F290185

General Info

Members Datasets Scaffolds Average Seq Length
188 153 142 237

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935409751|2935411855
Length 263
Sequence AETSARAVGAPRTARDARALRTAERTGAELHLDGLTAGYGGAPVLRGVDVRVPAGTILALLGANGAGKTTLLRSVSGLMPAASGRIVFDGVDLAEVSVEDRARAGLAQVPEGRSVVAELTVDENLRLGGLQRFRGRRLTAAVDGIYDLFEPLVRRRRAAGHQLSGGERQMLALGRAIIAEPRVLLLDEPSLGLAPRVVAQIMAVLRTLRDERGLTVLLAEQNVTSALAVADHGVVLNLGEVVADRPAEDLRTDSALRHAYLGF

Samples

Sample ID Description Type Environment
1 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
2 2519899620 Rhizobium sp. Pop5 Isolate Nodule
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
6 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
7 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
8 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
9 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2791355261 Rhizobium sp. J15 Isolate Nodule
12 2791355263 Rhizobium chutanense C5 Isolate Nodule
13 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
14 2838061910 Rhizobium phaseoli L15 Isolate Nodule
15 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
16 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
17 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
18 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
19 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
20 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
21 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
22 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
23 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
24 2858882152 Micromonospora noduli MED15 Isolate Nodule
25 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
26 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
27 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
28 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
29 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
30 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
31 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
32 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
33 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
34 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
35 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
143 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
144 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
145 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
146 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
147 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
148 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
149 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
150 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
151 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
152 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
153 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0.53
Isolates 24.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 9.04
Rhizoplane 3.19
Rhizosphere 69.15
Stem 0
Stem Tuber 0
Unclassified 16.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100067753 3300005329 Bacteria 3325
2 Ga0070683_100103796 3300005329 Bacteria 2679
3 Ga0070668_100028221 3300005347 Bacteria 4261
4 Ga0070709_10029886 3300005434 Bacteria 3264
5 Ga0070713_100705666 3300005436 Bacteria 963
6 Ga0070708_100000047 3300005445 Bacteria 80385
7 Ga0070708_100803062 3300005445 Bacteria 884
8 Ga0070706_100001107 3300005467 Bacteria 29199
9 Ga0070706_100005590 3300005467 Bacteria 11958
10 Ga0070706_100476485 3300005467 Bacteria 1161
11 Ga0070707_100000094 3300005468 Bacteria 80385
