F286184

General Info

Members Datasets Scaffolds Average Seq Length
186 112 183 428

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1003206|Ga0265337_10032066
Length 471
Sequence LTRSPTKKREGSGHASRERRRAVVLHVARKSGAAPDAIRSSRSEQSRLDEAIALTGAIGLDVAEGVIANIARATPATLIGSGKVEEIKALCNAVEPEVVIVNAQLSPVQQRNLEKAWGTKVLDRTALILEIFGERARTREGRLQVELAHLTYQRSRLVRSWTHLERQRGGFGFLGGPGETQIETDRRLIGERIAKIKRELEDVKRTRGLHRRARKKVPYPVVALVGYTNAGKSTLFNRLTSAEVLAKDMLFATLDPTMRGLKLSSGRRVILSDTVGFIADLPVELVAAFRATLEEVLEADIVVHVRDAAHDESEAQKADVQKVLAELGVKEDGRAGIEVLNKIDLLEPDVRAAMLARNRVAPRLVSSGQAGGGEQIAVSAITGEGLDALVQSIDRLLGSQDLTMRLALTPDDGAGLAWAHAHGRVLERRDTDKVVYLVIAGDDSAVDRFTQRFPGKLTIIEPDQRRRAISS

Samples

Sample ID Description Type Environment
1 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
2 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 0
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000231 3300001904 Bacteria 10126
2 JGI24740J21852_10004395 3300001979 Bacteria 6062
3 JGI24737J22298_10000089 3300001990 Bacteria 27032
4 JGI25406J46586_10000221 3300003203 Bacteria 25171
5 JGI25165J46597_1001751 3300003214 Bacteria 9476
6 Ga0070658_10000505 3300005327 Bacteria 33825
7 Ga0070660_100000039 3300005339 Bacteria 76157
8 Ga0070660_100001500 3300005339 Bacteria 15992
9 Ga0070660_100019832 3300005339 Bacteria 4933
10 Ga0070691_10000866 3300005341 Bacteria 12258
11 Ga0070661_100003178 3300005344 Bacteria 11318
12 Ga0070692_10007610 3300005345 Bacteria 4782
13 Ga0070692_10026098 3300005345 Bacteria 2885
14 Ga0070709_10006975 3300005434 Bacteria 6170
15 Ga0070713_100000044 3300005436 Bacteria 78106
16 Ga0070710_10137164 3300005437 Bacteria 1497
17 Ga0070705_100025612 3300005440 Bacteria 3200
18 Ga0070663_100008010 3300005455 Bacteria 6475
19 Ga0070663_100011800 3300005455 Bacteria 5502
20 Ga0070663_100044436 3300005455 Bacteria 3132
21 Ga0070681_10066832 3300005458 Bacteria 3564
22 Ga0068853_100001346 3300005539 Bacteria 17708
23 Ga0068855_100000135 3300005563 Bacteria 94502
24 Ga0068855_100023931 3300005563 Bacteria 7314
25 Ga0068855_100111031 3300005563 Bacteria 3147
26 Ga0068855_100251380 3300005563 Bacteria 1972
27 Ga0068855_100339596 3300005563 Bacteria 1656
28 Ga0068857_100000031 3300005577 Bacteria 75513
29 Ga0068857_100034325 3300005577 Bacteria 4487
30 Ga0068854_100002608 3300005578 Bacteria 11175
31 Ga0068854_100039012 3300005578 Bacteria 3343
32 Ga0068856_100002408 3300005614 Bacteria 19253
33 Ga0068856_100010774 3300005614 Bacteria 8879
34 Ga0068852_100002278 3300005616 Bacteria 13189
35 Ga0068858_100090542 3300005842 Bacteria 2847
36 Ga0081539_10000076 3300005985 Bacteria 229037
37 Ga0075365_10117470 3300006038 Bacteria 1832
38 Ga0070712_100000037 3300006175 Bacteria 67430
39 Ga0070712_100000058 3300006175 Bacteria 56442
40 Ga0075431_100026197 3300006847 Bacteria 5981
41 Ga0075436_100000558 3300006914 Bacteria 24300
42 Ga0105240_10006089 3300009093 Bacteria 17805
43 Ga0105240_10057615 3300009093 Bacteria 4853
44 Ga0111539_10046778 3300009094 Bacteria 5174
45 Ga0105238_10002095 3300009551 Bacteria 20151
46 Ga0157373_10142601 3300013100 Bacteria 1685
47 Ga0157371_10002068 3300013102 Bacteria 19673
48 Ga0157371_10004826 3300013102 Bacteria 11596
49 Ga0157371_10005773 3300013102 Bacteria 10367
