F286184
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 186 | 112 | 183 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1003206|Ga0265337_10032066 |
| Length | 471 |
| Sequence | LTRSPTKKREGSGHASRERRRAVVLHVARKSGAAPDAIRSSRSEQSRLDEAIALTGAIGLDVAEGVIANIARATPATLIGSGKVEEIKALCNAVEPEVVIVNAQLSPVQQRNLEKAWGTKVLDRTALILEIFGERARTREGRLQVELAHLTYQRSRLVRSWTHLERQRGGFGFLGGPGETQIETDRRLIGERIAKIKRELEDVKRTRGLHRRARKKVPYPVVALVGYTNAGKSTLFNRLTSAEVLAKDMLFATLDPTMRGLKLSSGRRVILSDTVGFIADLPVELVAAFRATLEEVLEADIVVHVRDAAHDESEAQKADVQKVLAELGVKEDGRAGIEVLNKIDLLEPDVRAAMLARNRVAPRLVSSGQAGGGEQIAVSAITGEGLDALVQSIDRLLGSQDLTMRLALTPDDGAGLAWAHAHGRVLERRDTDKVVYLVIAGDDSAVDRFTQRFPGKLTIIEPDQRRRAISS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 2 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 68 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 71 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 72 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 73 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 77 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 78 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 79 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 81 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 82 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 83 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 84 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 85 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 92 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 95 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 96 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 100 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 101 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 0 |
| Isolates | 1.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.15 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000231 | 3300001904 | Bacteria | 10126 |
| 2 | JGI24740J21852_10004395 | 3300001979 | Bacteria | 6062 |
| 3 | JGI24737J22298_10000089 | 3300001990 | Bacteria | 27032 |
| 4 | JGI25406J46586_10000221 | 3300003203 | Bacteria | 25171 |
| 5 | JGI25165J46597_1001751 | 3300003214 | Bacteria | 9476 |
| 6 | Ga0070658_10000505 | 3300005327 | Bacteria | 33825 |
| 7 | Ga0070660_100000039 | 3300005339 | Bacteria | 76157 |
| 8 | Ga0070660_100001500 | 3300005339 | Bacteria | 15992 |
| 9 | Ga0070660_100019832 | 3300005339 | Bacteria | 4933 |
| 10 | Ga0070691_10000866 | 3300005341 | Bacteria | 12258 |
| 11 | Ga0070661_100003178 | 3300005344 | Bacteria | 11318 |
| 12 | Ga0070692_10007610 | 3300005345 | Bacteria | 4782 |
| 13 | Ga0070692_10026098 | 3300005345 | Bacteria | 2885 |
| 14 | Ga0070709_10006975 | 3300005434 | Bacteria | 6170 |
| 15 | Ga0070713_100000044 | 3300005436 | Bacteria | 78106 |
| 16 | Ga0070710_10137164 | 3300005437 | Bacteria | 1497 |
| 17 | Ga0070705_100025612 | 3300005440 | Bacteria | 3200 |
| 18 | Ga0070663_100008010 | 3300005455 | Bacteria | 6475 |
| 19 | Ga0070663_100011800 | 3300005455 | Bacteria | 5502 |
| 20 | Ga0070663_100044436 | 3300005455 | Bacteria | 3132 |
| 21 | Ga0070681_10066832 | 3300005458 | Bacteria | 3564 |
| 22 | Ga0068853_100001346 | 3300005539 | Bacteria | 17708 |
| 23 | Ga0068855_100000135 | 3300005563 | Bacteria | 94502 |
| 24 | Ga0068855_100023931 | 3300005563 | Bacteria | 7314 |
| 25 | Ga0068855_100111031 | 3300005563 | Bacteria | 3147 |
| 26 | Ga0068855_100251380 | 3300005563 | Bacteria | 1972 |
| 27 | Ga0068855_100339596 | 3300005563 | Bacteria | 1656 |
| 28 | Ga0068857_100000031 | 3300005577 | Bacteria | 75513 |
