F287572

General Info

Members Datasets Scaffolds Average Seq Length
187 146 166 288

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10216528|Ga0105245_102165281
Length 317
Sequence MDNNIEEVTMEFAPEIDAPNPTPLKDLDEWEDFLKMRYPEGSQPGALGNADAHAEFIRADKKEEEFRDYRKEARASVKEFYRLNHTYQTFDFVQEKRREFLGLNRRKMGVWEAMEYLNQLVDDSDPDTDLSQLEHLLQTAESVRRDGHPGWMVLTGLIHDLGKILCLWGEPQWAVVGDTFPTGCKYSEKVVYPEFFDFNPDSNDAKLQTPCGVYEEGGGLDKVFMSWGHDEYLYHVTKDYLPDPALYMIRYHSFYAAHRERAYEHLMNAKDKEMFDWVRKFNPYDLYSKSDVPPNSKELRPYYESLIAEYFPPVLNW

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
3 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
6 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
7 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
8 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
9 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
10 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
11 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
12 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
13 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
14 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
15 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
16 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
17 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
18 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
135 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
136 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
143 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
145 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
146 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 1.07
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 0.53
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 18.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000072 3300002738 Bacteria 93790
2 JGI25157J39369_1004575 3300002741 Bacteria 2468
3 JGI25160J50197_1010291 3300003354 Bacteria 3393
4 Ga0065165_1039277 3300005262 Bacteria 1419
5 Ga0065714_10145875 3300005288 Bacteria 1139
6 Ga0065712_10217368 3300005290 Bacteria 1052
7 Ga0065715_10360404 3300005293 Bacteria 936
8 Ga0070658_10000043 3300005327 Bacteria 132337
9 Ga0070658_10000279 3300005327 Bacteria 44799
10 Ga0070676_10000002 3300005328 Bacteria 357662
11 Ga0070689_100002536 3300005340 Bacteria 11966
12 Ga0070661_100130794 3300005344 Bacteria 1885
13 Ga0070668_100126165 3300005347 Bacteria 2050
14 Ga0070674_100004998 3300005356 Bacteria 7606
15 Ga0070673_100029235 3300005364 Bacteria 4108
16 Ga0070688_100192483 3300005365 Bacteria 1422
17 Ga0070700_100199245 3300005441 Unclassified 1405
18 Ga0070694_100036824 3300005444 Bacteria 3243
19 Ga0070697_100398907 3300005536 Bacteria 1193
20 Ga0070686_100005554 3300005544 Bacteria 6977
21 Ga0070686_100011942 3300005544 Unclassified 4939
22 Ga0070695_100054782 3300005545 Bacteria 2568
23 Ga0070665_100256117 3300005548 Bacteria 1751
24 Ga0070704_100133582 3300005549 Eukaryota 1927
25 Ga0070702_100134751 3300005615 Bacteria 1565
26 Ga0081540_1003827 3300005983 Bacteria 11779
27 Ga0075436_100005615 3300006914 Bacteria 8608
28 Ga0105240_10000532 3300009093 Bacteria 70311
29 Ga0105240_10003797 3300009093 Bacteria 23330