50 Ga0157371_10101502 3300013102 Bacteria 2041
51 Ga0157370_10015304 3300013104 Bacteria 7803
52 Ga0157370_10089417 3300013104 Bacteria 2893
53 Ga0157370_10133026 3300013104 Bacteria 2319
54 Ga0157369_10000298 3300013105 Bacteria 66393
55 Ga0157369_10004587 3300013105 Bacteria 16237
56 Ga0157369_10027270 3300013105 Bacteria 6334
57 Ga0157369_10179906 3300013105 Bacteria 2225
58 Ga0157374_10001130 3300013296 Bacteria 22903
59 Ga0157380_10012472 3300014326 Bacteria 6166
60 Ga0207427_102230 3300025231 Bacteria 5468
61 Ga0209233_1000401 3300025261 Bacteria 35524
62 Ga0207647_10010353 3300025904 Bacteria 6585
63 Ga0207647_10028683 3300025904 Bacteria 3612
64 Ga0207699_10003589 3300025906 Bacteria 7418
65 Ga0207705_10000050 3300025909 Bacteria 170078
66 Ga0207705_10000070 3300025909 Bacteria 130733
67 Ga0207705_10000386 3300025909 Bacteria 39450
68 Ga0207705_10005712 3300025909 Bacteria 9292
69 Ga0207695_10004765 3300025913 Bacteria 18346
70 Ga0207695_10251124 3300025913 Bacteria 1668
71 Ga0207693_10000135 3300025915 Bacteria 67093
72 Ga0207663_10016995 3300025916 Bacteria 4045
73 Ga0207657_10000020 3300025919 Bacteria 157826
74 Ga0207657_10000101 3300025919 Bacteria 82962
75 Ga0207657_10000923 3300025919 Bacteria 31101
76 Ga0207657_10003397 3300025919 Bacteria 17017
77 Ga0207657_10056655 3300025919 Bacteria 3380
78 Ga0207649_10000160 3300025920 Bacteria 54640
79 Ga0207681_10105782 3300025923 Bacteria 2038
80 Ga0207694_10043603 3300025924 Bacteria 3463
81 Ga0207700_10000017 3300025928 Bacteria 195983
82 Ga0207644_10112371 3300025931 Bacteria 2062
83 Ga0207665_10046757 3300025939 Bacteria 2900
84 Ga0207661_10019801 3300025944 Bacteria 5022
85 Ga0207667_10021043 3300025949 Bacteria 7234
86 Ga0207667_10058896 3300025949 Bacteria 4026
87 Ga0207640_10000594 3300025981 Bacteria 21529
88 Ga0207640_10128366 3300025981 Bacteria 1829
89 Ga0207639_10003033 3300026041 Bacteria 11311
90 Ga0207678_10000908 3300026067 Bacteria 27102
91 Ga0207678_10005029 3300026067 Bacteria 11863
92 Ga0207678_10005405 3300026067 Bacteria 11442
93 Ga0207678_10006350 3300026067 Bacteria 10494
94 Ga0207702_10000035 3300026078 Bacteria 158744
95 Ga0207702_10019017 3300026078 Bacteria 5683
96 Ga0207702_10021628 3300026078 Bacteria 5326
97 Ga0207674_10000003 3300026116 Bacteria 241674
98 Ga0207674_10002143 3300026116 Bacteria 24953
99 Ga0207674_10116434 3300026116 Bacteria 2644
100 Ga0207698_10001848 3300026142 Bacteria 12361
101 Ga0207698_10024791 3300026142 Bacteria 4216
102 Ga0265337_1003206 3300028556 Bacteria 7166
103 Ga0265334_10000872 3300028573 Bacteria 15109
104 Ga0265338_10006580 3300028800 Bacteria 14740
105 Ga0265338_10011529 3300028800 Bacteria 10196
106 Ga0265320_10002130 3300031240 Bacteria 13888
107 Ga0265325_10001254 3300031241 Bacteria 18106
108 Ga0265325_10015093 3300031241 Bacteria 4354
109 Ga0265339_10021260 3300031249 Bacteria 3778
110 Ga0265331_10000054 3300031250 Bacteria 180181
111 Ga0265327_10000179 3300031251 Bacteria 135005
112 Ga0265316_10042716 3300031344 Bacteria 3621
113 Ga0307408_100108505 3300031548 Bacteria 2128
114 Ga0265313_10017017 3300031595 Bacteria 4153
115 Ga0265313_10024451 3300031595 Bacteria 3226
116 Ga0265314_10038681 3300031711 Bacteria 3443