| 29 | Ga0068857_100034325 | 3300005577 | Bacteria | 4487 |
| 30 | Ga0068854_100002608 | 3300005578 | Bacteria | 11175 |
| 31 | Ga0068854_100039012 | 3300005578 | Bacteria | 3343 |
| 32 | Ga0068856_100002408 | 3300005614 | Bacteria | 19253 |
| 33 | Ga0068856_100010774 | 3300005614 | Bacteria | 8879 |
| 34 | Ga0068852_100002278 | 3300005616 | Bacteria | 13189 |
| 35 | Ga0068858_100090542 | 3300005842 | Bacteria | 2847 |
| 36 | Ga0081539_10000076 | 3300005985 | Bacteria | 229037 |
| 37 | Ga0075365_10117470 | 3300006038 | Bacteria | 1832 |
| 38 | Ga0070712_100000037 | 3300006175 | Bacteria | 67430 |
| 39 | Ga0070712_100000058 | 3300006175 | Bacteria | 56442 |
| 40 | Ga0075431_100026197 | 3300006847 | Bacteria | 5981 |
| 41 | Ga0075436_100000558 | 3300006914 | Bacteria | 24300 |
| 42 | Ga0105240_10006089 | 3300009093 | Bacteria | 17805 |
| 43 | Ga0105240_10057615 | 3300009093 | Bacteria | 4853 |
| 44 | Ga0111539_10046778 | 3300009094 | Bacteria | 5174 |
| 45 | Ga0105238_10002095 | 3300009551 | Bacteria | 20151 |
| 46 | Ga0157373_10142601 | 3300013100 | Bacteria | 1685 |
| 47 | Ga0157371_10002068 | 3300013102 | Bacteria | 19673 |
| 48 | Ga0157371_10004826 | 3300013102 | Bacteria | 11596 |
| 49 | Ga0157371_10005773 | 3300013102 | Bacteria | 10367 |
| 50 | Ga0157371_10101502 | 3300013102 | Bacteria | 2041 |
| 51 | Ga0157370_10015304 | 3300013104 | Bacteria | 7803 |
| 52 | Ga0157370_10089417 | 3300013104 | Bacteria | 2893 |
| 53 | Ga0157370_10133026 | 3300013104 | Bacteria | 2319 |
| 54 | Ga0157369_10000298 | 3300013105 | Bacteria | 66393 |
| 55 | Ga0157369_10004587 | 3300013105 | Bacteria | 16237 |
| 56 | Ga0157369_10027270 | 3300013105 | Bacteria | 6334 |
| 57 | Ga0157369_10179906 | 3300013105 | Bacteria | 2225 |
| 58 | Ga0157374_10001130 | 3300013296 | Bacteria | 22903 |
| 59 | Ga0157380_10012472 | 3300014326 | Bacteria | 6166 |
| 60 | Ga0207427_102230 | 3300025231 | Bacteria | 5468 |
| 61 | Ga0209233_1000401 | 3300025261 | Bacteria | 35524 |
| 62 | Ga0207647_10010353 | 3300025904 | Bacteria | 6585 |
| 63 | Ga0207647_10028683 | 3300025904 | Bacteria | 3612 |
| 64 | Ga0207699_10003589 | 3300025906 | Bacteria | 7418 |
| 65 | Ga0207705_10000050 | 3300025909 | Bacteria | 170078 |
| 66 | Ga0207705_10000070 | 3300025909 | Bacteria | 130733 |
| 67 | Ga0207705_10000386 | 3300025909 | Bacteria | 39450 |
| 68 | Ga0207705_10005712 | 3300025909 | Bacteria | 9292 |
| 69 | Ga0207695_10004765 | 3300025913 | Bacteria | 18346 |
| 70 | Ga0207695_10251124 | 3300025913 | Bacteria | 1668 |
| 71 | Ga0207693_10000135 | 3300025915 | Bacteria | 67093 |
| 72 | Ga0207663_10016995 | 3300025916 | Bacteria | 4045 |
| 73 | Ga0207657_10000020 | 3300025919 | Bacteria | 157826 |
| 74 | Ga0207657_10000101 | 3300025919 | Bacteria | 82962 |
| 75 | Ga0207657_10000923 | 3300025919 | Bacteria | 31101 |
| 76 | Ga0207657_10003397 | 3300025919 | Bacteria | 17017 |
| 77 | Ga0207657_10056655 | 3300025919 | Bacteria | 3380 |
| 78 | Ga0207649_10000160 | 3300025920 | Bacteria | 54640 |
| 79 | Ga0207681_10105782 | 3300025923 | Bacteria | 2038 |
| 80 | Ga0207694_10043603 | 3300025924 | Bacteria | 3463 |
| 81 | Ga0207700_10000017 | 3300025928 | Bacteria | 195983 |
| 82 | Ga0207644_10112371 | 3300025931 | Bacteria | 2062 |
| 83 | Ga0207665_10046757 | 3300025939 | Bacteria | 2900 |
| 84 | Ga0207661_10019801 | 3300025944 | Bacteria | 5022 |
| 85 | Ga0207667_10021043 | 3300025949 | Bacteria | 7234 |
| 86 | Ga0207667_10058896 | 3300025949 | Bacteria | 4026 |
| 87 | Ga0207640_10000594 | 3300025981 | Bacteria | 21529 |