30 Ga0105240_10016873 3300009093 Bacteria 9867
31 Ga0105240_10200182 3300009093 Bacteria 2341
32 Ga0105240_10638970 3300009093 Bacteria 1168
33 Ga0111539_10037717 3300009094 Bacteria 5834
34 Ga0111539_10231363 3300009094 Unclassified 2152
35 Ga0105245_10216528 3300009098 Unclassified 1846
36 Ga0114129_10323038 3300009147 Bacteria 2051
37 Ga0105241_10269763 3300009174 Unclassified 1449
38 Ga0105248_10078968 3300009177 Bacteria 3699
39 Ga0105248_10487715 3300009177 Unclassified 1389
40 Ga0105237_10001666 3300009545 Bacteria 28772
41 Ga0105237_10132182 3300009545 Unclassified 2490
42 Ga0105237_10269912 3300009545 Bacteria 1704
43 Ga0105238_10400449 3300009551 Unclassified 1366
44 Ga0105238_10512964 3300009551 Bacteria 1201
45 Ga0105249_10280211 3300009553 Unclassified 1664
46 Ga0105239_10013247 3300010375 Bacteria 9166
47 Ga0157373_10000001 3300013100 Bacteria 864756
48 Ga0157370_10000073 3300013104 Bacteria 109460
49 Ga0157370_10254935 3300013104 Bacteria 1622
50 Ga0157369_10010171 3300013105 Bacteria 10736
51 Ga0157369_10086445 3300013105 Bacteria 3349
52 Ga0157369_10219125 3300013105 Bacteria 1992
53 Ga0157374_10101564 3300013296 Bacteria 2757
54 Ga0157374_10177628 3300013296 Bacteria 2078
55 Ga0157378_10244462 3300013297 Bacteria 1716
56 Ga0157372_10171695 3300013307 Unclassified 2509
57 Ga0157372_10282556 3300013307 Bacteria 1930
58 Ga0157372_10625769 3300013307 Bacteria 1254
59 Ga0157375_10120995 3300013308 Bacteria 2727
60 Ga0163163_10197698 3300014325 Bacteria 2059
61 Ga0163163_10325054 3300014325 Unclassified 1592
62 Ga0157380_10377632 3300014326 Bacteria 1336
63 Ga0157377_10139857 3300014745 Bacteria 1487
64 Ga0157377_10234153 3300014745 Unclassified 1182
65 Ga0157376_10177940 3300014969 Unclassified 1942
66 Ga0182006_1000292 3300015261 Bacteria 44107
67 Ga0182006_1014683 3300015261 Bacteria 3372
68 Ga0163161_10000155 3300017792 Bacteria 63345
69 Ga0206349_1932901 3300020075 Bacteria 993
70 Ga0154015_1454391 3300020610 Bacteria 1489
71 Ga0213875_10000094 3300021388 Bacteria 102400
72 Ga0213875_10003034 3300021388 Bacteria 9736
73 Ga0209646_1000037 3300025246 Bacteria 355116
74 Ga0209026_1000860 3300025250 Bacteria 15846
75 Ga0207426_1000193 3300025302 Bacteria 151669
76 Ga0207688_10149555 3300025901 Bacteria 1378
77 Ga0207680_10000699 3300025903 Bacteria 15770
78 Ga0207645_10000002 3300025907 Bacteria 289099
79 Ga0207645_10022050 3300025907 Bacteria 4148
80 Ga0207705_10000034 3300025909 Bacteria 216943
81 Ga0207705_10000311 3300025909 Bacteria 44823
82 Ga0207695_10000407 3300025913 Bacteria 95753
83 Ga0207695_10005624 3300025913 Bacteria 16548
84 Ga0207695_10013318 3300025913 Bacteria 9812
85 Ga0207695_10208688 3300025913 Bacteria 1865
86 Ga0207671_10042025 3300025914 Bacteria 3384
87 Ga0207671_10164297 3300025914 Bacteria 1720
88 Ga0207657_10371811 3300025919 Bacteria 1126
89 Ga0207652_10413170 3300025921 Bacteria 1217
90 Ga0207694_10280380 3300025924 Unclassified 1369
91 Ga0207650_10287316 3300025925 Bacteria 1340
92 Ga0207659_10040332 3300025926 Unclassified 3264
93 Ga0207659_10246942 3300025926 Bacteria 1446
94 Ga0207690_10356178 3300025932 Bacteria 1158
95 Ga0207670_10020144 3300025936 Bacteria 4092