12 Ga0070707_100543749 3300005468 Bacteria 1123
13 Ga0070698_100027120 3300005471 Bacteria 5957
14 Ga0070698_100242987 3300005471 Bacteria 1733
15 Ga0070699_100003386 3300005518 Bacteria 14106
16 Ga0070699_100040642 3300005518 Bacteria 4026
17 Ga0070679_100364669 3300005530 Bacteria 1392
18 Ga0070679_100436830 3300005530 Bacteria 1254
19 Ga0070684_100264066 3300005535 Bacteria 1575
20 Ga0070697_100001153 3300005536 Bacteria 20035
21 Ga0070697_100192506 3300005536 Bacteria 1731
22 Ga0070704_100003748 3300005549 Bacteria 8749
23 Ga0068857_100299626 3300005577 Bacteria 1482
24 Ga0068856_100182717 3300005614 Bacteria 2111
25 Ga0068859_100707485 3300005617 Bacteria 1098
26 Ga0068864_100023325 3300005618 Bacteria 5195
27 Ga0068870_10305248 3300005840 Bacteria 1006
28 Ga0068863_100032810 3300005841 Bacteria 4947
29 Ga0081540_1009223 3300005983 Bacteria 6804
30 Ga0070717_10172941 3300006028 Bacteria 1879
31 Ga0070716_100018616 3300006173 Bacteria 3620
32 Ga0075428_100241846 3300006844 Bacteria 1947
33 Ga0097620_100707439 3300006931 Bacteria 1098
34 Ga0111539_10031184 3300009094 Bacteria 6479
35 Ga0114129_10000004 3300009147 Bacteria 160944
36 Ga0114129_10008222 3300009147 Bacteria 14875
37 Ga0105242_11091187 3300009176 Bacteria 812
38 Ga0105248_10036653 3300009177 Bacteria 5486
39 Ga0171462_1001 3300013250 Bacteria 1135406
40 Ga0157372_10090973 3300013307 Bacteria 3470
41 Ga0157375_10755631 3300013308 Bacteria 1123
42 Ga0163163_10161096 3300014325 Bacteria 2289
43 Ga0157376_10841520 3300014969 Bacteria 932
44 Ga0206353_10936676 3300020082 Bacteria 2225
45 Ga0209025_1039752 3300025294 Bacteria 2047
46 Ga0207692_10030547 3300025898 Bacteria 2570
47 Ga0207699_10032898 3300025906 Bacteria 2925
48 Ga0207684_10000246 3300025910 Bacteria 81541
49 Ga0207684_10000304 3300025910 Bacteria 69992
50 Ga0207684_10037702 3300025910 Bacteria 4102
51 Ga0207684_10272001 3300025910 Bacteria 1462
52 Ga0207707_10541354 3300025912 Bacteria 990
53 Ga0207693_10026639 3300025915 Bacteria 4574
54 Ga0207652_10137914 3300025921 Bacteria 2179
55 Ga0207652_10144170 3300025921 Bacteria 2131
56 Ga0207646_10000204 3300025922 Bacteria 80399
57 Ga0207646_10006954 3300025922 Bacteria 11601
58 Ga0207665_10087516 3300025939 Bacteria 2153
59 Ga0207711_10054766 3300025941 Bacteria 3424
60 Ga0207711_10443990 3300025941 Bacteria 1207
61 Ga0207661_10066818 3300025944 Bacteria 2922
62 Ga0207661_10096649 3300025944 Bacteria 2472
63 Ga0207679_10293385 3300025945 Bacteria 1399
64 Ga0207668_10001283 3300025972 Bacteria 14967
65 Ga0207678_10000192 3300026067 Bacteria 52866
66 Ga0207702_10157151 3300026078 Bacteria 2073
67 Ga0207702_10724511 3300026078 Bacteria 981
68 Ga0207641_10016628 3300026088 Bacteria 6023
69 Ga0207676_10061464 3300026095 Bacteria 2974
70 Ga0210000_1005503 3300027462 Bacteria 1837
71 Ga0268266_10198957 3300028379 Bacteria 1833
72 Ga0307515_10002732 3300028794 Bacteria 37745
73 Ga0307515_10090301 3300028794 Bacteria 3844
74 Ga0307512_10019452 3300030522 Bacteria 6178
75 Ga0307513_10078561 3300031456 Bacteria 3413
76 Ga0307508_10002502 3300031616 Bacteria 19362
77 Ga0307405_10166194 3300031731 Bacteria 1569
78 Ga0307405_10207608 3300031731 Bacteria 1427
79 Ga0307413_10049580 3300031824 Bacteria 2517
80 Ga0307413_10127132 3300031824 Bacteria 1738
81 Ga0307518_10223393 3300031838 Bacteria 1227
82 Ga0307410_10026172 3300031852 Bacteria 3669
83 Ga0307410_10068772 3300031852 Bacteria 2447
84 Ga0307410_10172863 3300031852 Bacteria 1629
85 Ga0307406_10098264 3300031901 Bacteria 1987
86 Ga0307406_10106198 3300031901 Bacteria 1923
87 Ga0307407_10011599 3300031903 Bacteria 4203