| 88 | Ga0207640_10128366 | 3300025981 | Bacteria | 1829 |
| 89 | Ga0207639_10003033 | 3300026041 | Bacteria | 11311 |
| 90 | Ga0207678_10000908 | 3300026067 | Bacteria | 27102 |
| 91 | Ga0207678_10005029 | 3300026067 | Bacteria | 11863 |
| 92 | Ga0207678_10005405 | 3300026067 | Bacteria | 11442 |
| 93 | Ga0207678_10006350 | 3300026067 | Bacteria | 10494 |
| 94 | Ga0207702_10000035 | 3300026078 | Bacteria | 158744 |
| 95 | Ga0207702_10019017 | 3300026078 | Bacteria | 5683 |
| 96 | Ga0207702_10021628 | 3300026078 | Bacteria | 5326 |
| 97 | Ga0207674_10000003 | 3300026116 | Bacteria | 241674 |
| 98 | Ga0207674_10002143 | 3300026116 | Bacteria | 24953 |
| 99 | Ga0207674_10116434 | 3300026116 | Bacteria | 2644 |
| 100 | Ga0207698_10001848 | 3300026142 | Bacteria | 12361 |
| 101 | Ga0207698_10024791 | 3300026142 | Bacteria | 4216 |
| 102 | Ga0265337_1003206 | 3300028556 | Bacteria | 7166 |
| 103 | Ga0265334_10000872 | 3300028573 | Bacteria | 15109 |
| 104 | Ga0265338_10006580 | 3300028800 | Bacteria | 14740 |
| 105 | Ga0265338_10011529 | 3300028800 | Bacteria | 10196 |
| 106 | Ga0265320_10002130 | 3300031240 | Bacteria | 13888 |
| 107 | Ga0265325_10001254 | 3300031241 | Bacteria | 18106 |
| 108 | Ga0265325_10015093 | 3300031241 | Bacteria | 4354 |
| 109 | Ga0265339_10021260 | 3300031249 | Bacteria | 3778 |
| 110 | Ga0265331_10000054 | 3300031250 | Bacteria | 180181 |
| 111 | Ga0265327_10000179 | 3300031251 | Bacteria | 135005 |
| 112 | Ga0265316_10042716 | 3300031344 | Bacteria | 3621 |
| 113 | Ga0307408_100108505 | 3300031548 | Bacteria | 2128 |
| 114 | Ga0265313_10017017 | 3300031595 | Bacteria | 4153 |
| 115 | Ga0265313_10024451 | 3300031595 | Bacteria | 3226 |
| 116 | Ga0265314_10038681 | 3300031711 | Bacteria | 3443 |
| 117 | Ga0265314_10053504 | 3300031711 | Bacteria | 2799 |
| 118 | Ga0307405_10079780 | 3300031731 | Bacteria | 2135 |
| 119 | Ga0307413_10004305 | 3300031824 | Bacteria | 6173 |
| 120 | Ga0307413_10028416 | 3300031824 | Bacteria | 3114 |
| 121 | Ga0307410_10016460 | 3300031852 | Bacteria | 4410 |
| 122 | Ga0307410_10044676 | 3300031852 | Bacteria | 2944 |
| 123 | Ga0307410_10079014 | 3300031852 | Bacteria | 2304 |
| 124 | Ga0307410_10101743 | 3300031852 | Bacteria | 2060 |
| 125 | Ga0307407_10006813 | 3300031903 | Bacteria | 5120 |
| 126 | Ga0307407_10013915 | 3300031903 | Bacteria | 3921 |
| 127 | Ga0307412_10065499 | 3300031911 | Bacteria | 2459 |
| 128 | Ga0307412_10142734 | 3300031911 | Bacteria | 1756 |
| 129 | Ga0307409_100047791 | 3300031995 | Bacteria | 3251 |
| 130 | Ga0307409_100070067 | 3300031995 | Bacteria | 2782 |
| 131 | Ga0307416_100167101 | 3300032002 | Bacteria | 2042 |
| 132 | Ga0307416_100210455 | 3300032002 | Bacteria | 1854 |
| 133 | Ga0307414_10001464 | 3300032004 | Bacteria | 12269 |
| 134 | Ga0307411_10000729 | 3300032005 | Bacteria | 12120 |
| 135 | Ga0307411_10000971 | 3300032005 | Bacteria | 10993 |
| 136 | Ga0307411_10027595 | 3300032005 | Bacteria | 3438 |
| 137 | Ga0307411_10110657 | 3300032005 | Bacteria | 1965 |
| 138 | Ga0307411_10126450 | 3300032005 | Bacteria | 1860 |
| 139 | Ga0373961_0028833 | 3300035241 | Bacteria | 1533 |
| 140 | Ga0373933_0009318 | 3300035724 | Bacteria | 5362 |
| 141 | Ga0373937_0045793 | 3300036401 | Bacteria | 3998 |
| 142 | Ga0373925_0003173 | 3300037068 | Bacteria | 12858 |
| 143 | Ga0373925_0058969 | 3300037068 | Bacteria | 2878 |
| 144 | Ga0395899_0001091 | 3300037312 | Bacteria | 24377 |
| 145 | Ga0395899_0007617 | 3300037312 | Bacteria | 8351 |