96 Ga0207669_10274243 3300025937 Bacteria 1268
97 Ga0207691_10021879 3300025940 Bacteria 6035
98 Ga0207691_10309597 3300025940 Bacteria 1356
99 Ga0207667_10521810 3300025949 Bacteria 1203
100 Ga0207651_10039838 3300025960 Bacteria 3102
101 Ga0207641_10427343 3300026088 Bacteria 1277
102 Ga0207674_10407547 3300026116 Bacteria 1314
103 Ga0207698_10394033 3300026142 Bacteria 1321
104 Ga0268266_10001046 3300028379 Bacteria 34719
105 Ga0268266_10293339 3300028379 Unclassified 1515
106 Ga0307515_10199229 3300028794 Bacteria 1884
107 Ga0307408_100001353 3300031548 Bacteria 18332
108 Ga0307413_10037692 3300031824 Bacteria 2794
109 Ga0307410_10000223 3300031852 Bacteria 21373
110 Ga0307406_10000114 3300031901 Bacteria 46700
111 Ga0307407_10012251 3300031903 Bacteria 4114
112 Ga0307409_100163553 3300031995 Bacteria 1950
113 Ga0307414_10000079 3300032004 Bacteria 90645
114 Ga0307411_10000011 3300032005 Bacteria 204666
115 Ga0307411_10098723 3300032005 Bacteria 2059
116 Ga0307510_10066542 3300033180 Bacteria 3637
117 Ga0373927_0006925 3300035695 Bacteria 7699
118 Ga0373927_0015411 3300035695 Bacteria 5052
119 Ga0373937_0109697 3300036401 Unclassified 2566
120 Ga0373925_0287783 3300037068 Bacteria 1324
121 Ga0395900_0002222 3300037418 Bacteria 21676
122 Ga0395900_0046006 3300037418 Bacteria 4495
123 Ga0395898_0005709 3300037466 Bacteria 13411
124 Ga0395898_0501599 3300037466 Bacteria 1154
125 Ga0395905_0003393 3300037471 Bacteria 17050
126 Ga0395905_0033106 3300037471 Bacteria 4858
127 Ga0436364_1064665 3300037853 Bacteria 3311
128 Ga0436364_1476447 3300037853 Bacteria 31338
129 Ga0436365_1709814 3300039437 Unclassified 2667
130 Ga0436363_0295773 3300039450 Bacteria 1022
131 Ga0439447_003076 3300041407 Bacteria 5955
132 Ga0439460_0037029 3300042461 Bacteria 1418
133 Ga0451576_0019650 3300045051 Bacteria 7372
134 Ga0495580_0214254 3300046472 Bacteria 1324
135 Ga0495580_0384815 3300046472 Unclassified 947
136 Ga0495610_0125108 3300046512 Bacteria 1122
137 Ga0495645_0042822 3300046543 Bacteria 3302
138 Ga0495625_0252962 3300046660 Bacteria 1143
139 Ga0495671_0097976 3300046692 Bacteria 1434
140 Ga0495684_0004388 3300047471 Bacteria 11027
141 Ga0496112_0285491 3300048915 Unclassified 1597
142 Ga0496116_0000032 3300048919 Bacteria 419997
143 Ga0496118_0143003 3300048921 Bacteria 1512
144 Ga0496121_0040442 3300048924 Bacteria 4090
145 Ga0496124_0009820 3300048927 Bacteria 9789
146 Ga0496124_0369150 3300048927 Bacteria 1008
147 Ga0496125_0000111 3300048928 Bacteria 191489
148 Ga0496126_0000792 3300048929 Bacteria 56862
149 Ga0501034_0443419 3300049571 Bacteria 1217
150 Ga0501034_0696475 3300049571 Bacteria 915
151 Ga0501041_0210517 3300049577 Bacteria 1219
152 Ga0501075_0098992 3300049591 Bacteria 2214
153 Ga0501238_001008 3300049671 Bacteria 3213
154 Ga0501249_000005 3300049679 Bacteria 225972
155 Ga0501249_001259 3300049679 Bacteria 5316
156 Ga0501241_006843 3300049758 Bacteria 2096
157 Ga0501266_000006 3300049763 Bacteria 312183
158 Ga0501280_000900 3300049776 Bacteria 6356
159 Ga0501035_0237926 3300049822 Bacteria 1550
160 nmdc:mga08x19_17303_c1 3300050514 Bacteria 4410
161 Ga0495595_0087131 3300053084 Bacteria 1495
