686112 109
92 3300031249 Ga0265339_10011419 Ga0265339_100114195 109
93 3300031711 Ga0265314_10023233 Ga0265314_100232337 109
94 3300031711 Ga0265314_10597037 Ga0265314_105970372 109
95 3300031911 Ga0307412_10756339 Ga0307412_107563391 109
96 3300035111 Ga0373923_0361084 Ga0373923_0361084_333_662 109
97 3300036401 Ga0373937_0653910 Ga0373937_0653910_457_786 109
98 3300037312 Ga0395899_0371506 Ga0395899_0371506_147_476 109
99 3300037418 Ga0395900_0055920 Ga0395900_0055920_519_848 109
100 3300037466 Ga0395898_0299063 Ga0395898_0299063_306_635 109
101 3300037471 Ga0395905_0033712 Ga0395905_0033712_1075_1404 109
102 3300038443 Ga0395901_0053456 Ga0395901_0053456_3210_3539 109
103 3300046453 Ga0495627_002012 Ga0495627_002012_8587_8916 109
104 3300046458 Ga0495591_001044 Ga0495591_001044_16762_17091 109
105 3300046501 Ga0495607_0029502 Ga0495607_0029502_760_1089 109
106 3300046506 Ga0495583_0000038 Ga0495583_0000038_224675_225004 109
107 3300046507 Ga0495606_0000725 Ga0495606_0000725_37381_37710 109
108 3300046513 Ga0495616_0204223 Ga0495616_0204223_281_610 109
109 3300046517 Ga0495630_1459255 Ga0495630_1459255_115_444 109
110 3300046519 Ga0495632_0000275 Ga0495632_0000275_31906_32235 109
111 3300046522 Ga0495643_0178208 Ga0495643_0178208_401_730 109
112 3300046522 Ga0495643_0216098 Ga0495643_0216098_63_392 109
113 3300046524 Ga0495648_0004103 Ga0495648_0004103_3480_3809 109
114 3300046542 Ga0495597_0124982 Ga0495597_0124982_596_925 109
115 3300046665 Ga0495661_0000328 Ga0495661_0000328_49753_50082 109
116 3300046665 Ga0495661_0216926 Ga0495661_0216926_498_827 109
117 3300046691 Ga0495670_0023999 Ga0495670_0023999_1281_1610 109
118 3300046794 Ga0495589_0053902 Ga0495589_0053902_1639_1968 109
119 3300047320 Ga0495672_0236565 Ga0495672_0236565_211_540 109
120 3300047469 Ga0495673_0004400 Ga0495673_0004400_3893_4222 109
121 3300047469 Ga0495673_0349141 Ga0495673_0349141_141_470 109
122 3300047470 Ga0495681_0002465 Ga0495681_0002465_6706_7035 109
123 3300047470 Ga0495681_0015794 Ga0495681_0015794_3865_4194 109
124 3300047472 Ga0495686_0007211 Ga0495686_0007211_918_1247 109
125 3300047472 Ga0495686_0081601 Ga0495686_0081601_1241_1570 109
126 3300047472 Ga0495686_0205769 Ga0495686_0205769_379_708 109
127 3300048905 Ga0496102_0109495 Ga0496102_0109495_714_1043 109
128 3300048905 Ga0496102_0210627 Ga0496102_0210627_621_950 109
129 3300048905 Ga0496102_1054488 Ga0496102_1054488_187_516 109
130 3300048917 Ga0496114_0694126 Ga0496114_0694126_26_355 109
131 3300048919 Ga0496116_0142188 Ga0496116_0142188_72_401 109
132 3300048920 Ga0496117_0001631 Ga0496117_0001631_7798_8127 109
133 3300048920 Ga0496117_0109879 Ga0496117_0109879_856_1185 109
134 3300048920 Ga0496117_0132737 Ga0496117_0132737_25_354 109
135 3300048920 Ga0496117_0190933 Ga0496117_0190933_807_1136 109
136 3300048920 Ga0496117_0352686 Ga0496117_0352686_318_647 109
137 3300048921 Ga0496118_0012654 Ga0496118_0012654_3900_4229 109
138 3300048921 Ga0496118_0014969 Ga0496118_0014969_6116_6445 109
139 3300048921 Ga0496118_0077712 Ga0496118_0077712_599_928 109
140 3300048921 Ga0496118_0368996 Ga0496118_0368996_69_398 109
141 3300048922 Ga0496119_0004615 Ga0496119_0004615_12077_12406 109
142 3300048922 Ga0496119_0332913 Ga0496119_0332913_163_492 109
143 3300048923 Ga0496120_0064144 Ga0496120_0064144_120_449 109
144 3300048924 Ga0496121_0002148 Ga0496121_0002148_23361_23690 109
145 3300048924 Ga0496121_0031651 Ga0496121_0031651_2721_3050 109
146 3300048924 Ga0496121_0056251 Ga0496121_0056251_1552_1881 109
147 3300048924 Ga0496121_0259768 Ga0496121_0259768_435_764 109
148 3300048925 Ga0496122_0001612 Ga0496122_0001612_31887_32216 109
149 3300048925 Ga0496122_0001717 Ga0496122_0001717_11712_12041 109
150 3300048926 Ga0496123_0000211 Ga0496123_0000211_11872_12201 109
151 3300048926 Ga0496123_0000674 Ga0496123_0000674_3059_3388 109
152 3300048927 Ga0496124_0001697 Ga0496124_0001697_7815_8144 109
153 3300048928 Ga0496125_0005040 Ga0496125_0005040_1385_1714 109
154 3300048928 Ga0496125_0076158 Ga0496125_0076158_1794_2123 109
155 3300048929 Ga0496126_0000105 Ga0496126_0000105_174658_174987 109
156 3300048929 Ga0496126_0103478 Ga0496126_0103478_1216_1545 109
157 3300048929 Ga0496126_0246561 Ga0496126_0246561_642_971 109
158 3300048929 Ga0496126_0414353 Ga0496126_0414353_131_460 109
159 3300049460 Ga0495682_0016227 Ga0495682_0016227_163_492 109
160 3300049589 Ga0501073_0063938 Ga0501073_0063938_75_404 109
161 3300050516 nmdc:mga0sz30_253613_c1 nmdc:mga0sz30_253613_c1_114_443 109
162 3300053087 Ga0500643_000150 Ga0500643_000150_29325_29654 109
163 3300053087 Ga0500643_200739 Ga0500643_200739_59_388 109
164 3300053092 Ga0500583_0159990 Ga0500583_0159990_114_443 109
165 3300053093 Ga0500651_0003766 Ga0500651_0003766_3722_4051 109
166 3300053093 Ga0500651_0387317 Ga0500651_0387317_360_689 109
167 3300053096 Ga0500641_0144210 Ga0500641_0144210_219_548 109
168 3300053098 Ga0500650_0291624 Ga0500650_0291624_28_357 109
169 3300053103 Ga0500555_000264 Ga0500555_000264_18340_18669 109
170 3300053111 Ga0500572_000146 Ga0500572_000146_22708_23037 109
171 3300053118 Ga0500594_0017076 Ga0500594_0017076_1205_1534 109
172 3300053119 Ga0500595_053730 Ga0500595_053730_439_768 109
173 3300053119 Ga0500595_203435 Ga0500595_203435_34_363 109
174 3300053122 Ga0500608_279153 Ga0500608_279153_133_462 109
175 3300053122 Ga0500608_325567 Ga0500608_325567_29_364 109
176 3300053130 Ga0500642_0018992 Ga0500642_0018992_1632_1961 109
177 3300053136 Ga0500559_0002979 Ga0500559_0002979_7882_8211 109
178 3300053136 Ga0500559_0004555 Ga0500559_0004555_1626_1955 109
179 3300053139 Ga0500568_0001583 Ga0500568_0001583_13122_13451 109
180 3300053140 Ga0500573_0056595 Ga0500573_0056595_382_711 109
181 3300053146 Ga0500588_0061623 Ga0500588_0061623_763_1092 109
182 3300053151 Ga0500604_0109031 Ga0500604_0109031_354_683 109
183 3300053153 Ga0500616_0002658 Ga0500616_0002658_12727_13056 109
184 3300053156 Ga0500622_0066789 Ga0500622_0066789_314_643 109
185 3300053158 Ga0500627_0295555 Ga0500627_0295555_334_663 109
186 3300053161 Ga0500634_0069112 Ga0500634_0069112_143_478 109
187 3300053161 Ga0500634_0275109 Ga0500634_0275109_206_535 109
188 3300053162 Ga0500638_216579 Ga0500638_216579_370_699 109
189 3300053163 Ga0500639_277199 Ga0500639_277199_89_418 109
190 3300053178 Ga0500637_0187256 Ga0500637_0187256_514_843 109
191 3300053735 Ga0500596_019203 Ga0500596_019203_397_726 109
192 3300054114 Ga0501084_1149343 Ga0501084_1149343_33_362 109

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.648 1 98
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.5323 1 97
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.5292 1 98
7a0g-assembly1.cif.gz_JJJ structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.4665 5 104
7d3u-assembly1.cif.gz_G structure of mrp complex from dietzia sp. dq12-45-1b 0.4414 1 99
ID Description Score Start End Superfamily
af_A0A0R0GBE4_5_124_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6483 7 97 1.10.3730.20
af_Q6H4M5_1_105_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6221 4 97 1.20.1280.290
af_Q20231_29_140_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.5889 5 98 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.5795 1 105 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.5759 1 97 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A0N1DPY6-F1-model_v4 deleted 0.9399 1 99
AF-A0A2K9Z2K0-F1-model_v4 Integral membrane protein 0.9358 1 99 GO:0016020
AF-W0HNV0-F1-model_v4 Uncharacterized protein 0.9347 3 104 GO:0016020
AF-A0A1Q8B8G0-F1-model_v4 Uncharacterized protein 0.932 1 100 GO:0016020
AF-A0A192LWI2-F1-model_v4 deleted 0.9291 1 99

Feature Viewer

pLDDT pTM Quality
90.44 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map