| 146 | Ga0395899_0021568 | 3300037312 | Bacteria | 4884 |
| 147 | Ga0395900_0000136 | 3300037418 | Bacteria | 123664 |
| 148 | Ga0395900_0039133 | 3300037418 | Bacteria | 4886 |
| 149 | Ga0395900_0039561 | 3300037418 | Bacteria | 4858 |
| 150 | Ga0395900_0068576 | 3300037418 | Bacteria | 3645 |
| 151 | Ga0395900_0096074 | 3300037418 | Bacteria | 3044 |
| 152 | Ga0395900_0141511 | 3300037418 | Bacteria | 2463 |
| 153 | Ga0395898_0022594 | 3300037466 | Bacteria | 6369 |
| 154 | Ga0395898_0064292 | 3300037466 | Bacteria | 3558 |
| 155 | Ga0395898_0200964 | 3300037466 | Bacteria | 1903 |
| 156 | Ga0395905_0075022 | 3300037471 | Bacteria | 3169 |
| 157 | Ga0395905_0105440 | 3300037471 | Bacteria | 2647 |
| 158 | Ga0436364_1447762 | 3300037853 | Bacteria | 1127 |
| 159 | Ga0395901_0000030 | 3300038443 | Bacteria | 241916 |
| 160 | Ga0395901_0009349 | 3300038443 | Bacteria | 9940 |
| 161 | Ga0395901_0039909 | 3300038443 | Bacteria | 4859 |
| 162 | Ga0395901_0120233 | 3300038443 | Bacteria | 2761 |
| 163 | Ga0451577_0155950 | 3300042876 | Bacteria | 2055 |
| 164 | Ga0466969_0054639 | 3300044656 | Bacteria | 1955 |
| 165 | Ga0466966_0000027 | 3300044684 | Bacteria | 106520 |
| 166 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 167 | Ga0453684_0033883 | 3300044712 | Bacteria | 7105 |
| 168 | Ga0466971_0020407 | 3300044719 | Bacteria | 2946 |
| 169 | Ga0466957_0007761 | 3300044842 | Bacteria | 6072 |
| 170 | Ga0466958_0000759 | 3300045836 | Bacteria | 14160 |
| 171 | Ga0495651_0131798 | 3300046462 | Bacteria | 1824 |
| 172 | Ga0495586_0044555 | 3300046535 | Bacteria | 2390 |
| 173 | Ga0495672_0002467 | 3300047320 | Bacteria | 17008 |
| 174 | Ga0501040_0073723 | 3300049576 | Bacteria | 2359 |
| 175 | Ga0501047_0039379 | 3300049581 | Bacteria | 4572 |
| 176 | Ga0501047_0226350 | 3300049581 | Bacteria | 1725 |
| 177 | Ga0501077_0010487 | 3300049593 | Bacteria | 5768 |
| 178 | Ga0501079_0018028 | 3300049741 | Bacteria | 5391 |
| 179 | Ga0501080_0022741 | 3300049742 | Bacteria | 5808 |
| 180 | Ga0501080_0164993 | 3300049742 | Bacteria | 2044 |
| 181 | Ga0501044_0000116 | 3300049823 | Bacteria | 96626 |
| 182 | nmdc:mga08x19_561_c1 | 3300050514 | Bacteria | 24307 |
| 183 | Ga0501084_0001058 | 3300054114 | Bacteria | 21381 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_1447762 | Ga0436364_1447762_20_1114 | 362 |
| 2 | 3300014326 | Ga0157380_10012472 | Ga0157380_100124726 | 365 |
| 3 | 3300047320 | Ga0495672_0002467 | Ga0495672_0002467_12816_14039 | 370 |
| 4 | 3300005539 | Ga0068853_100001346 | Ga0068853_10000134612 | 374 |
| 5 | 3300026041 | Ga0207639_10003033 | Ga0207639_100030335 | 374 |
| 6 | 3300026116 | Ga0207674_10002143 | Ga0207674_1000214314 | 374 |
| 7 | 3300005339 | Ga0070660_100001500 | Ga0070660_1000015003 | 375 |
| 8 | 3300005341 | Ga0070691_10000866 | Ga0070691_100008665 | 375 |
| 9 | 3300025909 | Ga0207705_10000386 | Ga0207705_1000038614 | 375 |
| 10 | 3300025919 | Ga0207657_10000101 | Ga0207657_1000010122 | 375 |
| 11 | 3300037068 | Ga0373925_0003173 | Ga0373925_0003173_7729_8886 | 378 |
| 12 | 3300001990 | JGI24737J22298_10000089 | JGI24737J22298_1000008924 | 380 |
| 13 | 3300046462 | Ga0495651_0131798 | Ga0495651_0131798_310_1506 | 381 |
| 14 | 3300031548 | Ga0307408_100108505 | Ga0307408_1001085052 | 382 |
| 15 | 3300031731 | Ga0307405_10079780 | Ga0307405_100797802 | 382 |
| 16 | 3300031852 | Ga0307410_10079014 | Ga0307410_100790142 | 382 |
| 17 | 3300031250 | Ga0265331_10000054 | Ga0265331_10000054182 | 387 |
| 18 | 3300031711 | Ga0265314_10053504 | Ga0265314_100535042 | 387 |