117 Ga0265314_10053504 3300031711 Bacteria 2799
118 Ga0307405_10079780 3300031731 Bacteria 2135
119 Ga0307413_10004305 3300031824 Bacteria 6173
120 Ga0307413_10028416 3300031824 Bacteria 3114
121 Ga0307410_10016460 3300031852 Bacteria 4410
122 Ga0307410_10044676 3300031852 Bacteria 2944
123 Ga0307410_10079014 3300031852 Bacteria 2304
124 Ga0307410_10101743 3300031852 Bacteria 2060
125 Ga0307407_10006813 3300031903 Bacteria 5120
126 Ga0307407_10013915 3300031903 Bacteria 3921
127 Ga0307412_10065499 3300031911 Bacteria 2459
128 Ga0307412_10142734 3300031911 Bacteria 1756
129 Ga0307409_100047791 3300031995 Bacteria 3251
130 Ga0307409_100070067 3300031995 Bacteria 2782
131 Ga0307416_100167101 3300032002 Bacteria 2042
132 Ga0307416_100210455 3300032002 Bacteria 1854
133 Ga0307414_10001464 3300032004 Bacteria 12269
134 Ga0307411_10000729 3300032005 Bacteria 12120
135 Ga0307411_10000971 3300032005 Bacteria 10993
136 Ga0307411_10027595 3300032005 Bacteria 3438
137 Ga0307411_10110657 3300032005 Bacteria 1965
138 Ga0307411_10126450 3300032005 Bacteria 1860
139 Ga0373961_0028833 3300035241 Bacteria 1533
140 Ga0373933_0009318 3300035724 Bacteria 5362
141 Ga0373937_0045793 3300036401 Bacteria 3998
142 Ga0373925_0003173 3300037068 Bacteria 12858
143 Ga0373925_0058969 3300037068 Bacteria 2878
144 Ga0395899_0001091 3300037312 Bacteria 24377
145 Ga0395899_0007617 3300037312 Bacteria 8351
146 Ga0395899_0021568 3300037312 Bacteria 4884
147 Ga0395900_0000136 3300037418 Bacteria 123664
148 Ga0395900_0039133 3300037418 Bacteria 4886
149 Ga0395900_0039561 3300037418 Bacteria 4858
150 Ga0395900_0068576 3300037418 Bacteria 3645
151 Ga0395900_0096074 3300037418 Bacteria 3044
152 Ga0395900_0141511 3300037418 Bacteria 2463
153 Ga0395898_0022594 3300037466 Bacteria 6369
154 Ga0395898_0064292 3300037466 Bacteria 3558
155 Ga0395898_0200964 3300037466 Bacteria 1903
156 Ga0395905_0075022 3300037471 Bacteria 3169
157 Ga0395905_0105440 3300037471 Bacteria 2647
158 Ga0436364_1447762 3300037853 Bacteria 1127
159 Ga0395901_0000030 3300038443 Bacteria 241916
160 Ga0395901_0009349 3300038443 Bacteria 9940
161 Ga0395901_0039909 3300038443 Bacteria 4859
162 Ga0395901_0120233 3300038443 Bacteria 2761
163 Ga0451577_0155950 3300042876 Bacteria 2055
164 Ga0466969_0054639 3300044656 Bacteria 1955
165 Ga0466966_0000027 3300044684 Bacteria 106520
166 Ga0453684_0000031 3300044712 Bacteria 752632
167 Ga0453684_0033883 3300044712 Bacteria 7105
168 Ga0466971_0020407 3300044719 Bacteria 2946
169 Ga0466957_0007761 3300044842 Bacteria 6072
170 Ga0466958_0000759 3300045836 Bacteria 14160
171 Ga0495651_0131798 3300046462 Bacteria 1824
172 Ga0495586_0044555 3300046535 Bacteria 2390
173 Ga0495672_0002467 3300047320 Bacteria 17008
174 Ga0501040_0073723 3300049576 Bacteria 2359
175 Ga0501047_0039379 3300049581 Bacteria 4572
176 Ga0501047_0226350 3300049581 Bacteria 1725
177 Ga0501077_0010487 3300049593 Bacteria 5768
178 Ga0501079_0018028 3300049741 Bacteria 5391
179 Ga0501080_0022741 3300049742 Bacteria 5808
180 Ga0501080_0164993 3300049742 Bacteria 2044
181 Ga0501044_0000116 3300049823 Bacteria 96626
182 nmdc:mga08x19_561_c1 3300050514 Bacteria 24307
183 Ga0501084_0001058 3300054114 Bacteria 21381

