F280307

General Info

Members Datasets Scaffolds Average Seq Length
183 138 167 247

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100113892|Ga0070680_1001138924
Length 258
Sequence MGELVRHVIHGAVHELQLARAPVNALNPALCGDLADTLATAVDAGAQGIVLSGGPKVFSAGLDVPYLLSLGKDRAALTSAWERFFTAARALARSPVPVAAAIAGHAPAGGCVLALCCDYRVMARSPDALSPFRIGLNETQVGLAAPEGIQHLLARVVGPLRAERLLVSGELVDAERALAIGLVDEVVAIDNVAGHARAWLDTLLALPRQPMLQTRAIARADVLAALEPERIALDRFIDGWFSADTQAGLQALVSRLGK

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
12 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
13 2919513703 Luteimonas sp. 3794 Isolate Unclassified
14 2919675420 Luteimonas terrae 4099 Isolate Unclassified
15 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
16 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
43 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
85 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.26
Metatranscriptomes 0
Isolates 8.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 5.46
Rhizosphere 77.6
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000183 3300003187 Bacteria 78518
2 Ga0055526_1000157 3300003771 Bacteria 60697
3 Ga0055537_1000375 3300003773 Bacteria 30121
4 Ga0055524_1000288 3300003775 Bacteria 48798
5 Ga0055534_1000110 3300003784 Bacteria 60793
6 Ga0055528_1000131 3300003790 Bacteria 60697
7 Ga0065715_10019307 3300005293 Bacteria 2701
8 Ga0065715_10413965 3300005293 Bacteria 819
9 Ga0070680_100113892 3300005336 Bacteria 2253
10 Ga0068868_100081592 3300005338 Bacteria 2593
11 Ga0070660_100162108 3300005339 Bacteria 1802
12 Ga0070689_100212986 3300005340 Bacteria 1582
13 Ga0070668_100440008 3300005347 Bacteria 1119
14 Ga0070671_100010554 3300005355 Bacteria 7416
15 Ga0070673_100755499 3300005364 Bacteria 896
16 Ga0070667_100033259 3300005367 Bacteria 4308
17 Ga0070667_100165090 3300005367 Bacteria 1952
18 Ga0070663_100013083 3300005455 Bacteria 5273
19 Ga0068867_100015452 3300005459 Bacteria 5414
20 Ga0068853_100354565 3300005539 Bacteria 1365
21 Ga0070672_100798293 3300005543 Bacteria 830
22 Ga0070693_100000933 3300005547 Bacteria 12978
23 Ga0070665_100160174 3300005548 Bacteria 2252
24 Ga0068855_100740949 3300005563 Bacteria 1048
25 Ga0075364_10072864 3300006051 Bacteria 2264
26 Ga0068865_100537316 3300006881 Bacteria 980
27 Ga0105245_10933854 3300009098 Bacteria 910
28 Ga0105030_105232 3300009987 Bacteria 1097
29 Ga0157316_1002279 3300012510 Bacteria 1290
30 Ga0157371_10045048 3300013102 Bacteria 3140
31 Ga0157371_10102464 3300013102 Bacteria 2031
32 Ga0157369_10891482 3300013105 Bacteria 912
33 Ga0157378_10352032 3300013297 Unclassified 1439
34 Ga0163162_10081722 3300013306 Bacteria 3302
35 Ga0157372_10066264 3300013307 Bacteria 4057
36 Ga0157375_10108001 3300013308 Bacteria 2877
37 Ga0157514_126750 3300013874 Bacteria 1092
38 Ga0157380_10122389 3300014326 Bacteria 2206
39 Ga0157380_10327058 3300014326 Bacteria 1424
40 Ga0183360_10001 3300015689 Bacteria 3943671
41 Ga0207425_1004805 3300025245 Bacteria 3974
42 Ga0209565_1000001 3300025263 Bacteria 2950419
43 Ga0209673_1000001 3300025273 Bacteria 3176258
44 Ga0209675_1000001 3300025291 Bacteria 2950293
45 Ga0209025_1000015 3300025294 Bacteria 808120
46 Ga0209564_1000001 3300025295 Bacteria 3176258
47 Ga0209758_1008563 3300025297 Bacteria 6587
48 Ga0209256_1000002 3300025299 Bacteria 1906740
49 Ga0207680_10271432 3300025903 Bacteria 1176
50 Ga0207705_10185034 3300025909 Bacteria 1573
51 Ga0207660_10092036 3300025917 Bacteria 2250
52 Ga0207657_10035700 3300025919 Bacteria 4456
53 Ga0207652_10362763 3300025921 Bacteria 1308
54 Ga0207681_10027988 3300025923 Bacteria 3649
55 Ga0207681_10035819 3300025923 Bacteria 3272
56 Ga0207690_10341732 3300025932 Bacteria 1181
57 Ga0207691_10074765 3300025940 Bacteria 3056
58 Ga0207679_10203655 3300025945 Bacteria 1655
59 Ga0207651_10831062 3300025960 Bacteria 820
60 Ga0207668_10008277 3300025972 Bacteria 6197
61 Ga0207668_10138702 3300025972 Bacteria 1867
62 Ga0207640_10042326 3300025981 Bacteria 2904
63 Ga0207658_10352250 3300025986 Bacteria 1282
64 Ga0207639_10257539 3300026041 Bacteria 1524
65 Ga0207641_10053776 3300026088 Bacteria 3415
66 Ga0207648_10038777 3300026089 Bacteria 4191
67 Ga0207698_10193710 3300026142 Bacteria 1813
68 Ga0209967_1003495 3300027364 Bacteria 2072
69 Ga0209970_1001005 3300027614 Bacteria 5010
70 Ga0209971_1001288 3300027682 Bacteria 6235
71 Ga0209974_10007862 3300027876 Bacteria 3659
72 Ga0268266_10239703 3300028379 Bacteria 1673
73 Ga0268265_10077448 3300028380 Bacteria 2612
74 Ga0316177_1067943 3300030731 Bacteria 4304
75 Ga0314311_1142176 3300030733 Bacteria 3675
76 Ga0307413_10000580 3300031824 Bacteria 12267
77 Ga0307406_10004350 3300031901 Bacteria 7710
78 Ga0307407_10150149 3300031903 Bacteria 1513
79 Ga0307412_10048645 3300031911 Bacteria 2790
80 Ga0307412_10054469 3300031911 Bacteria 2656
81 Ga0307412_10179837 3300031911 Bacteria 1590
82 Ga0307412_10929423 3300031911 Bacteria 764
83 Ga0307409_100764623 3300031995 Bacteria 971
84 Ga0307414_10005456 3300032004 Bacteria 7005
85 Ga0307414_10048306 3300032004 Bacteria 2935
86 Ga0307414_10589827 3300032004 Bacteria 995
87 Ga0307411_10016682 3300032005 Bacteria 4161
88 Ga0307411_10239815 3300032005 Bacteria 1419
89 Ga0307411_10292545 3300032005 Bacteria 1302
90 Ga0395899_0313222 3300037312 Bacteria 1059
91 Ga0395900_0072511 3300037418 Bacteria 3540
92 Ga0395900_0086726 3300037418 Bacteria 3217
93 Ga0395898_0217918 3300037466 Bacteria 1821
94 Ga0395898_0343761 3300037466 Bacteria 1423
95 Ga0395905_0000855 3300037471 Bacteria 39769
96 Ga0395905_0415301 3300037471 Bacteria 1241
97 Ga0395901_0055396 3300038443 Bacteria 4124
98 Ga0439436_0003742 3300041404 Bacteria 4642
99 Ga0439436_0003760 3300041404 Bacteria 4636
100 Ga0439445_0014215 3300042004 Bacteria 1936
101 Ga0439462_0041746 3300042015 Bacteria 1225
102 Ga0466967_0697680 3300045976 Bacteria 1005
103 Ga0495650_0124934 3300046471 Bacteria 944
104 Ga0495663_0112335 3300046525 Bacteria 906
105 Ga0495598_0004053 3300046537 Bacteria 3148
106 Ga0495656_0018052 3300046615 Bacteria 2702
107 Ga0495672_0070428 3300047320 Bacteria 1981
108 Ga0496100_0403763 3300048903 Bacteria 1041
109 Ga0496102_0169576 3300048905 Bacteria 2055
110 Ga0496108_0071204 3300048911 Bacteria 2933
111 Ga0496108_0094656 3300048911 Bacteria 2542
112 Ga0496109_0049369 3300048912 Bacteria 3831
113 Ga0496109_0159451 3300048912 Bacteria 2114
114 Ga0496110_0138464 3300048913 Bacteria 2200
115 Ga0496111_0160224 3300048914 Bacteria 1670
116 Ga0496112_0210884 3300048915 Bacteria 1900
117 Ga0496113_0617294 3300048916 Bacteria 868
118 Ga0496121_0004743 3300048924 Bacteria 17942
119 Ga0496124_0000032 3300048927 Bacteria 332524
120 Ga0501031_0020909 3300049568 Bacteria 4267
121 Ga0501032_0010490 3300049569 Bacteria 6682
122 Ga0501032_0011267 3300049569 Bacteria 6420
123 Ga0501033_0001622 3300049570 Bacteria 19773
124 Ga0501033_0014816 3300049570 Bacteria 5920
125 Ga0501034_0023494 3300049571 Bacteria 6282
126 Ga0501034_0072044 3300049571 Bacteria 3464
127 Ga0501034_0148029 3300049571 Bacteria 2324
128 Ga0501036_0003753 3300049572 Bacteria 12173
129 Ga0501036_0007794 3300049572 Bacteria 8757
130 Ga0501037_0002159 3300049573 Bacteria 14241
131 Ga0501037_0010030 3300049573 Bacteria 6948
132 Ga0501037_0166053 3300049573 Bacteria 1572
133 Ga0501038_0006664 3300049574 Bacteria 10675
134 Ga0501038_0013755 3300049574 Bacteria 7376
135 Ga0501038_0073312 3300049574 Bacteria 2899
136 Ga0501038_0248819 3300049574 Bacteria 1409
137 Ga0501039_0010199 3300049575 Bacteria 7161
138 Ga0501039_0016137 3300049575 Bacteria 5721
139 Ga0501039_0102638 3300049575 Bacteria 2232
140 Ga0501043_0227722 3300049579 Bacteria 1440
141 Ga0501043_0416176 3300049579 Bacteria 1014
142 Ga0501046_0002927 3300049580 Bacteria 15794
143 Ga0501046_0055012 3300049580 Bacteria 3129
144 Ga0501047_0067829 3300049581 Bacteria 3436
145 Ga0501047_0145297 3300049581 Bacteria 2249
146 Ga0501047_0169036 3300049581 Bacteria 2056
147 Ga0501068_0009768 3300049584 Bacteria 5375
148 Ga0501070_0003764 3300049586 Bacteria 13100
149 Ga0501070_0029994 3300049586 Bacteria 4557
150 Ga0501073_0095854 3300049589 Bacteria 2060
151 Ga0501073_0174980 3300049589 Bacteria 1485
152 Ga0501074_0031181 3300049590 Bacteria 3862
153 Ga0501079_0039881 3300049741 Bacteria 3623
154 Ga0501080_0002734 3300049742 Bacteria 15472
155 Ga0501080_0020400 3300049742 Bacteria 6134
156 Ga0501083_0272910 3300049744 Bacteria 1100
157 Ga0501035_0012821 3300049822 Bacteria 7741
158 Ga0501035_0015265 3300049822 Bacteria 7089
159 Ga0501035_0175550 3300049822 Bacteria 1848
160 Ga0501035_0513094 3300049822 Bacteria 985
161 Ga0501044_0003706 3300049823 Bacteria 17173
162 Ga0501044_0014809 3300049823 Bacteria 8406
163 Ga0501044_0020028 3300049823 Bacteria 7143
164 Ga0501044_0447124 3300049823 Bacteria 1199
165 nmdc:mga00v17_25477_c1 3300050491 Bacteria 3439
166 nmdc:mga00v17_53903_c1 3300050491 Bacteria 2453
167 Ga0501082_0000508 3300060353 Bacteria 34518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10008277 Ga0207668_100082771 214
2 3300049569 Ga0501032_0011267 Ga0501032_0011267_5445_6200 217
3 3300049570 Ga0501033_0001622 Ga0501033_0001622_10843_11598 217
4 3300049571 Ga0501034_0072044 Ga0501034_0072044_1248_2003 217
5 3300049572 Ga0501036_0003753 Ga0501036_0003753_2890_3645 217
6 3300049573 Ga0501037_0002159 Ga0501037_0002159_5410_6165 217
7 3300049574 Ga0501038_0013755 Ga0501038_0013755_2019_2774 217
8 3300049575 Ga0501039_0016137 Ga0501039_0016137_1271_2026 217
9 3300049579 Ga0501043_0227722 Ga0501043_0227722_211_966 217
10 3300049580 Ga0501046_0002927 Ga0501046_0002927_8167_8922 217
11 3300049581 Ga0501047_0067829 Ga0501047_0067829_1220_1975 217
12 3300049584 Ga0501068_0009768 Ga0501068_0009768_1880_2635 217
13 3300049586 Ga0501070_0003764 Ga0501070_0003764_5928_6683 217
14 3300049590 Ga0501074_0031181 Ga0501074_0031181_2615_3370 217
15 3300049741 Ga0501079_0039881 Ga0501079_0039881_2732_3487 217
16 3300049742 Ga0501080_0002734 Ga0501080_0002734_8529_9284 217
17 3300049744 Ga0501083_0272910 Ga0501083_0272910_104_859 217
18 3300049822 Ga0501035_0012821 Ga0501035_0012821_6189_6944 217
19 3300049823 Ga0501044_0014809 Ga0501044_0014809_1590_2345 217
20 3300031911 Ga0307412_10929423 Ga0307412_109294231 218
21 3300049572 Ga0501036_0007794 Ga0501036_0007794_21_683 220
22 3300025903 Ga0207680_10271432 Ga0207680_102714321 221
23 3300005347 Ga0070668_100440008 Ga0070668_1004400082 223
24 3300005367 Ga0070667_100165090 Ga0070667_1001650902 223
25 3300005548 Ga0070665_100160174 Ga0070665_1001601742 223
26 3300025972 Ga0207668_10138702 Ga0207668_101387022 223
27 3300028379 Ga0268266_10239703 Ga0268266_102397032 223
28 3300049574 Ga0501038_0073312 Ga0501038_0073312_124_813 226
29 3300047320 Ga0495672_0070428 Ga0495672_0070428_398_1150 232
30 3300025923 Ga0207681_10027988 Ga0207681_100279886 237
31 3300005563 Ga0068855_100740949 Ga0068855_1007409492 238
32 3300037312 Ga0395899_0313222 Ga0395899_0313222_57_833 238
33 3300049589 Ga0501073_0174980 Ga0501073_0174980_284_1042 238
34 3300027614 Ga0209970_1001005 Ga0209970_10010053 241
35 3300049581 Ga0501047_0145297 Ga0501047_0145297_1497_2237 241
36 3300013102 Ga0157371_10102464 Ga0157371_101024641 242
37 iso_pu_bacteria 2524614729 2525555985 244
38 iso_pu_bacteria 2627854209 2630650999 244
39 3300046537 Ga0495598_0004053 Ga0495598_0004053_1280_2041 245
40 3300048912 Ga0496109_0049369 Ga0496109_0049369_2944_3687 247
41 iso_pu_bacteria 2842780639 2842783573 247
42 3300005338 Ga0068868_100081592 Ga0068868_1000815922 248
43 3300005340 Ga0070689_100212986 Ga0070689_1002129862 248
44 3300005367 Ga0070667_100033259 Ga0070667_1000332596 248
45 3300005455 Ga0070663_100013083 Ga0070663_1000130836 248
46 3300005547 Ga0070693_100000933 Ga0070693_10000093310 248
47 3300006881 Ga0068865_100537316 Ga0068865_1005373162 248
48 3300013297 Ga0157378_10352032 Ga0157378_103520322 248
49 3300025981 Ga0207640_10042326 Ga0207640_100423264 248
50 3300025986 Ga0207658_10352250 Ga0207658_103522502 248
51 3300026142 Ga0207698_10193710 Ga0207698_101937103 248
52 3300032004 Ga0307414_10048306 Ga0307414_100483062 248
53 3300032005 Ga0307411_10239815 Ga0307411_102398152 248
54 3300032005 Ga0307411_10292545 Ga0307411_102925452 248
55 3300049574 Ga0501038_0248819 Ga0501038_0248819_361_1119 248
56 3300049579 Ga0501043_0416176 Ga0501043_0416176_233_991 248
57 3300049580 Ga0501046_0055012 Ga0501046_0055012_569_1327 248
58 3300049589 Ga0501073_0095854 Ga0501073_0095854_781_1539 248
59 3300049823 Ga0501044_0003706 Ga0501044_0003706_2110_2865 248
60 3300060353 Ga0501082_0000508 Ga0501082_0000508_5417_6175 248
61 iso_pu_bacteria 2643221559 2643818974 248
62 iso_pu_bacteria 2643221573 2643879494 248
63 iso_pu_bacteria 2643221586 2643941355 248
64 iso_pu_bacteria 2643221593 2643974374 248
65 iso_pu_bacteria 2643221612 2644080400 248
66 iso_pu_bacteria 2643221720 2644662894 248
67 iso_pu_bacteria 2643221727 2644697013 248
68 iso_pu_bacteria 2643221728 2644698151 248
69 iso_pu_bacteria 2894414249 2894414691 248
70 iso_pu_bacteria 2919513703 2919516521 248
71 iso_pu_bacteria 2919675420 2919678595 248
72 iso_pu_bacteria 2941489479 2941489583 248
73 iso_pu_bacteria 2995948881 2995950880 248
74 3300046471 Ga0495650_0124934 Ga0495650_0124934_66_839 250
75 3300048927 Ga0496124_0000032 Ga0496124_0000032_281917_282690 250
76 3300006051 Ga0075364_10072864 Ga0075364_100728642 251
77 3300009987 Ga0105030_105232 Ga0105030_1052321 251
78 3300013874 Ga0157514_126750 Ga0157514_1267501 251
79 3300050491 nmdc:mga00v17_25477_c1 nmdc:mga00v17_25477_c1_1294_2052 251
80 3300050491 nmdc:mga00v17_53903_c1 nmdc:mga00v17_53903_c1_1421_2179 251
81 3300003187 JGI25151J46595_10000183 JGI25151J46595_1000018349 252
82 3300003771 Ga0055526_1000157 Ga0055526_100015756 252
83 3300003773 Ga0055537_1000375 Ga0055537_100037526 252
84 3300003775 Ga0055524_1000288 Ga0055524_100028844 252
85 3300003784 Ga0055534_1000110 Ga0055534_10001103 252
86 3300003790 Ga0055528_1000131 Ga0055528_100013156 252
87 3300005293 Ga0065715_10019307 Ga0065715_100193073 252
88 3300005293 Ga0065715_10413965 Ga0065715_104139651 252
89 3300005336 Ga0070680_100113892 Ga0070680_1001138924 252
90 3300005339 Ga0070660_100162108 Ga0070660_1001621082 252
91 3300005355 Ga0070671_100010554 Ga0070671_1000105548 252
92 3300005364 Ga0070673_100755499 Ga0070673_1007554991 252
93 3300005459 Ga0068867_100015452 Ga0068867_1000154525 252
94 3300005539 Ga0068853_100354565 Ga0068853_1003545652 252
95 3300005543 Ga0070672_100798293 Ga0070672_1007982931 252
96 3300009098 Ga0105245_10933854 Ga0105245_109338542 252
97 3300012510 Ga0157316_1002279 Ga0157316_10022792 252
98 3300013102 Ga0157371_10045048 Ga0157371_100450481 252
99 3300013105 Ga0157369_10891482 Ga0157369_108914821 252
100 3300013306 Ga0163162_10081722 Ga0163162_100817224 252
101 3300013307 Ga0157372_10066264 Ga0157372_100662643 252
102 3300013308 Ga0157375_10108001 Ga0157375_101080014 252
103 3300014326 Ga0157380_10122389 Ga0157380_101223893 252
104 3300014326 Ga0157380_10327058 Ga0157380_103270582 252
105 3300015689 Ga0183360_10001 Ga0183360_100012278 252
106 3300025245 Ga0207425_1004805 Ga0207425_10048054 252
107 3300025263 Ga0209565_1000001 Ga0209565_10000011580 252
108 3300025273 Ga0209673_1000001 Ga0209673_10000011580 252
109 3300025291 Ga0209675_1000001 Ga0209675_1000001954 252
110 3300025294 Ga0209025_1000015 Ga0209025_1000015201 252
111 3300025295 Ga0209564_1000001 Ga0209564_10000011116 252
112 3300025297 Ga0209758_1008563 Ga0209758_10085633 252
113 3300025299 Ga0209256_1000002 Ga0209256_1000002438 252
114 3300025909 Ga0207705_10185034 Ga0207705_101850343 252
115 3300025917 Ga0207660_10092036 Ga0207660_100920363 252
116 3300025919 Ga0207657_10035700 Ga0207657_100357005 252
117 3300025921 Ga0207652_10362763 Ga0207652_103627632 252
118 3300025923 Ga0207681_10035819 Ga0207681_100358192 252
119 3300025932 Ga0207690_10341732 Ga0207690_103417322 252
120 3300025940 Ga0207691_10074765 Ga0207691_100747652 252
121 3300025945 Ga0207679_10203655 Ga0207679_102036552 252
122 3300025960 Ga0207651_10831062 Ga0207651_108310621 252
123 3300026041 Ga0207639_10257539 Ga0207639_102575392 252
124 3300026088 Ga0207641_10053776 Ga0207641_100537762 252
125 3300026089 Ga0207648_10038777 Ga0207648_100387774 252
126 3300027364 Ga0209967_1003495 Ga0209967_10034951 252
127 3300027682 Ga0209971_1001288 Ga0209971_10012884 252
128 3300027876 Ga0209974_10007862 Ga0209974_100078622 252
129 3300028380 Ga0268265_10077448 Ga0268265_100774482 252
130 3300030731 Ga0316177_1067943 Ga0316177_10679435 252
131 3300030733 Ga0314311_1142176 Ga0314311_11421763 252
132 3300031824 Ga0307413_10000580 Ga0307413_100005807 252
133 3300031901 Ga0307406_10004350 Ga0307406_100043503 252
134 3300031903 Ga0307407_10150149 Ga0307407_101501492 252
135 3300031911 Ga0307412_10048645 Ga0307412_100486453 252
136 3300031911 Ga0307412_10054469 Ga0307412_100544692 252
137 3300031911 Ga0307412_10179837 Ga0307412_101798373 252
138 3300031995 Ga0307409_100764623 Ga0307409_1007646231 252
139 3300032004 Ga0307414_10005456 Ga0307414_100054565 252
140 3300032004 Ga0307414_10589827 Ga0307414_105898272 252
141 3300032005 Ga0307411_10016682 Ga0307411_100166825 252
142 3300037418 Ga0395900_0072511 Ga0395900_0072511_1484_2242 252
143 3300037418 Ga0395900_0086726 Ga0395900_0086726_1573_2349 252
144 3300037466 Ga0395898_0217918 Ga0395898_0217918_963_1721 252
145 3300037466 Ga0395898_0343761 Ga0395898_0343761_51_809 252
146 3300037471 Ga0395905_0000855 Ga0395905_0000855_38316_39074 252
147 3300037471 Ga0395905_0415301 Ga0395905_0415301_269_1027 252
148 3300038443 Ga0395901_0055396 Ga0395901_0055396_1379_2137 252
149 3300041404 Ga0439436_0003742 Ga0439436_0003742_2327_3085 252
150 3300041404 Ga0439436_0003760 Ga0439436_0003760_153_911 252
151 3300042004 Ga0439445_0014215 Ga0439445_0014215_809_1567 252
152 3300042015 Ga0439462_0041746 Ga0439462_0041746_95_853 252
153 3300045976 Ga0466967_0697680 Ga0466967_0697680_143_901 252
154 3300046525 Ga0495663_0112335 Ga0495663_0112335_79_837 252
155 3300046615 Ga0495656_0018052 Ga0495656_0018052_1447_2205 252
156 3300048903 Ga0496100_0403763 Ga0496100_0403763_182_940 252
157 3300048905 Ga0496102_0169576 Ga0496102_0169576_875_1633 252
158 3300048911 Ga0496108_0071204 Ga0496108_0071204_800_1558 252
159 3300048911 Ga0496108_0094656 Ga0496108_0094656_558_1316 252
160 3300048912 Ga0496109_0159451 Ga0496109_0159451_734_1495 252
161 3300048913 Ga0496110_0138464 Ga0496110_0138464_785_1543 252
162 3300048914 Ga0496111_0160224 Ga0496111_0160224_670_1428 252
163 3300048915 Ga0496112_0210884 Ga0496112_0210884_722_1480 252
164 3300048916 Ga0496113_0617294 Ga0496113_0617294_67_825 252
165 3300048924 Ga0496121_0004743 Ga0496121_0004743_3805_4563 252
166 3300049568 Ga0501031_0020909 Ga0501031_0020909_2908_3669 252
167 3300049569 Ga0501032_0010490 Ga0501032_0010490_5077_5853 252
168 3300049570 Ga0501033_0014816 Ga0501033_0014816_1068_1826 252
169 3300049571 Ga0501034_0023494 Ga0501034_0023494_4837_5613 252
170 3300049571 Ga0501034_0148029 Ga0501034_0148029_190_951 252
171 3300049573 Ga0501037_0010030 Ga0501037_0010030_702_1478 252
172 3300049573 Ga0501037_0166053 Ga0501037_0166053_712_1473 252
173 3300049574 Ga0501038_0006664 Ga0501038_0006664_743_1519 252
174 3300049575 Ga0501039_0010199 Ga0501039_0010199_1220_1996 252
175 3300049575 Ga0501039_0102638 Ga0501039_0102638_1458_2219 252
176 3300049581 Ga0501047_0169036 Ga0501047_0169036_547_1308 252
177 3300049586 Ga0501070_0029994 Ga0501070_0029994_2465_3241 252
178 3300049742 Ga0501080_0020400 Ga0501080_0020400_4900_5676 252
179 3300049822 Ga0501035_0015265 Ga0501035_0015265_1305_2081 252
180 3300049822 Ga0501035_0175550 Ga0501035_0175550_54_815 252
181 3300049822 Ga0501035_0513094 Ga0501035_0513094_132_893 252
182 3300049823 Ga0501044_0020028 Ga0501044_0020028_1395_2171 252
183 3300049823 Ga0501044_0447124 Ga0501044_0447124_310_1071 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

9

257

0.9

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

14

257

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hc8-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9242 3 226
4fn7-assembly1.cif.gz_B apo structure of the mtb enoyol coa isomerase (rv0632c) 0.9239 2 229
3ot6-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase/isomerase family protein from psudomonas syringae 0.9199 3 229
6c7c-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase, echa3, from mycobacterium ulcerans agy99 0.9146 3 236
1sg4-assembly1.cif.gz_B crystal structure of human mitochondrial delta3-delta2-enoyl-coa isomerase 0.9145 3 251
ID Description Score Start End Superfamily
af_Q9VL67_22_219_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.939 2 195 3.90.226.10
af_P42126_42_246_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9331 1 200 3.90.226.10
6c7cA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9278 1 229 3.90.226.10
af_Q4CTQ3_133_338_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9255 4 200 3.90.226.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9238 96 198 3.90.226.20
ID Description Score Start End GO Terms
AF-A0A508AUT1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9763 2 252 GO:0006635
GO:0016853
AF-B0RY37-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9756 46 251 GO:0006635
AF-A0A5D8YVE4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9737 1 252 GO:0006635
GO:0016853
AF-A0A4V1N1H7-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9718 1 250 GO:0006635
GO:0016853
AF-A0A837APL9-F1-model_v4 Enoyl-CoA hydratase 0.9715 109 251 GO:0006635

Feature Viewer

pLDDT pTM Quality
91.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map