| 19 | 3300044712 | Ga0453684_0033883 | Ga0453684_0033883_1201_2469 | 388 |
| 20 | 3300003203 | JGI25406J46586_10000221 | JGI25406J46586_1000022125 | 389 |
| 21 | 3300005985 | Ga0081539_10000076 | Ga0081539_10000076186 | 389 |
| 22 | 3300031251 | Ga0265327_10000179 | Ga0265327_10000179109 | 392 |
| 23 | iso_pu_bacteria | 2883577096 | 2883580488 | 397 |
| 24 | 3300031240 | Ga0265320_10002130 | Ga0265320_1000213012 | 398 |
| 25 | 3300031241 | Ga0265325_10015093 | Ga0265325_100150935 | 398 |
| 26 | 3300031995 | Ga0307409_100070067 | Ga0307409_1000700673 | 402 |
| 27 | 3300032005 | Ga0307411_10126450 | Ga0307411_101264502 | 402 |
| 28 | 3300026116 | Ga0207674_10116434 | Ga0207674_101164342 | 408 |
| 29 | 3300031824 | Ga0307413_10028416 | Ga0307413_100284162 | 411 |
| 30 | 3300031903 | Ga0307407_10006813 | Ga0307407_100068133 | 411 |
| 31 | 3300031995 | Ga0307409_100047791 | Ga0307409_1000477913 | 411 |
| 32 | 3300032002 | Ga0307416_100167101 | Ga0307416_1001671012 | 411 |
| 33 | 3300032005 | Ga0307411_10000729 | Ga0307411_1000072912 | 411 |
| 34 | 3300032005 | Ga0307411_10110657 | Ga0307411_101106572 | 411 |
| 35 | 3300037471 | Ga0395905_0105440 | Ga0395905_0105440_805_2040 | 411 |
| 36 | 3300046535 | Ga0495586_0044555 | Ga0495586_0044555_403_1707 | 411 |
| 37 | 3300049741 | Ga0501079_0018028 | Ga0501079_0018028_3347_4834 | 411 |
| 38 | 3300025923 | Ga0207681_10105782 | Ga0207681_101057822 | 413 |
| 39 | 3300026067 | Ga0207678_10006350 | Ga0207678_100063509 | 413 |
| 40 | 3300031852 | Ga0307410_10016460 | Ga0307410_100164602 | 414 |
| 41 | 3300049581 | Ga0501047_0226350 | Ga0501047_0226350_224_1489 | 414 |
| 42 | 3300049742 | Ga0501080_0022741 | Ga0501080_0022741_2627_3892 | 414 |
| 43 | iso_pu_bacteria | 2929199973 | 2929203577 | 414 |
| 44 | 3300005458 | Ga0070681_10066832 | Ga0070681_100668322 | 415 |
| 45 | 3300005563 | Ga0068855_100111031 | Ga0068855_1001110312 | 415 |
| 46 | 3300005577 | Ga0068857_100000031 | Ga0068857_10000003176 | 415 |
| 47 | 3300005614 | Ga0068856_100002408 | Ga0068856_10000240825 | 415 |
| 48 | 3300005842 | Ga0068858_100090542 | Ga0068858_1000905423 | 415 |
| 49 | 3300009551 | Ga0105238_10002095 | Ga0105238_1000209517 | 415 |
| 50 | 3300013104 | Ga0157370_10015304 | Ga0157370_100153046 | 415 |
| 51 | 3300013105 | Ga0157369_10179906 | Ga0157369_101799062 | 415 |
| 52 | 3300025924 | Ga0207694_10043603 | Ga0207694_100436032 | 415 |
| 53 | 3300026116 | Ga0207674_10000003 | Ga0207674_10000003180 | 415 |
| 54 | 3300028573 | Ga0265334_10000872 | Ga0265334_1000087213 | 415 |
| 55 | 3300028800 | Ga0265338_10011529 | Ga0265338_100115295 | 415 |
| 56 | 3300031241 | Ga0265325_10001254 | Ga0265325_100012544 | 415 |
| 57 | 3300031249 | Ga0265339_10021260 | Ga0265339_100212604 | 415 |
| 58 | 3300031344 | Ga0265316_10042716 | Ga0265316_100427163 | 415 |
| 59 | 3300031595 | Ga0265313_10017017 | Ga0265313_100170173 | 415 |
| 60 | 3300035724 | Ga0373933_0009318 | Ga0373933_0009318_2552_3835 | 415 |
| 61 | 3300035241 | Ga0373961_0028833 | Ga0373961_0028833_88_1455 | 416 |
| 62 | 3300005327 | Ga0070658_10000505 | Ga0070658_100005053 | 420 |
| 63 | 3300005434 | Ga0070709_10006975 | Ga0070709_100069752 | 420 |
| 64 | 3300005436 | Ga0070713_100000044 | Ga0070713_1000000441 | 420 |
| 65 | 3300005437 | Ga0070710_10137164 | Ga0070710_101371641 | 420 |
| 66 | 3300005440 | Ga0070705_100025612 | Ga0070705_1000256123 | 420 |
| 67 | 3300006175 | Ga0070712_100000037 | Ga0070712_10000003749 | 420 |
| 68 | 3300006175 | Ga0070712_100000058 | Ga0070712_1000000584 | 420 |