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1447762 Ga0436364_1447762_20_1114 362
2 3300014326 Ga0157380_10012472 Ga0157380_100124726 365
3 3300047320 Ga0495672_0002467 Ga0495672_0002467_12816_14039 370
4 3300005539 Ga0068853_100001346 Ga0068853_10000134612 374
5 3300026041 Ga0207639_10003033 Ga0207639_100030335 374
6 3300026116 Ga0207674_10002143 Ga0207674_1000214314 374
7 3300005339 Ga0070660_100001500 Ga0070660_1000015003 375
8 3300005341 Ga0070691_10000866 Ga0070691_100008665 375
9 3300025909 Ga0207705_10000386 Ga0207705_1000038614 375
10 3300025919 Ga0207657_10000101 Ga0207657_1000010122 375
11 3300037068 Ga0373925_0003173 Ga0373925_0003173_7729_8886 378
12 3300001990 JGI24737J22298_10000089 JGI24737J22298_1000008924 380
13 3300046462 Ga0495651_0131798 Ga0495651_0131798_310_1506 381
14 3300031548 Ga0307408_100108505 Ga0307408_1001085052 382
15 3300031731 Ga0307405_10079780 Ga0307405_100797802 382
16 3300031852 Ga0307410_10079014 Ga0307410_100790142 382
17 3300031250 Ga0265331_10000054 Ga0265331_10000054182 387
18 3300031711 Ga0265314_10053504 Ga0265314_100535042 387
19 3300044712 Ga0453684_0033883 Ga0453684_0033883_1201_2469 388
20 3300003203 JGI25406J46586_10000221 JGI25406J46586_1000022125 389
21 3300005985 Ga0081539_10000076 Ga0081539_10000076186 389
22 3300031251 Ga0265327_10000179 Ga0265327_10000179109 392
23 iso_pu_bacteria 2883577096 2883580488 397
24 3300031240 Ga0265320_10002130 Ga0265320_1000213012 398
25 3300031241 Ga0265325_10015093 Ga0265325_100150935 398
26 3300031995 Ga0307409_100070067 Ga0307409_1000700673 402
27 3300032005 Ga0307411_10126450 Ga0307411_101264502 402
28 3300026116 Ga0207674_10116434 Ga0207674_101164342 408
29 3300031824 Ga0307413_10028416 Ga0307413_100284162 411
30 3300031903 Ga0307407_10006813 Ga0307407_100068133 411
31 3300031995 Ga0307409_100047791 Ga0307409_1000477913 411
32 3300032002 Ga0307416_100167101 Ga0307416_1001671012 411
33 3300032005 Ga0307411_10000729 Ga0307411_1000072912 411
34 3300032005 Ga0307411_10110657 Ga0307411_101106572 411
35 3300037471 Ga0395905_0105440 Ga0395905_0105440_805_2040 411
36 3300046535 Ga0495586_0044555 Ga0495586_0044555_403_1707 411
37 3300049741 Ga0501079_0018028 Ga0501079_0018028_3347_4834 411
38 3300025923 Ga0207681_10105782 Ga0207681_101057822 413
39 3300026067 Ga0207678_10006350 Ga0207678_100063509 413
40 3300031852 Ga0307410_10016460 Ga0307410_100164602 414
41 3300049581 Ga0501047_0226350 Ga0501047_0226350_224_1489 414
42 3300049742 Ga0501080_0022741 Ga0501080_0022741_2627_3892 414
43 iso_pu_bacteria 2929199973 2929203577 414
44 3300005458 Ga0070681_10066832 Ga0070681_100668322 415
45 3300005563 Ga0068855_100111031 Ga0068855_1001110312 415
46 3300005577 Ga0068857_100000031 Ga0068857_10000003176 415
47 3300005614 Ga0068856_100002408 Ga0068856_10000240825 415
48 3300005842 Ga0068858_100090542 Ga0068858_1000905423 415
49 3300009551 Ga0105238_10002095 Ga0105238_1000209517 415
50 3300013104 Ga0157370_10015304 Ga0157370_100153046 415
51 3300013105 Ga0157369_10179906 Ga0157369_101799062 415
52 3300025924 Ga0207694_10043603 Ga0207694_100436032 415
53 3300026116 Ga0207674_10000003 Ga0207674_10000003180 415
54 3300028573 Ga0265334_10000872 Ga0265334_1000087213 415
55 3300028800 Ga0265338_10011529 Ga0265338_100115295 415
56 3300031241 Ga0265325_10001254 Ga0265325_100012544 415
57 3300031249 Ga0265339_10021260 Ga0265339_100212604 415
58 3300031344 Ga0265316_10042716 Ga0265316_100427163 415
59 3300031595 Ga0265313_10017017 Ga0265313_100170173 415
60 3300035724 Ga0373933_0009318 Ga0373933_0009318_2552_3835 415
61 3300035241 Ga0373961_0028833 Ga0373961_0028833_88_1455 416
62 3300005327 Ga0070658_10000505 Ga0070658_100005053 420
63 3300005434 Ga0070709_10006975 Ga0070709_100069752 420
64 3300005436 Ga0070713_100000044 Ga0070713_1000000441 420
65 3300005437 Ga0070710_10137164 Ga0070710_101371641 420
66 3300005440 Ga0070705_100025612 Ga0070705_1000256123 420
67 3300006175 Ga0070712_100000037 Ga0070712_10000003749 420
68 3300006175 Ga0070712_100000058 Ga0070712_1000000584 420
69 3300006914 Ga0075436_100000558 Ga0075436_10000055825 420
70 3300025904 Ga0207647_10010353 Ga0207647_100103534 420
71 3300025906 Ga0207699_10003589 Ga0207699_100035894 420
72 3300025909 Ga0207705_10000050 Ga0207705_10000050169 420
73 3300025915 Ga0207693_10000135 Ga0207693_1000013517 420
74 3300025916 Ga0207663_10016995 Ga0207663_100169954 420
75 3300025928 Ga0207700_10000017 Ga0207700_10000017143 420
76 3300025939 Ga0207665_10046757 Ga0207665_100467573 420
77 3300026078 Ga0207702_10000035 Ga0207702_10000035112 420
78 3300028800 Ga0265338_10006580 Ga0265338_100065804 420
79 3300031711 Ga0265314_10038681 Ga0265314_100386812 420
80 3300031911 Ga0307412_10065499 Ga0307412_100654993 420
81 3300036401 Ga0373937_0045793 Ga0373937_0045793_725_2026 420
82 3300037068 Ga0373925_0058969 Ga0373925_0058969_1105_2406 420
83 3300050514 nmdc:mga08x19_561_c1 nmdc:mga08x19_561_c1_22786_24087 420
84 3300006847 Ga0075431_100026197 Ga0075431_1000261974 421
85 3300031824 Ga0307413_10004305 Ga0307413_100043054 421
86 3300032004 Ga0307414_10001464 Ga0307414_100014646 421
87 3300032005 Ga0307411_10027595 Ga0307411_100275952 421
88 3300049576 Ga0501040_0073723 Ga0501040_0073723_369_1709 421
89 3300049593 Ga0501077_0010487 Ga0501077_0010487_3194_4534 421
90 3300049742 Ga0501080_0164993 Ga0501080_0164993_590_1930 421
91 3300054114 Ga0501084_0001058 Ga0501084_0001058_9438_10778 421
92 3300049581 Ga0501047_0039379 Ga0501047_0039379_2175_3545 426
93 iso_pu_bacteria 8055909800 8055911232 428
94 3300037466 Ga0395898_0200964 Ga0395898_0200964_276_1601 429
95 3300003214 JGI25165J46597_1001751 JGI25165J46597_10017515 433
96 3300025231 Ga0207427_102230 Ga0207427_1022304 433
97 3300025261 Ga0209233_1000401 Ga0209233_100040131 433
98 3300025931 Ga0207644_10112371 Ga0207644_101123711 433
99 3300032002 Ga0307416_100210455 Ga0307416_1002104552 433
100 3300028556 Ga0265337_1003206 Ga0265337_10032066 434
101 3300031595 Ga0265313_10024451 Ga0265313_100244513 434
102 3300031852 Ga0307410_10044676 Ga0307410_100446762 434
103 3300031852 Ga0307410_10101743 Ga0307410_101017432 434
104 3300031903 Ga0307407_10013915 Ga0307407_100139152 434
105 3300031911 Ga0307412_10142734 Ga0307412_101427342 434
106 3300032005 Ga0307411_10000971 Ga0307411_1000097111 434
107 3300049823 Ga0501044_0000116 Ga0501044_0000116_52832_54235 434
108 3300005339 Ga0070660_100000039 Ga0070660_10000003977 435
109 3300005339 Ga0070660_100019832 Ga0070660_1000198325 435
110 3300005345 Ga0070692_10007610 Ga0070692_100076103 435
111 3300005345 Ga0070692_10026098 Ga0070692_100260983 435
112 3300005455 Ga0070663_100011800 Ga0070663_1000118006 435
113 3300005563 Ga0068855_100000135 Ga0068855_1000001355 435
114 3300005563 Ga0068855_100251380 Ga0068855_1002513802 435
115 3300013102 Ga0157371_10004826 Ga0157371_100048267 435
116 3300013102 Ga0157371_10005773 Ga0157371_100057739 435
117 3300013104 Ga0157370_10089417 Ga0157370_100894173 435
118 3300025909 Ga0207705_10005712 Ga0207705_100057129 435
119 3300025919 Ga0207657_10000020 Ga0207657_10000020113 435
120 3300025919 Ga0207657_10000923 Ga0207657_1000092312 435
121 3300025919 Ga0207657_10056655 Ga0207657_100566552 435
122 3300025944 Ga0207661_10019801 Ga0207661_100198013 435
123 3300025949 Ga0207667_10021043 Ga0207667_100210435 435
124 3300026067 Ga0207678_10000908 Ga0207678_100009085 435
125 3300037312 Ga0395899_0001091 Ga0395899_0001091_7717_9027 435
126 3300037312 Ga0395899_0021568 Ga0395899_0021568_2824_4134 435
127 3300037418 Ga0395900_0000136 Ga0395900_0000136_68839_70149 435
128 3300037418 Ga0395900_0141511 Ga0395900_0141511_596_1906 435
129 3300037466 Ga0395898_0022594 Ga0395898_0022594_4728_6038 435
130 3300037466 Ga0395898_0064292 Ga0395898_0064292_952_2262 435
131 3300037471 Ga0395905_0075022 Ga0395905_0075022_751_2061 435
132 3300038443 Ga0395901_0000030 Ga0395901_0000030_209597_210907 435
133 3300038443 Ga0395901_0039909 Ga0395901_0039909_246_1556 435
134 3300038443 Ga0395901_0120233 Ga0395901_0120233_815_2125 435
135 3300042876 Ga0451577_0155950 Ga0451577_0155950_123_1442 435
136 3300044712 Ga0453684_0000031 Ga0453684_0000031_371786_373105 435
137 3300006038 Ga0075365_10117470 Ga0075365_101174702 436
138 3300009094 Ga0111539_10046778 Ga0111539_100467786 436
139 3300001904 JGI24736J21556_1000231 JGI24736J21556_10002313 438
140 3300001979 JGI24740J21852_10004395 JGI24740J21852_100043955 438
141 3300005344 Ga0070661_100003178 Ga0070661_1000031784 438
142 3300005455 Ga0070663_100008010 Ga0070663_1000080106 438
143 3300005455 Ga0070663_100044436 Ga0070663_1000444362 438
144 3300005563 Ga0068855_100023931 Ga0068855_1000239314 438
145 3300005563 Ga0068855_100339596 Ga0068855_1003395962 438
146 3300005577 Ga0068857_100034325 Ga0068857_1000343254 438
147 3300005578 Ga0068854_100002608 Ga0068854_10000260810 438
148 3300005578 Ga0068854_100039012 Ga0068854_1000390121 438
149 3300005614 Ga0068856_100010774 Ga0068856_1000107742 438
150 3300005616 Ga0068852_100002278 Ga0068852_1000022784 438
151 3300009093 Ga0105240_10006089 Ga0105240_100060893 438
152 3300009093 Ga0105240_10057615 Ga0105240_100576154 438
153 3300013100 Ga0157373_10142601 Ga0157373_101426012 438
154 3300013102 Ga0157371_10002068 Ga0157371_1000206814 438
155 3300013102 Ga0157371_10101502 Ga0157371_101015022 438
156 3300013104 Ga0157370_10133026 Ga0157370_101330262 438
157 3300013105 Ga0157369_10000298 Ga0157369_1000029818 438
158 3300013105 Ga0157369_10004587 Ga0157369_1000458719 438
159 3300013105 Ga0157369_10027270 Ga0157369_100272706 438
160 3300013296 Ga0157374_10001130 Ga0157374_1000113017 438
161 3300025904 Ga0207647_10028683 Ga0207647_100286833 438
162 3300025909 Ga0207705_10000070 Ga0207705_1000007045 438
163 3300025913 Ga0207695_10004765 Ga0207695_100047652 438
164 3300025913 Ga0207695_10251124 Ga0207695_102511242 438
165 3300025919 Ga0207657_10003397 Ga0207657_100033978 438
166 3300025920 Ga0207649_10000160 Ga0207649_1000016030 438
167 3300025949 Ga0207667_10058896 Ga0207667_100588962 438
168 3300025981 Ga0207640_10000594 Ga0207640_1000059410 438
169 3300025981 Ga0207640_10128366 Ga0207640_101283662 438
170 3300026067 Ga0207678_10005029 Ga0207678_100050296 438
171 3300026067 Ga0207678_10005405 Ga0207678_1000540510 438
172 3300026078 Ga0207702_10019017 Ga0207702_100190175 438
173 3300026078 Ga0207702_10021628 Ga0207702_100216283 438
174 3300026142 Ga0207698_10001848 Ga0207698_100018486 438
175 3300026142 Ga0207698_10024791 Ga0207698_100247913 438
176 3300037312 Ga0395899_0007617 Ga0395899_0007617_2482_3798 438
177 3300037418 Ga0395900_0039133 Ga0395900_0039133_1871_3187 438
178 3300037418 Ga0395900_0039561 Ga0395900_0039561_1770_3086 438
179 3300037418 Ga0395900_0068576 Ga0395900_0068576_1203_2519 438
180 3300037418 Ga0395900_0096074 Ga0395900_0096074_1328_2644 438
181 3300038443 Ga0395901_0009349 Ga0395901_0009349_8489_9805 438
182 3300044656 Ga0466969_0054639 Ga0466969_0054639_304_1620 438
183 3300044684 Ga0466966_0000027 Ga0466966_0000027_57616_58932 438
184 3300044719 Ga0466971_0020407 Ga0466971_0020407_1053_2369 438
185 3300044842 Ga0466957_0007761 Ga0466957_0007761_3483_4799 438
186 3300045836 Ga0466958_0000759 Ga0466958_0000759_8182_9498 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13167

GTP-bdg_N

GTP-binding GTPase N-terminal

45

133

0.98

PF16360

GTP-bdg_M

GTP-binding GTPase Middle Region

135

214

0.98

PF19275

HflX_C

HflX C-terminal domain

366

456

0.9

PF01926

MMR_HSR1

50S ribosome-binding GTPase

221

342

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7of2-assembly1.cif.gz_C structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with gtpbp6. 0.7794 17 426
8a57-assembly1.cif.gz_D cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.7784 17 423
7of2-assembly1.cif.gz_C structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with gtpbp6. 0.774 17 426
2f1m-assembly2.cif.gz_C conformational flexibility in the multidrug efflux system protein acra 0.7677 131 196
7yla-assembly1.cif.gz_6 cryo-em structure of 50s-hflx complex 0.7658 16 426
ID Description Score Start End Superfamily
af_O33230_82_179_3.40.50.11060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain 0.9685 36 125 3.40.50.11060
af_Q2R1U5_146_245_3.40.50.11060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain 0.9553 30 126 3.40.50.11060
af_Q2FYY9_24_121_3.40.50.11060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain 0.932 31 123 3.40.50.11060
af_P25519_16_114_3.40.50.11060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain 0.9318 27 126 3.40.50.11060
af_Q2R1U5_146_245_3.40.50.11060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain 0.9188 30 126 3.40.50.11060
ID Description Score Start End GO Terms
AF-A0A257SFL2-F1-model_v4 GTPase HflX N-terminal domain-containing protein 0.9721 36 126 GO:0005525
GO:0005737
GO:0043022
GO:0046872
AF-X1G2X4-F1-model_v4 GTPase HflX N-terminal domain-containing protein 0.9699 61 143 GO:0005525
GO:0005737
GO:0043022
GO:0046872
AF-A0A350W5Y5-F1-model_v4 GTPase HflX 0.9549 17 123 GO:0005525
GO:0005737
GO:0043022
GO:0046872
AF-A0A519ZRN3-F1-model_v4 GTPase HflX 0.9501 21 144 GO:0005525
GO:0005737
GO:0043022
GO:0046872
AF-X1VIR7-F1-model_v4 GTPase HflX N-terminal domain-containing protein 0.9385 17 138 GO:0005525
GO:0005737
GO:0043022
GO:0046872

Feature Viewer

pLDDT pTM Quality
79.66 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map