88 Ga0307407_10095530 3300031903 Bacteria 1833
89 Ga0307412_10051509 3300031911 Bacteria 2721
90 Ga0307412_10206785 3300031911 Bacteria 1495
91 Ga0307409_100014011 3300031995 Bacteria 5192
92 Ga0307409_100084214 3300031995 Bacteria 2581
93 Ga0307409_100141940 3300031995 Bacteria 2071
94 Ga0307416_100046203 3300032002 Bacteria 3435
95 Ga0307416_100667963 3300032002 Bacteria 1125
96 Ga0307411_10207603 3300032005 Bacteria 1510
97 Ga0307415_100182030 3300032126 Bacteria 1650
98 Ga0307507_10129982 3300033179 Bacteria 1975
99 Ga0373950_0026892 3300034818 Bacteria 1046
100 Ga0373940_0035023 3300035088 Bacteria 1357
101 Ga0373951_0000305 3300035091 Bacteria 15567
102 Ga0373941_0006542 3300035115 Bacteria 2813
103 Ga0373942_0001766 3300035207 Bacteria 5473
104 Ga0373935_0013934 3300035692 Bacteria 4854
105 Ga0395900_0397871 3300037418 Bacteria 1342
106 Ga0395905_0013693 3300037471 Bacteria 7769
107 Ga0395901_0035892 3300038443 Bacteria 5123
108 Ga0436365_1709036 3300039437 Bacteria 6644
109 Ga0466965_0001045 3300044683 Bacteria 10742
110 Ga0466966_0254969 3300044684 Bacteria 1057
111 Ga0466961_0226531 3300044693 Bacteria 1151
112 Ga0466961_0274892 3300044693 Bacteria 1032
113 Ga0466963_0212727 3300044694 Bacteria 1353
114 Ga0466970_0003636 3300044765 Bacteria 7520
115 Ga0466970_0022877 3300044765 Bacteria 3261
116 Ga0466957_0017520 3300044842 Bacteria 4197
117 Ga0466960_0002265 3300044901 Bacteria 7195
118 Ga0466967_0228146 3300045976 Bacteria 1772
119 Ga0495638_0024826 3300046460 Bacteria 3902
120 Ga0495638_0213603 3300046460 Bacteria 1082
121 Ga0495630_0000965 3300046517 Bacteria 20112
122 Ga0495632_0033018 3300046519 Bacteria 2661
123 Ga0495668_0000173 3300046616 Bacteria 95830
124 Ga0495625_0001016 3300046660 Bacteria 37004
125 Ga0495683_0090202 3300047323 Bacteria 1486
126 Ga0495626_0000642 3300048091 Bacteria 33724
127 Ga0496105_0049543 3300048908 Bacteria 3468
128 Ga0496108_0000220 3300048911 Bacteria 51907
129 Ga0496108_0069608 3300048911 Bacteria 2969
130 Ga0496112_0143054 3300048915 Bacteria 2360
131 Ga0496112_0474207 3300048915 Bacteria 1188
132 Ga0496113_0002002 3300048916 Bacteria 11677
133 Ga0496119_0005331 3300048922 Bacteria 12371
134 Ga0496126_0226003 3300048929 Bacteria 1570
135 Ga0501034_0014673 3300049571 Bacteria 8066
136 nmdc:mga05p37_34314_c1 3300050507 Bacteria 6214
137 nmdc:mga05p37_4281_c1 3300050507 Bacteria 16670
138 nmdc:mga09592_6259_c1 3300050508 Bacteria 9694
139 nmdc:mga0a205_67830_c1 3300050515 Bacteria 2218
140 Ga0500569_061920 3300053109 Bacteria 1157
141 Ga0500594_0006537 3300053118 Bacteria 2623
142 Ga0500630_067895 3300053159 Bacteria 1692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100000047 Ga0070708_1000000478 216
2 3300005467 Ga0070706_100001107 Ga0070706_1000011078 216
3 3300005468 Ga0070707_100000094 Ga0070707_1000000948 216
4 3300005518 Ga0070699_100003386 Ga0070699_1000033865 216
5 3300005549 Ga0070704_100003748 Ga0070704_1000037486 216
6 3300025910 Ga0207684_10000246 Ga0207684_1000024682 216
7 3300025922 Ga0207646_10000204 Ga0207646_100002048 216
8 3300046517 Ga0495630_0000965 Ga0495630_0000965_4683_5396 216
9 3300006028 Ga0070717_10172941 Ga0070717_101729413 219
10 3300005536 Ga0070697_100001153 Ga0070697_10000115321 220
11 3300028794 Ga0307515_10002732 Ga0307515_100027327 226
12 3300028794 Ga0307515_10090301 Ga0307515_100903013 226
13 3300030522 Ga0307512_10019452 Ga0307512_100194525 226
14 3300031616 Ga0307508_10002502 Ga0307508_1000250214 226
15 3300044693 Ga0466961_0274892 Ga0466961_0274892_227_934 226
16 3300046460 Ga0495638_0213603 Ga0495638_0213603_328_1017 226
17 3300046519 Ga0495632_0033018 Ga0495632_0033018_1667_2356 226