| 69 | 3300006914 | Ga0075436_100000558 | Ga0075436_10000055825 | 420 |
| 70 | 3300025904 | Ga0207647_10010353 | Ga0207647_100103534 | 420 |
| 71 | 3300025906 | Ga0207699_10003589 | Ga0207699_100035894 | 420 |
| 72 | 3300025909 | Ga0207705_10000050 | Ga0207705_10000050169 | 420 |
| 73 | 3300025915 | Ga0207693_10000135 | Ga0207693_1000013517 | 420 |
| 74 | 3300025916 | Ga0207663_10016995 | Ga0207663_100169954 | 420 |
| 75 | 3300025928 | Ga0207700_10000017 | Ga0207700_10000017143 | 420 |
| 76 | 3300025939 | Ga0207665_10046757 | Ga0207665_100467573 | 420 |
| 77 | 3300026078 | Ga0207702_10000035 | Ga0207702_10000035112 | 420 |
| 78 | 3300028800 | Ga0265338_10006580 | Ga0265338_100065804 | 420 |
| 79 | 3300031711 | Ga0265314_10038681 | Ga0265314_100386812 | 420 |
| 80 | 3300031911 | Ga0307412_10065499 | Ga0307412_100654993 | 420 |
| 81 | 3300036401 | Ga0373937_0045793 | Ga0373937_0045793_725_2026 | 420 |
| 82 | 3300037068 | Ga0373925_0058969 | Ga0373925_0058969_1105_2406 | 420 |
| 83 | 3300050514 | nmdc:mga08x19_561_c1 | nmdc:mga08x19_561_c1_22786_24087 | 420 |
| 84 | 3300006847 | Ga0075431_100026197 | Ga0075431_1000261974 | 421 |
| 85 | 3300031824 | Ga0307413_10004305 | Ga0307413_100043054 | 421 |
| 86 | 3300032004 | Ga0307414_10001464 | Ga0307414_100014646 | 421 |
| 87 | 3300032005 | Ga0307411_10027595 | Ga0307411_100275952 | 421 |
| 88 | 3300049576 | Ga0501040_0073723 | Ga0501040_0073723_369_1709 | 421 |
| 89 | 3300049593 | Ga0501077_0010487 | Ga0501077_0010487_3194_4534 | 421 |
| 90 | 3300049742 | Ga0501080_0164993 | Ga0501080_0164993_590_1930 | 421 |
| 91 | 3300054114 | Ga0501084_0001058 | Ga0501084_0001058_9438_10778 | 421 |
| 92 | 3300049581 | Ga0501047_0039379 | Ga0501047_0039379_2175_3545 | 426 |
| 93 | iso_pu_bacteria | 8055909800 | 8055911232 | 428 |
| 94 | 3300037466 | Ga0395898_0200964 | Ga0395898_0200964_276_1601 | 429 |
| 95 | 3300003214 | JGI25165J46597_1001751 | JGI25165J46597_10017515 | 433 |
| 96 | 3300025231 | Ga0207427_102230 | Ga0207427_1022304 | 433 |
| 97 | 3300025261 | Ga0209233_1000401 | Ga0209233_100040131 | 433 |
| 98 | 3300025931 | Ga0207644_10112371 | Ga0207644_101123711 | 433 |
| 99 | 3300032002 | Ga0307416_100210455 | Ga0307416_1002104552 | 433 |
| 100 | 3300028556 | Ga0265337_1003206 | Ga0265337_10032066 | 434 |
| 101 | 3300031595 | Ga0265313_10024451 | Ga0265313_100244513 | 434 |
| 102 | 3300031852 | Ga0307410_10044676 | Ga0307410_100446762 | 434 |
| 103 | 3300031852 | Ga0307410_10101743 | Ga0307410_101017432 | 434 |
| 104 | 3300031903 | Ga0307407_10013915 | Ga0307407_100139152 | 434 |
| 105 | 3300031911 | Ga0307412_10142734 | Ga0307412_101427342 | 434 |
| 106 | 3300032005 | Ga0307411_10000971 | Ga0307411_1000097111 | 434 |
| 107 | 3300049823 | Ga0501044_0000116 | Ga0501044_0000116_52832_54235 | 434 |
| 108 | 3300005339 | Ga0070660_100000039 | Ga0070660_10000003977 | 435 |
| 109 | 3300005339 | Ga0070660_100019832 | Ga0070660_1000198325 | 435 |
| 110 | 3300005345 | Ga0070692_10007610 | Ga0070692_100076103 | 435 |
| 111 | 3300005345 | Ga0070692_10026098 | Ga0070692_100260983 | 435 |
| 112 | 3300005455 | Ga0070663_100011800 | Ga0070663_1000118006 | 435 |
| 113 | 3300005563 | Ga0068855_100000135 | Ga0068855_1000001355 | 435 |
| 114 | 3300005563 | Ga0068855_100251380 | Ga0068855_1002513802 | 435 |
| 115 | 3300013102 | Ga0157371_10004826 | Ga0157371_100048267 | 435 |
| 116 | 3300013102 | Ga0157371_10005773 | Ga0157371_100057739 | 435 |
| 117 | 3300013104 | Ga0157370_10089417 | Ga0157370_100894173 | 435 |
| 118 | 3300025909 | Ga0207705_10005712 | Ga0207705_100057129 | 435 |