162 Ga0500644_0018423 3300053088 Bacteria 2045
163 Ga0500641_0000013 3300053096 Bacteria 156919
164 Ga0500641_0000117 3300053096 Bacteria 30553
165 Ga0500655_031320 3300053133 Bacteria 1025
166 Ga0500658_0000007 3300053134 Bacteria 284115

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10254935 Ga0157370_102549352 252
2 3300049577 Ga0501041_0210517 Ga0501041_0210517_384_1175 259
3 3300049591 Ga0501075_0098992 Ga0501075_0098992_1345_2136 259
4 3300005615 Ga0070702_100134751 Ga0070702_1001347512 261
5 3300025907 Ga0207645_10022050 Ga0207645_100220502 262
6 3300053133 Ga0500655_031320 Ga0500655_031320_157_975 263
7 3300005290 Ga0065712_10217368 Ga0065712_102173681 266
8 3300005293 Ga0065715_10360404 Ga0065715_103604041 266
9 3300005347 Ga0070668_100126165 Ga0070668_1001261652 266
10 3300005356 Ga0070674_100004998 Ga0070674_1000049984 266
11 3300025901 Ga0207688_10149555 Ga0207688_101495552 266
12 3300025919 Ga0207657_10371811 Ga0207657_103718111 266
13 3300025937 Ga0207669_10274243 Ga0207669_102742431 266
14 3300025940 Ga0207691_10309597 Ga0207691_103095972 266
15 3300009551 Ga0105238_10512964 Ga0105238_105129641 267
16 3300025903 Ga0207680_10000699 Ga0207680_1000069911 267
17 3300005328 Ga0070676_10000002 Ga0070676_10000002235 269
18 3300025907 Ga0207645_10000002 Ga0207645_10000002164 269
19 3300009093 Ga0105240_10016873 Ga0105240_100168735 270
20 3300013297 Ga0157378_10244462 Ga0157378_102444621 270
21 3300025913 Ga0207695_10013318 Ga0207695_100133188 270
22 3300028379 Ga0268266_10001046 Ga0268266_100010467 270
23 3300005327 Ga0070658_10000043 Ga0070658_1000004348 272
24 3300009174 Ga0105241_10269763 Ga0105241_102697632 272
25 3300009177 Ga0105248_10487715 Ga0105248_104877152 272
26 3300009545 Ga0105237_10132182 Ga0105237_101321822 272
27 3300009553 Ga0105249_10280211 Ga0105249_102802112 272
28 3300013105 Ga0157369_10219125 Ga0157369_102191252 272
29 3300013296 Ga0157374_10177628 Ga0157374_101776282 272
30 3300013307 Ga0157372_10171695 Ga0157372_101716953 272
31 3300014325 Ga0163163_10325054 Ga0163163_103250542 272
32 3300014745 Ga0157377_10234153 Ga0157377_102341531 272
33 3300014969 Ga0157376_10177940 Ga0157376_101779402 272
34 3300020610 Ga0154015_1454391 Ga0154015_14543912 272
35 3300025909 Ga0207705_10000034 Ga0207705_10000034140 272
36 3300025921 Ga0207652_10413170 Ga0207652_104131701 272
37 3300025932 Ga0207690_10356178 Ga0207690_103561781 272
38 3300048915 Ga0496112_0285491 Ga0496112_0285491_764_1582 272
39 3300053084 Ga0495595_0087131 Ga0495595_0087131_645_1463 272
40 3300005983 Ga0081540_1003827 Ga0081540_10038274 274
41 3300046543 Ga0495645_0042822 Ga0495645_0042822_817_1644 275
42 3300042461 Ga0439460_0037029 Ga0439460_0037029_482_1321 276
43 3300005548 Ga0070665_100256117 Ga0070665_1002561172 277
44 3300025913 Ga0207695_10208688 Ga0207695_102086882 277
45 3300028379 Ga0268266_10293339 Ga0268266_102933391 277
46 3300039450 Ga0436363_0295773 Ga0436363_0295773_19_906 277
47 3300009093 Ga0105240_10638970 Ga0105240_106389701 278
48 3300035695 Ga0373927_0015411 Ga0373927_0015411_102_938 278
49 3300039437 Ga0436365_1709814 Ga0436365_1709814_1209_2045 278
50 3300046472 Ga0495580_0384815 Ga0495580_0384815_98_934 278