18 3300053109 Ga0500569_061920 Ga0500569_061920_285_974 226
19 3300053118 Ga0500594_0006537 Ga0500594_0006537_393_1082 226
20 3300025945 Ga0207679_10293385 Ga0207679_102933851 230
21 iso_pu_bacteria 2513237085 2513574428 230
22 iso_pu_bacteria 2519899620 2520381104 230
23 iso_pu_bacteria 2657244999 2657684727 230
24 iso_pu_bacteria 2791355261 2793331572 230
25 iso_pu_bacteria 2791355263 2793344659 230
26 iso_pu_bacteria 2802429268 2804755871 230
27 iso_pu_bacteria 2838061910 2838064553 230
28 iso_pu_bacteria 2842264693 2842270049 230
29 iso_pu_bacteria 2842428310 2842433882 230
30 iso_pu_bacteria 2842434925 2842440258 230
31 iso_pu_bacteria 2842441272 2842446953 230
32 iso_pu_bacteria 2842469257 2842474808 230
33 iso_pu_bacteria 8005430974 8005434924 230
34 iso_pu_bacteria 8005626139 8005628966 230
35 3300005347 Ga0070668_100028221 Ga0070668_1000282212 231
36 3300005436 Ga0070713_100705666 Ga0070713_1007056662 231
37 3300005467 Ga0070706_100476485 Ga0070706_1004764851 231
38 3300005530 Ga0070679_100436830 Ga0070679_1004368302 231
39 3300005983 Ga0081540_1009223 Ga0081540_10092237 231
40 3300009094 Ga0111539_10031184 Ga0111539_100311845 231
41 3300009176 Ga0105242_11091187 Ga0105242_110911871 231
42 3300014969 Ga0157376_10841520 Ga0157376_108415201 231
43 3300025898 Ga0207692_10030547 Ga0207692_100305473 231
44 3300025972 Ga0207668_10001283 Ga0207668_100012834 231
45 3300028379 Ga0268266_10198957 Ga0268266_101989572 231
46 3300034818 Ga0373950_0026892 Ga0373950_0026892_318_1025 231
47 3300035088 Ga0373940_0035023 Ga0373940_0035023_435_1142 231
48 3300035115 Ga0373941_0006542 Ga0373941_0006542_1752_2459 231
49 3300035207 Ga0373942_0001766 Ga0373942_0001766_2159_2866 231
50 3300035692 Ga0373935_0013934 Ga0373935_0013934_25_729 231
51 3300048911 Ga0496108_0000220 Ga0496108_0000220_44753_45457 231
52 3300053159 Ga0500630_067895 Ga0500630_067895_507_1211 231
53 iso_pu_bacteria 8003314358 8003316679 231
54 3300039437 Ga0436365_1709036 Ga0436365_1709036_2974_3672 232
55 3300050515 nmdc:mga0a205_67830_c1 nmdc:mga0a205_67830_c1_923_1636 232
56 iso_pu_bacteria 2643221690 2644502968 232
57 iso_pu_bacteria 2643221694 2644525307 232
58 iso_pu_bacteria 2643221722 2644669392 232
59 3300013308 Ga0157375_10755631 Ga0157375_107556312 233
60 3300027462 Ga0210000_1005503 Ga0210000_10055033 233
61 3300031824 Ga0307413_10049580 Ga0307413_100495803 233
62 3300031824 Ga0307413_10127132 Ga0307413_101271322 233
63 3300031852 Ga0307410_10026172 Ga0307410_100261722 233
64 3300031852 Ga0307410_10068772 Ga0307410_100687723 233
65 3300031903 Ga0307407_10095530 Ga0307407_100955302 233
66 3300031995 Ga0307409_100084214 Ga0307409_1000842142 233
67 3300031995 Ga0307409_100141940 Ga0307409_1001419402 233
68 3300032002 Ga0307416_100046203 Ga0307416_1000462033 233
69 3300032005 Ga0307411_10207603 Ga0307411_102076032 233
70 3300025294 Ga0209025_1039752 Ga0209025_10397522 234
71 3300046460 Ga0495638_0024826 Ga0495638_0024826_2032_2754 234
72 3300049571 Ga0501034_0014673 Ga0501034_0014673_6378_7085 234
73 iso_pu_bacteria 2643221572 2643876649 234
74 iso_pu_bacteria 2643221669 2644383704 234
75 iso_pu_bacteria 2895660088 2895660866 234
76 iso_pu_bacteria 8001781756 8001785444 234
77 3300005329 Ga0070683_100067753 Ga0070683_1000677534 235
78 3300005329 Ga0070683_100103796 Ga0070683_1001037963 235
79 3300005434 Ga0070709_10029886 Ga0070709_100298863 235
80 3300005445 Ga0070708_100803062 Ga0070708_1008030622 235
81 3300005467 Ga0070706_100005590 Ga0070706_1000055904 235
82 3300005468 Ga0070707_100543749 Ga0070707_1005437492 235
83 3300005471 Ga0070698_100027120 Ga0070698_1000271203 235
84 3300005471 Ga0070698_100242987 Ga0070698_1002429872 235
85 3300005518 Ga0070699_100040642 Ga0070699_1000406425 235
86 3300005530 Ga0070679_100364669 Ga0070679_1003646691 235
87 3300005535 Ga0070684_100264066 Ga0070684_1002640662 235
88 3300005536 Ga0070697_100192506 Ga0070697_1001925063 235
89 3300005577 Ga0068857_100299626 Ga0068857_1002996261 235
90 3300005614 Ga0068856_100182717 Ga0068856_1001827172 235
91 3300005617 Ga0068859_100707485 Ga0068859_1007074852 235
92 3300005618 Ga0068864_100023325 Ga0068864_1000233254 235
93 3300005840 Ga0068870_10305248 Ga0068870_103052482 235
94 3300005841 Ga0068863_100032810 Ga0068863_1000328103 235
95 3300006173 Ga0070716_100018616 Ga0070716_1000186164 235
96 3300006844 Ga0075428_100241846 Ga0075428_1002418462 235
97 3300006931 Ga0097620_100707439 Ga0097620_1007074392 235
98 3300009147 Ga0114129_10000004 Ga0114129_1000000418 235
99 3300009147 Ga0114129_10008222 Ga0114129_1000822211 235
100 3300009177 Ga0105248_10036653 Ga0105248_100366533 235
101 3300013250 Ga0171462_1001 Ga0171462_1001539 235
102 3300013307 Ga0157372_10090973 Ga0157372_100909732 235
103 3300014325 Ga0163163_10161096 Ga0163163_101610963 235
104 3300020082 Ga0206353_10936676 Ga0206353_109366762 235
105 3300025906 Ga0207699_10032898 Ga0207699_100328983 235
106 3300025910 Ga0207684_10000304 Ga0207684_1000030419 235
107 3300025910 Ga0207684_10037702 Ga0207684_100377022 235
108 3300025910 Ga0207684_10272001 Ga0207684_102720012 235
109 3300025912 Ga0207707_10541354 Ga0207707_105413542 235
110 3300025915 Ga0207693_10026639 Ga0207693_100266393 235
111 3300025921 Ga0207652_10137914 Ga0207652_101379142 235
112 3300025921 Ga0207652_10144170 Ga0207652_101441702 235
113 3300025922 Ga0207646_10006954 Ga0207646_100069544 235
114 3300025939 Ga0207665_10087516 Ga0207665_100875162 235
115 3300025941 Ga0207711_10054766 Ga0207711_100547663 235
116 3300025941 Ga0207711_10443990 Ga0207711_104439902 235
117 3300025944 Ga0207661_10066818 Ga0207661_100668183 235
118 3300025944 Ga0207661_10096649 Ga0207661_100966492 235
119 3300026067 Ga0207678_10000192 Ga0207678_1000019222 235
120 3300026078 Ga0207702_10157151 Ga0207702_101571512 235
121 3300026078 Ga0207702_10724511 Ga0207702_107245112 235
122 3300026088 Ga0207641_10016628 Ga0207641_100166284 235
123 3300026095 Ga0207676_10061464 Ga0207676_100614643 235
124 3300031456 Ga0307513_10078561 Ga0307513_100785612 235
125 3300031731 Ga0307405_10166194 Ga0307405_101661942 235
126 3300031731 Ga0307405_10207608 Ga0307405_102076082 235
127 3300031838 Ga0307518_10223393 Ga0307518_102233932 235
128 3300031852 Ga0307410_10172863 Ga0307410_101728632 235
129 3300031901 Ga0307406_10098264 Ga0307406_100982643 235
130 3300031901 Ga0307406_10106198 Ga0307406_101061982 235
131 3300031903 Ga0307407_10011599 Ga0307407_100115992 235
132 3300031911 Ga0307412_10051509 Ga0307412_100515093 235
133 3300031911 Ga0307412_10206785 Ga0307412_102067852 235
134 3300031995 Ga0307409_100014011 Ga0307409_1000140116 235
135 3300032002 Ga0307416_100667963 Ga0307416_1006679632 235
136 3300032126 Ga0307415_100182030 Ga0307415_1001820302 235
137 3300033179 Ga0307507_10129982 Ga0307507_101299822 235
138 3300035091 Ga0373951_0000305 Ga0373951_0000305_6754_7470 235
139 3300037418 Ga0395900_0397871 Ga0395900_0397871_135_851 235
140 3300037471 Ga0395905_0013693 Ga0395905_0013693_6028_6744 235
141 3300038443 Ga0395901_0035892 Ga0395901_0035892_1863_2579 235
142 3300044683 Ga0466965_0001045 Ga0466965_0001045_565_1296 235
143 3300044684 Ga0466966_0254969 Ga0466966_0254969_149_856 235
144 3300044693 Ga0466961_0226531 Ga0466961_0226531_226_933 235
145 3300044694 Ga0466963_0212727 Ga0466963_0212727_251_982 235
146 3300044765 Ga0466970_0003636 Ga0466970_0003636_2053_2784 235
147 3300044765 Ga0466970_0022877 Ga0466970_0022877_1838_2545 235
148 3300044842 Ga0466957_0017520 Ga0466957_0017520_2643_3374 235
149 3300044901 Ga0466960_0002265 Ga0466960_0002265_3896_4627 235
150 3300045976 Ga0466967_0228146 Ga0466967_0228146_125_844 235
151 3300046616 Ga0495668_0000173 Ga0495668_0000173_35116_35841 235
152 3300046660 Ga0495625_0001016 Ga0495625_0001016_30711_31436 235
153 3300047323 Ga0495683_0090202 Ga0495683_0090202_302_1027 235
154 3300048091 Ga0495626_0000642 Ga0495626_0000642_9653_10378 235
155 3300048908 Ga0496105_0049543 Ga0496105_0049543_1027_1791 235
156 3300048911 Ga0496108_0069608 Ga0496108_0069608_118_882 235
157 3300048915 Ga0496112_0143054 Ga0496112_0143054_1098_1862 235
158 3300048915 Ga0496112_0474207 Ga0496112_0474207_124_888 235
159 3300048916 Ga0496113_0002002 Ga0496113_0002002_7338_8102 235
160 3300048922 Ga0496119_0005331 Ga0496119_0005331_1622_2365 235
161 3300048929 Ga0496126_0226003 Ga0496126_0226003_775_1500 235
162 3300050507 nmdc:mga05p37_34314_c1 nmdc:mga05p37_34314_c1_2907_3629 235
163 3300050507 nmdc:mga05p37_4281_c1 nmdc:mga05p37_4281_c1_8669_9376 235
164 3300050508 nmdc:mga09592_6259_c1 nmdc:mga09592_6259_c1_3659_4381 235
165 iso_pu_bacteria 2721755702 2723643374 235
166 iso_pu_bacteria 2772190715 2772646110 235
167 iso_pu_bacteria 2855670206 2855670755 235
168 iso_pu_bacteria 2855676851 2855677816 235
169 iso_pu_bacteria 2857288857 2857289685 235
170 iso_pu_bacteria 2858848962 2858849348 235
171 iso_pu_bacteria 2858882152 2858882495 235
172 iso_pu_bacteria 2858888857 2858894670 235
173 iso_pu_bacteria 2858895516 2858895566 235
174 iso_pu_bacteria 2869048445 2869049622 235
175 iso_pu_bacteria 2869061728 2869063246 235
176 iso_pu_bacteria 2869068681 2869069654 235
177 iso_pu_bacteria 2880489317 2880490856 235
178 iso_pu_bacteria 2880495981 2880501659 235
179 iso_pu_bacteria 2887478801 2887480892 235
180 iso_pu_bacteria 2929226422 2929230162 235
181 iso_pu_bacteria 2935409751 2935411855 235
182 iso_pu_bacteria 8003830390 8003833919 235
183 iso_pu_bacteria 8003870546 8003872438 235
184 iso_pu_bacteria 8045830549 8045832427 235
185 iso_pu_bacteria 8046352972 8046354279 235
186 iso_pu_bacteria 8054704163 8054705877 235
187 iso_pu_bacteria 8054727385 8054728894 235
188 iso_pu_bacteria 8054734606 8054734759 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

191

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9619 2 235
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.95 2 235
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9449 2 222
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9449 2 222
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9381 1 222
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 1 235 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9583 1 235 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9565 1 230 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9562 2 235 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A521W3S2-F1-model_v4 ABC transporter ATP-binding protein 0.9808 1 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9768 2 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A521W3S2-F1-model_v4 ABC transporter ATP-binding protein 0.9767 1 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7T2SAA5-F1-model_v4 ABC transporter ATP-binding protein 0.9748 2 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A382XKN7-F1-model_v4 ABC transporter domain-containing protein 0.9733 4 215 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map