| 119 | 3300025919 | Ga0207657_10000020 | Ga0207657_10000020113 | 435 |
| 120 | 3300025919 | Ga0207657_10000923 | Ga0207657_1000092312 | 435 |
| 121 | 3300025919 | Ga0207657_10056655 | Ga0207657_100566552 | 435 |
| 122 | 3300025944 | Ga0207661_10019801 | Ga0207661_100198013 | 435 |
| 123 | 3300025949 | Ga0207667_10021043 | Ga0207667_100210435 | 435 |
| 124 | 3300026067 | Ga0207678_10000908 | Ga0207678_100009085 | 435 |
| 125 | 3300037312 | Ga0395899_0001091 | Ga0395899_0001091_7717_9027 | 435 |
| 126 | 3300037312 | Ga0395899_0021568 | Ga0395899_0021568_2824_4134 | 435 |
| 127 | 3300037418 | Ga0395900_0000136 | Ga0395900_0000136_68839_70149 | 435 |
| 128 | 3300037418 | Ga0395900_0141511 | Ga0395900_0141511_596_1906 | 435 |
| 129 | 3300037466 | Ga0395898_0022594 | Ga0395898_0022594_4728_6038 | 435 |
| 130 | 3300037466 | Ga0395898_0064292 | Ga0395898_0064292_952_2262 | 435 |
| 131 | 3300037471 | Ga0395905_0075022 | Ga0395905_0075022_751_2061 | 435 |
| 132 | 3300038443 | Ga0395901_0000030 | Ga0395901_0000030_209597_210907 | 435 |
| 133 | 3300038443 | Ga0395901_0039909 | Ga0395901_0039909_246_1556 | 435 |
| 134 | 3300038443 | Ga0395901_0120233 | Ga0395901_0120233_815_2125 | 435 |
| 135 | 3300042876 | Ga0451577_0155950 | Ga0451577_0155950_123_1442 | 435 |
| 136 | 3300044712 | Ga0453684_0000031 | Ga0453684_0000031_371786_373105 | 435 |
| 137 | 3300006038 | Ga0075365_10117470 | Ga0075365_101174702 | 436 |
| 138 | 3300009094 | Ga0111539_10046778 | Ga0111539_100467786 | 436 |
| 139 | 3300001904 | JGI24736J21556_1000231 | JGI24736J21556_10002313 | 438 |
| 140 | 3300001979 | JGI24740J21852_10004395 | JGI24740J21852_100043955 | 438 |
| 141 | 3300005344 | Ga0070661_100003178 | Ga0070661_1000031784 | 438 |
| 142 | 3300005455 | Ga0070663_100008010 | Ga0070663_1000080106 | 438 |
| 143 | 3300005455 | Ga0070663_100044436 | Ga0070663_1000444362 | 438 |
| 144 | 3300005563 | Ga0068855_100023931 | Ga0068855_1000239314 | 438 |
| 145 | 3300005563 | Ga0068855_100339596 | Ga0068855_1003395962 | 438 |
| 146 | 3300005577 | Ga0068857_100034325 | Ga0068857_1000343254 | 438 |
| 147 | 3300005578 | Ga0068854_100002608 | Ga0068854_10000260810 | 438 |
| 148 | 3300005578 | Ga0068854_100039012 | Ga0068854_1000390121 | 438 |
| 149 | 3300005614 | Ga0068856_100010774 | Ga0068856_1000107742 | 438 |
| 150 | 3300005616 | Ga0068852_100002278 | Ga0068852_1000022784 | 438 |
| 151 | 3300009093 | Ga0105240_10006089 | Ga0105240_100060893 | 438 |
| 152 | 3300009093 | Ga0105240_10057615 | Ga0105240_100576154 | 438 |
| 153 | 3300013100 | Ga0157373_10142601 | Ga0157373_101426012 | 438 |
| 154 | 3300013102 | Ga0157371_10002068 | Ga0157371_1000206814 | 438 |
| 155 | 3300013102 | Ga0157371_10101502 | Ga0157371_101015022 | 438 |
| 156 | 3300013104 | Ga0157370_10133026 | Ga0157370_101330262 | 438 |
| 157 | 3300013105 | Ga0157369_10000298 | Ga0157369_1000029818 | 438 |
| 158 | 3300013105 | Ga0157369_10004587 | Ga0157369_1000458719 | 438 |
| 159 | 3300013105 | Ga0157369_10027270 | Ga0157369_100272706 | 438 |
| 160 | 3300013296 | Ga0157374_10001130 | Ga0157374_1000113017 | 438 |
| 161 | 3300025904 | Ga0207647_10028683 | Ga0207647_100286833 | 438 |
| 162 | 3300025909 | Ga0207705_10000070 | Ga0207705_1000007045 | 438 |
| 163 | 3300025913 | Ga0207695_10004765 | Ga0207695_100047652 | 438 |
| 164 | 3300025913 | Ga0207695_10251124 | Ga0207695_102511242 | 438 |
| 165 | 3300025919 | Ga0207657_10003397 | Ga0207657_100033978 | 438 |
| 166 | 3300025920 | Ga0207649_10000160 | Ga0207649_1000016030 | 438 |