51 3300006914 Ga0075436_100005615 Ga0075436_1000056154 279
52 3300009093 Ga0105240_10000532 Ga0105240_1000053227 279
53 3300035695 Ga0373927_0006925 Ga0373927_0006925_2191_3030 279
54 3300046472 Ga0495580_0214254 Ga0495580_0214254_168_1007 279
55 3300050514 nmdc:mga08x19_17303_c1 nmdc:mga08x19_17303_c1_3052_3891 279
56 3300037471 Ga0395905_0003393 Ga0395905_0003393_15827_16672 281
57 3300009093 Ga0105240_10003797 Ga0105240_100037977 283
58 3300009545 Ga0105237_10001666 Ga0105237_1000166626 283
59 3300021388 Ga0213875_10003034 Ga0213875_100030343 283
60 3300025913 Ga0207695_10005624 Ga0207695_100056244 283
61 3300025914 Ga0207671_10042025 Ga0207671_100420253 283
62 3300037418 Ga0395900_0002222 Ga0395900_0002222_15907_16764 283
63 3300037466 Ga0395898_0005709 Ga0395898_0005709_10575_11432 283
64 3300037853 Ga0436364_1476447 Ga0436364_1476447_16539_17396 283
65 3300049571 Ga0501034_0696475 Ga0501034_0696475_29_892 283
66 3300049822 Ga0501035_0237926 Ga0501035_0237926_49_912 283
67 3300009147 Ga0114129_10323038 Ga0114129_103230381 285
68 3300013308 Ga0157375_10120995 Ga0157375_101209952 285
69 3300014325 Ga0163163_10197698 Ga0163163_101976983 285
70 iso_pu_bacteria 2513020052 2513233796 285
71 iso_pu_bacteria 2643221600 2644008829 285
72 iso_pu_bacteria 2643221667 2644372677 285
73 iso_pu_bacteria 2643221725 2644683191 285
74 iso_pu_bacteria 2738541279 2738736929 285
75 iso_pu_bacteria 2738541285 2738769493 285
76 iso_pu_bacteria 2738543007 2739218511 285
77 iso_pu_bacteria 2739367857 2740001463 285
78 iso_pu_bacteria 2739367858 2740006279 285
79 iso_pu_bacteria 2802428842 2802652919 285
80 iso_pu_bacteria 2833640130 2833642594 285
81 iso_pu_bacteria 2857613821 2857616867 285
82 iso_pu_bacteria 2857618242 2857620698 285
83 iso_pu_bacteria 2904419702 2904421208 285
84 iso_pu_bacteria 2919683626 2919687369 285
85 iso_pu_bacteria 2929150217 2929152374 285
86 iso_pu_bacteria 2977268062 2977270980 285
87 iso_pu_bacteria 8054307821 8054310644 285
88 iso_pu_bacteria 8055592153 8055595603 285
89 3300005327 Ga0070658_10000279 Ga0070658_1000027922 286
90 3300009551 Ga0105238_10400449 Ga0105238_104004491 286
91 3300010375 Ga0105239_10013247 Ga0105239_100132478 286
92 3300013296 Ga0157374_10101564 Ga0157374_101015642 286
93 3300025909 Ga0207705_10000311 Ga0207705_1000031122 286
94 3300025924 Ga0207694_10280380 Ga0207694_102803801 286
95 3300005288 Ga0065714_10145875 Ga0065714_101458752 287
96 3300005340 Ga0070689_100002536 Ga0070689_1000025363 287
97 3300005365 Ga0070688_100192483 Ga0070688_1001924831 287
98 3300005441 Ga0070700_100199245 Ga0070700_1001992451 287
99 3300005444 Ga0070694_100036824 Ga0070694_1000368242 287
100 3300005544 Ga0070686_100005554 Ga0070686_1000055543 287
101 3300005544 Ga0070686_100011942 Ga0070686_1000119422 287
102 3300005545 Ga0070695_100054782 Ga0070695_1000547822 287
103 3300005549 Ga0070704_100133582 Ga0070704_1001335822 287
104 3300009093 Ga0105240_10200182 Ga0105240_102001823 287
105 3300009094 Ga0111539_10037717 Ga0111539_100377175 287
106 3300009094 Ga0111539_10231363 Ga0111539_102313632 287
107 3300009177 Ga0105248_10078968 Ga0105248_100789685 287
108 3300009545 Ga0105237_10269912 Ga0105237_102699122 287
109 3300013100 Ga0157373_10000001 Ga0157373_10000001698 287
110 3300013104 Ga0157370_10000073 Ga0157370_1000007350 287
111 3300013105 Ga0157369_10010171 Ga0157369_100101712 287
112 3300013105 Ga0157369_10086445 Ga0157369_100864452 287
113 3300013307 Ga0157372_10282556 Ga0157372_102825562 287
114 3300014745 Ga0157377_10139857 Ga0157377_101398572 287
115 3300015261 Ga0182006_1000292 Ga0182006_100029213 287
116 3300015261 Ga0182006_1014683 Ga0182006_10146832 287
117 3300017792 Ga0163161_10000155 Ga0163161_100001557 287
118 3300020075 Ga0206349_1932901 Ga0206349_19329011 287
119 3300025913 Ga0207695_10000407 Ga0207695_1000040754 287
120 3300025914 Ga0207671_10164297 Ga0207671_101642972 287
121 3300025926 Ga0207659_10246942 Ga0207659_102469421 287
122 3300025936 Ga0207670_10020144 Ga0207670_100201441 287
123 3300025949 Ga0207667_10521810 Ga0207667_105218101 287
124 3300026088 Ga0207641_10427343 Ga0207641_104273431 287
125 3300028794 Ga0307515_10199229 Ga0307515_101992292 287
126 3300031548 Ga0307408_100001353 Ga0307408_1000013534 287
127 3300031824 Ga0307413_10037692 Ga0307413_100376922 287
128 3300031852 Ga0307410_10000223 Ga0307410_100002238 287
129 3300031901 Ga0307406_10000114 Ga0307406_1000011431 287
130 3300031903 Ga0307407_10012251 Ga0307407_100122512 287
131 3300032004 Ga0307414_10000079 Ga0307414_1000007965 287
132 3300032005 Ga0307411_10000011 Ga0307411_10000011128 287
133 3300032005 Ga0307411_10098723 Ga0307411_100987232 287
134 3300033180 Ga0307510_10066542 Ga0307510_100665422 287
135 3300037068 Ga0373925_0287783 Ga0373925_0287783_336_1241 287
136 3300037418 Ga0395900_0046006 Ga0395900_0046006_2472_3377 287
137 3300037471 Ga0395905_0033106 Ga0395905_0033106_1755_2660 287
138 3300037853 Ga0436364_1064665 Ga0436364_1064665_1558_2445 287
139 3300041407 Ga0439447_003076 Ga0439447_003076_1223_2101 287
140 3300045051 Ga0451576_0019650 Ga0451576_0019650_2246_3160 287
141 3300046512 Ga0495610_0125108 Ga0495610_0125108_76_948 287
142 3300046660 Ga0495625_0252962 Ga0495625_0252962_86_964 287
143 3300046692 Ga0495671_0097976 Ga0495671_0097976_532_1404 287
144 3300048919 Ga0496116_0000032 Ga0496116_0000032_281256_282143 287
145 3300048921 Ga0496118_0143003 Ga0496118_0143003_536_1423 287
146 3300048924 Ga0496121_0040442 Ga0496121_0040442_786_1673 287
147 3300048927 Ga0496124_0009820 Ga0496124_0009820_4235_5122 287
148 3300048927 Ga0496124_0369150 Ga0496124_0369150_22_900 287
149 3300048928 Ga0496125_0000111 Ga0496125_0000111_164074_164961 287
150 3300048929 Ga0496126_0000792 Ga0496126_0000792_54113_55000 287
151 3300049571 Ga0501034_0443419 Ga0501034_0443419_186_1073 287
152 3300049671 Ga0501238_001008 Ga0501238_001008_2029_2907 287
153 3300049679 Ga0501249_000005 Ga0501249_000005_56480_57352 287
154 3300049679 Ga0501249_001259 Ga0501249_001259_3841_4719 287
155 3300049758 Ga0501241_006843 Ga0501241_006843_1159_2037 287
156 3300049763 Ga0501266_000006 Ga0501266_000006_185291_186169 287
157 3300049776 Ga0501280_000900 Ga0501280_000900_1805_2683 287
158 3300053088 Ga0500644_0018423 Ga0500644_0018423_302_1174 287
159 3300053096 Ga0500641_0000013 Ga0500641_0000013_76428_77300 287
160 3300053096 Ga0500641_0000117 Ga0500641_0000117_26266_27138 287
161 3300053134 Ga0500658_0000007 Ga0500658_0000007_103648_104526 287
162 3300005536 Ga0070697_100398907 Ga0070697_1003989072 288
163 3300013307 Ga0157372_10625769 Ga0157372_106257691 288
164 3300014326 Ga0157380_10377632 Ga0157380_103776321 289
165 iso_pu_bacteria 2929921140 2929925990 289
166 iso_pu_bacteria 8003151029 8003153054 289
167 3300005344 Ga0070661_100130794 Ga0070661_1001307944 290
168 3300005364 Ga0070673_100029235 Ga0070673_1000292352 290
169 3300025925 Ga0207650_10287316 Ga0207650_102873161 290
170 3300025926 Ga0207659_10040332 Ga0207659_100403322 290
171 3300025940 Ga0207691_10021879 Ga0207691_100218794 290
172 3300025960 Ga0207651_10039838 Ga0207651_100398382 290
173 3300026116 Ga0207674_10407547 Ga0207674_104075472 290
174 3300031995 Ga0307409_100163553 Ga0307409_1001635532 290
175 3300021388 Ga0213875_10000094 Ga0213875_1000009443 291
176 3300026142 Ga0207698_10394033 Ga0207698_103940331 291
177 3300037466 Ga0395898_0501599 Ga0395898_0501599_110_1033 291
178 3300036401 Ga0373937_0109697 Ga0373937_0109697_1080_1967 292
179 3300047471 Ga0495684_0004388 Ga0495684_0004388_7835_8722 292
180 3300002738 JGI25154J39366_1000072 JGI25154J39366_100007235 293
181 3300002741 JGI25157J39369_1004575 JGI25157J39369_10045753 293
182 3300003354 JGI25160J50197_1010291 JGI25160J50197_10102913 293
183 3300005262 Ga0065165_1039277 Ga0065165_10392772 293
184 3300009098 Ga0105245_10216528 Ga0105245_102165281 293
185 3300025246 Ga0209646_1000037 Ga0209646_1000037263 293
186 3300025250 Ga0209026_1000860 Ga0209026_10008606 293
187 3300025302 Ga0207426_1000193 Ga0207426_1000193104 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05153

MIOX

Myo-inositol oxygenase

74

317

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.968 43 293
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9468 51 293
2ibn-assembly2.cif.gz_B crystal structure of human myo-inositol oxygenase (miox) 0.9399 51 293
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.9387 43 293
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9352 51 293
ID Description Score Start End Superfamily
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9771 51 293 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9759 51 293 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9502 51 293 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9379 51 293 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5154 86 284 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2W0BBD3-F1-model_v4 Inositol oxygenase 0.9904 111 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A2N1MRT8-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9878 84 291 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A1Q2YFQ0-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9877 109 288 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A4S4KQN7-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9869 109 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A3B8U6H5-F1-model_v4 Inositol oxygenase 0.9856 67 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113

Feature Viewer

pLDDT pTM Quality
84.62 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map