| 167 | 3300025949 | Ga0207667_10058896 | Ga0207667_100588962 | 438 |
| 168 | 3300025981 | Ga0207640_10000594 | Ga0207640_1000059410 | 438 |
| 169 | 3300025981 | Ga0207640_10128366 | Ga0207640_101283662 | 438 |
| 170 | 3300026067 | Ga0207678_10005029 | Ga0207678_100050296 | 438 |
| 171 | 3300026067 | Ga0207678_10005405 | Ga0207678_1000540510 | 438 |
| 172 | 3300026078 | Ga0207702_10019017 | Ga0207702_100190175 | 438 |
| 173 | 3300026078 | Ga0207702_10021628 | Ga0207702_100216283 | 438 |
| 174 | 3300026142 | Ga0207698_10001848 | Ga0207698_100018486 | 438 |
| 175 | 3300026142 | Ga0207698_10024791 | Ga0207698_100247913 | 438 |
| 176 | 3300037312 | Ga0395899_0007617 | Ga0395899_0007617_2482_3798 | 438 |
| 177 | 3300037418 | Ga0395900_0039133 | Ga0395900_0039133_1871_3187 | 438 |
| 178 | 3300037418 | Ga0395900_0039561 | Ga0395900_0039561_1770_3086 | 438 |
| 179 | 3300037418 | Ga0395900_0068576 | Ga0395900_0068576_1203_2519 | 438 |
| 180 | 3300037418 | Ga0395900_0096074 | Ga0395900_0096074_1328_2644 | 438 |
| 181 | 3300038443 | Ga0395901_0009349 | Ga0395901_0009349_8489_9805 | 438 |
| 182 | 3300044656 | Ga0466969_0054639 | Ga0466969_0054639_304_1620 | 438 |
| 183 | 3300044684 | Ga0466966_0000027 | Ga0466966_0000027_57616_58932 | 438 |
| 184 | 3300044719 | Ga0466971_0020407 | Ga0466971_0020407_1053_2369 | 438 |
| 185 | 3300044842 | Ga0466957_0007761 | Ga0466957_0007761_3483_4799 | 438 |
| 186 | 3300045836 | Ga0466958_0000759 | Ga0466958_0000759_8182_9498 | 438 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7of2-assembly1.cif.gz_C | structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with gtpbp6. | 0.7794 | 17 | 426 |
| 8a57-assembly1.cif.gz_D | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.7784 | 17 | 423 |
| 7of2-assembly1.cif.gz_C | structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with gtpbp6. | 0.774 | 17 | 426 |
| 2f1m-assembly2.cif.gz_C | conformational flexibility in the multidrug efflux system protein acra | 0.7677 | 131 | 196 |
| 7yla-assembly1.cif.gz_6 | cryo-em structure of 50s-hflx complex | 0.7658 | 16 | 426 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33230_82_179_3.40.50.11060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain | 0.9685 | 36 | 125 | 3.40.50.11060 |
| af_Q2R1U5_146_245_3.40.50.11060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain | 0.9553 | 30 | 126 | 3.40.50.11060 |
| af_Q2FYY9_24_121_3.40.50.11060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain | 0.932 | 31 | 123 | 3.40.50.11060 |
| af_P25519_16_114_3.40.50.11060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain | 0.9318 | 27 | 126 | 3.40.50.11060 |
| af_Q2R1U5_146_245_3.40.50.11060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTPase HflX, N-terminal domain | 0.9188 | 30 | 126 | 3.40.50.11060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257SFL2-F1-model_v4 | GTPase HflX N-terminal domain-containing protein | 0.9721 | 36 | 126 |
GO:0005525
GO:0005737 GO:0043022 GO:0046872 |
| AF-X1G2X4-F1-model_v4 | GTPase HflX N-terminal domain-containing protein | 0.9699 | 61 | 143 |
GO:0005525
GO:0005737 GO:0043022 GO:0046872 |
| AF-A0A350W5Y5-F1-model_v4 | GTPase HflX | 0.9549 | 17 | 123 |
GO:0005525
GO:0005737 GO:0043022 GO:0046872 |
| AF-A0A519ZRN3-F1-model_v4 | GTPase HflX | 0.9501 | 21 | 144 |
GO:0005525
GO:0005737 GO:0043022 GO:0046872 |
| AF-X1VIR7-F1-model_v4 | GTPase HflX N-terminal domain-containing protein | 0.9385 | 17 | 138 |
GO:0005525
GO:0005737 GO:0043022 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar