F279173

General Info

Members Datasets Scaffolds Average Seq Length
182 112 181 380

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10005257|Ga0182008_100052571
Length 440
Sequence MTKFRRLLYIAILALGGLPAWGAPGHAASRIKDIADFEGVRDNMLVGYGLVVGLNGTGDTLSQAVFTRESLIGMLERLGVNARDSNLRTANVAAVMVTATLPASAHQGTRVDINVASLGDATSLLGGTLLVTPLVGADGEVYSVAQGTVSSGGFAVKGQAASVTKGVPTSGRIPTGAIVEREVGFQLSQLHSVSLMLHNPDFTTARRVAQVINARLKSEIAQPTDPSTVVLNVPANLKGDIVDLMTDIEQLQIEPDQVARVVIDEQNGIIVMGENVRISTVAVAQGNLTVKITETPQVSQPNAFAPPGQATTFNPLAASGVINNPNPIFNPTLPPASGPFAQPPGNSTLQSQGTIQPFTPPGDANVQFAPGGXXSTVVVPRTSIEVDEQSNRRMAVVRSGVTLQELVNNLNALGVGPRDMISILQAIKAAGALQADIEMM

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
59 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
104 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
105 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
106 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
107 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
110 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 0
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10000250 3300003215 Bacteria 44142
3 JGI25153J46596_10001230 3300003215 Bacteria 15443
4 rootH2_10025783 3300003320 Bacteria 34012
5 rootH2_10033716 3300003320 Unclassified 3674
6 Ga0070658_10305990 3300005327 Bacteria 1356
7 Ga0070676_10089175 3300005328 Bacteria 1886
8 Ga0070683_100208750 3300005329 Bacteria 1855
9 Ga0070680_100001143 3300005336 Bacteria 19030
10 Ga0070663_100215704 3300005455 Bacteria 1505
11 Ga0070681_10003019 3300005458 Bacteria 15617
12 Ga0070681_10022065 3300005458 Bacteria 6388
13 Ga0070707_100080062 3300005468 Bacteria 3153
14 Ga0070698_100213769 3300005471 Bacteria 1863
15 Ga0070679_100000663 3300005530 Bacteria 29349
16 Ga0070679_100033903 3300005530 Bacteria 5056
17 Ga0068855_100003403 3300005563 Bacteria 19479
18 Ga0068855_100498305 3300005563 Bacteria 1324
19 Ga0068857_100066350 3300005577 Bacteria 3211
20 Ga0068856_100350968 3300005614 Bacteria 1494
21 Ga0068863_100105575 3300005841 Bacteria 2679
22 Ga0081455_10001491 3300005937 Bacteria 28956
23 Ga0070717_10016559 3300006028 Bacteria 5717
24 Ga0075436_100037907 3300006914 Bacteria 3327
25 Ga0105240_10000353 3300009093 Bacteria 86068
26 Ga0105240_10001587 3300009093 Bacteria 38589
27 Ga0105240_10015674 3300009093 Bacteria 10291
28 Ga0105240_10028822 3300009093 Bacteria 7243
29 Ga0105240_10175165 3300009093 Bacteria 2536
30 Ga0105240_10347565 3300009093 Unclassified 1683
31 Ga0105241_10000361 3300009174 Bacteria 34490
32 Ga0105238_10037504 3300009551 Bacteria 4927
33 Ga0105238_10076588 3300009551 Bacteria 3336
34 Ga0105249_10152313 3300009553 Bacteria 2227
35 Ga0105239_10006571 3300010375 Bacteria 13469
36 Ga0105239_10304658 3300010375 Bacteria 1794
37 Ga0157370_10004042 3300013104 Bacteria 17036
38 Ga0182008_10005257 3300014497 Bacteria 7406
39 Ga0157376_10170130 3300014969 Bacteria 1983
40 Ga0213872_10000220 3300021361 Bacteria 50540
41 Ga0213872_10000364 3300021361 Bacteria 38189
42 Ga0213872_10019499 3300021361 Bacteria 3123
43 Ga0213872_10027246 3300021361 Bacteria 2624
44 Ga0213875_10000417 3300021388 Bacteria 37407
45 Ga0213875_10000973 3300021388 Bacteria 20505
46 Ga0209233_1000006 3300025261 Bacteria 1473685
47 Ga0209676_1000019 3300025292 Bacteria 620012
48 Ga0209050_1006994 3300025298 Bacteria 6488
49 Ga0207654_10000033 3300025911 Bacteria 115194
50 Ga0207707_10001813 3300025912 Bacteria 19610
51 Ga0207707_10032285 3300025912 Bacteria 4583
52 Ga0207707_10143494 3300025912 Bacteria 2087
53 Ga0207695_10001073 3300025913 Bacteria 47807
54 Ga0207695_10005924 3300025913 Bacteria 16020
55 Ga0207695_10036272 3300025913 Bacteria 5332
56 Ga0207695_10053739 3300025913 Bacteria 4210
57 Ga0207693_10124093 3300025915 Bacteria 2029
58 Ga0207657_10189512 3300025919 Bacteria 1660
59 Ga0207652_10007215 3300025921 Bacteria 8962
60 Ga0207652_10152829 3300025921 Bacteria 2067
61 Ga0207694_10088686 3300025924 Bacteria 2438
62 Ga0207694_10089301 3300025924 Bacteria 2430
63 Ga0207664_10103859 3300025929 Bacteria 2352
64 Ga0207641_10087982 3300026088 Bacteria 2711
65 Ga0207674_10019606 3300026116 Bacteria 7323
66 Ga0207674_10041118 3300026116 Bacteria 4783
67 Ga0265338_10083857 3300028800 Bacteria 2664
68 Ga0265324_10005689 3300029957 Bacteria 5323
69 Ga0265330_10024945 3300031235 Bacteria 2711
70 Ga0265325_10000916 3300031241 Bacteria 21268
71 Ga0265340_10000016 3300031247 Bacteria 94019
72 Ga0265340_10005674 3300031247 Bacteria 6901
73 Ga0265339_10000089 3300031249 Bacteria 77145
74 Ga0265339_10022632 3300031249 Bacteria 3640
75 Ga0265339_10029614 3300031249 Bacteria 3106
76 Ga0265331_10000285 3300031250 Bacteria 56015
77 Ga0265327_10000543 3300031251 Bacteria 64532
78 Ga0265316_10018413 3300031344 Bacteria 6002
79 Ga0265316_10020586 3300031344 Bacteria 5613
80 Ga0265316_10022121 3300031344 Bacteria 5371
81 Ga0265316_10032462 3300031344 Bacteria 4261
82 Ga0265316_10049989 3300031344 Bacteria 3291
83 Ga0265316_10056948 3300031344 Bacteria 3050
84 Ga0265313_10001887 3300031595 Bacteria 19038
85 Ga0265313_10026307 3300031595 Bacteria 3067
86 Ga0265314_10068852 3300031711 Bacteria 2378
87 Ga0265342_10007775 3300031712 Bacteria 7798
88 Ga0265342_10036745 3300031712 Bacteria 2990
89 Ga0316578_10097362 3300031728 Bacteria 1762
90 Ga0307516_10034523 3300031730 Bacteria 5080
91 Ga0373926_0035900 3300035083 Bacteria 1760
92 Ga0373942_0008031 3300035207 Bacteria 2454
93 Ga0373927_0064726 3300035695 Bacteria 2365
94 Ga0373937_0004373 3300036401 Bacteria 11998
95 Ga0316584_0028632 3300036712 Bacteria 4110
96 Ga0316584_0050720 3300036712 Bacteria 3103
97 Ga0395900_0054740 3300037418 Bacteria 4108
98 Ga0395898_0371251 3300037466 Bacteria 1364
99 Ga0436364_1017767 3300037853 Bacteria 4839
100 Ga0436364_1255097 3300037853 Bacteria 56348
101 Ga0395901_0012750 3300038443 Bacteria 8526
102 Ga0395901_0248264 3300038443 Bacteria 1855
103 Ga0400483_099778 3300039062 Bacteria 2196
104 Ga0400483_187940 3300039062 Bacteria 3229
105 Ga0400483_267383 3300039062 Bacteria 3905
106 Ga0436360_0672336 3300039438 Bacteria 2123
107 Ga0436360_0690986 3300039438 Bacteria 1324
108 Ga0436361_0115674 3300039447 Bacteria 5066
109 Ga0436361_0125172 3300039447 Bacteria 55027
110 Ga0436361_0131490 3300039447 Bacteria 1691
111 Ga0436361_0280065 3300039447 Bacteria 2507
112 Ga0436361_0307588 3300039447 Bacteria 2759
113 Ga0436361_0473063 3300039447 Bacteria 2037
114 Ga0436361_0497825 3300039447 Bacteria 5019
115 Ga0436361_0600428 3300039447 Bacteria 8915
116 Ga0436361_0780495 3300039447 Bacteria 34158
117 Ga0436363_1338435 3300039450 Bacteria 4531
118 Ga0451577_0045903 3300042876 Bacteria 3910
119 Ga0451577_0106936 3300042876 Bacteria 2501
120 Ga0451577_0198692 3300042876 Bacteria 1810
121 Ga0453683_0002203 3300044673 Bacteria 15480
122 Ga0466966_0120072 3300044684 Bacteria 1615
123 Ga0453684_0000006 3300044712 Bacteria 1364191
124 Ga0453684_0000048 3300044712 Bacteria 559743
125 Ga0453684_0054038 3300044712 Bacteria 5236
126 Ga0453684_0248106 3300044712 Bacteria 2046
127 Ga0466959_0097125 3300045049 Bacteria 2111
128 Ga0451576_0000402 3300045051 Bacteria 100964
129 Ga0451576_0000947 3300045051 Bacteria 54449
130 Ga0451576_0007035 3300045051 Bacteria 13596
131 Ga0466958_0006721 3300045836 Bacteria 6278
132 Ga0466967_0115323 3300045976 Bacteria 2474
133 Ga0495603_0029338 3300046455 Bacteria 3317
134 Ga0495642_0050733 3300046528 Bacteria 1706
135 Ga0495587_0004994 3300046536 Bacteria 8686
136 Ga0495622_0007229 3300046557 Bacteria 5154
137 Ga0495649_0022995 3300046694 Bacteria 3483
138 Ga0495672_0000485 3300047320 Bacteria 46894
139 Ga0501032_0150076 3300049569 Bacteria 1533
140 Ga0501033_0002881 3300049570 Bacteria 14412
141 Ga0501033_0021674 3300049570 Bacteria 4849
142 Ga0501033_0023231 3300049570 Bacteria 4678
143 Ga0501034_0039537 3300049571 Bacteria 4778
144 Ga0501034_0123169 3300049571 Bacteria 2578
145 Ga0501036_0524177 3300049572 Bacteria 985
146 Ga0501038_0080600 3300049574 Bacteria 2744
147 Ga0501038_0090369 3300049574 Bacteria 2567
148 Ga0501039_0114655 3300049575 Bacteria 2109
149 Ga0501040_0029100 3300049576 Bacteria 3728
150 Ga0501043_0085108 3300049579 Bacteria 2485
151 Ga0501043_0196943 3300049579 Bacteria 1565
152 Ga0501047_0013854 3300049581 Bacteria 7657
153 Ga0501047_0026575 3300049581 Bacteria 5570
154 Ga0501047_0071134 3300049581 Bacteria 3349
155 Ga0501071_0068573 3300049587 Bacteria 2581
156 Ga0501075_0033163 3300049591 Bacteria 3841
157 Ga0501077_0047780 3300049593 Bacteria 2719
158 Ga0501080_0115975 3300049742 Bacteria 2483
159 Ga0501080_0194227 3300049742 Bacteria 1865
160 Ga0501080_0203045 3300049742 Bacteria 1819
161 Ga0501081_0010540 3300049743 Bacteria 6033
162 Ga0501083_0014873 3300049744 Bacteria 5442
163 Ga0501035_0014124 3300049822 Bacteria 7366
164 Ga0501035_0015465 3300049822 Bacteria 7039
165 Ga0501044_0035028 3300049823 Bacteria 5259
166 Ga0501044_0038721 3300049823 Bacteria 4978
167 Ga0501044_0155254 3300049823 Bacteria 2268
168 Ga0501044_0231200 3300049823 Bacteria 1796
169 nmdc:mga08x19_13081_c1 3300050514 Bacteria 5012
170 Ga0500643_000027 3300053087 Bacteria 251062
171 Ga0500555_019324 3300053103 Bacteria 1962
172 Ga0500559_0045361 3300053136 Bacteria 1924
173 Ga0500588_0000406 3300053146 Bacteria 6752
174 Ga0500604_0000485 3300053151 Bacteria 10972
175 Ga0500616_0000921 3300053153 Bacteria 32145
176 Ga0500637_0000496 3300053178 Bacteria 15240
177 Ga0500611_013922 3300053727 Bacteria 1392
178 Ga0501084_0215741 3300054114 Bacteria 1619
179 Ga0501082_0039382 3300060353 Bacteria 4077
180 Ga0501082_0069629 3300060353 Bacteria 3029
181 Ga0501082_0101883 3300060353 Bacteria 2484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0524177 Ga0501036_0524177_36_944 300
2 3300037466 Ga0395898_0371251 Ga0395898_0371251_351_1349 332
3 3300044673 Ga0453683_0002203 Ga0453683_0002203_6021_7115 334
4 3300035695 Ga0373927_0064726 Ga0373927_0064726_834_2051 340
5 3300039447 Ga0436361_0131490 Ga0436361_0131490_462_1631 341
6 3300039447 Ga0436361_0473063 Ga0436361_0473063_26_1195 341
7 3300005458 Ga0070681_10003019 Ga0070681_1000301913 344
8 3300005530 Ga0070679_100000663 Ga0070679_10000066319 344
9 3300009093 Ga0105240_10015674 Ga0105240_100156747 344
10 3300013104 Ga0157370_10004042 Ga0157370_100040429 344
11 3300025912 Ga0207707_10001813 Ga0207707_1000181311 344
12 3300025921 Ga0207652_10007215 Ga0207652_100072154 344
13 3300006914 Ga0075436_100037907 Ga0075436_1000379074 345
14 3300035083 Ga0373926_0035900 Ga0373926_0035900_217_1515 345
15 3300050514 nmdc:mga08x19_13081_c1 nmdc:mga08x19_13081_c1_2506_3804 345
16 3300042876 Ga0451577_0198692 Ga0451577_0198692_315_1430 346
17 3300049742 Ga0501080_0115975 Ga0501080_0115975_1028_2302 347
18 3300049744 Ga0501083_0014873 Ga0501083_0014873_3277_4551 347
19 3300054114 Ga0501084_0215741 Ga0501084_0215741_305_1579 347
20 3300060353 Ga0501082_0069629 Ga0501082_0069629_1253_2527 347
21 3300006028 Ga0070717_10016559 Ga0070717_100165598 348
22 3300021361 Ga0213872_10000220 Ga0213872_1000022020 348
23 3300021361 Ga0213872_10019499 Ga0213872_100194994 348
24 3300039447 Ga0436361_0125172 Ga0436361_0125172_47404_48576 348
25 3300039447 Ga0436361_0280065 Ga0436361_0280065_814_2061 350
26 3300039438 Ga0436360_0690986 Ga0436360_0690986_42_1256 352
27 3300005468 Ga0070707_100080062 Ga0070707_1000800622 353
28 3300005471 Ga0070698_100213769 Ga0070698_1002137691 353
29 3300039062 Ga0400483_099778 Ga0400483_099778_836_1897 353
30 3300039447 Ga0436361_0497825 Ga0436361_0497825_3006_4220 353
31 3300044712 Ga0453684_0054038 Ga0453684_0054038_3541_4692 353
32 3300049570 Ga0501033_0021674 Ga0501033_0021674_440_1540 353
33 3300049570 Ga0501033_0023231 Ga0501033_0023231_1231_2331 353
34 3300049574 Ga0501038_0090369 Ga0501038_0090369_1002_2102 353
35 3300049579 Ga0501043_0085108 Ga0501043_0085108_332_1432 353
36 3300049822 Ga0501035_0014124 Ga0501035_0014124_2072_3172 353
37 3300049823 Ga0501044_0231200 Ga0501044_0231200_411_1511 353
38 3300021361 Ga0213872_10000364 Ga0213872_1000036412 354
39 3300039447 Ga0436361_0780495 Ga0436361_0780495_2575_3789 354
40 3300045836 Ga0466958_0006721 Ga0466958_0006721_4644_5813 356
41 3300044712 Ga0453684_0000006 Ga0453684_0000006_1277113_1278252 358
42 3300053178 Ga0500637_0000496 Ga0500637_0000496_9468_10556 359
43 3300009174 Ga0105241_10000361 Ga0105241_1000036129 360
44 3300025911 Ga0207654_10000033 Ga0207654_1000003384 360
45 3300035207 Ga0373942_0008031 Ga0373942_0008031_39_1232 360
46 3300039438 Ga0436360_0672336 Ga0436360_0672336_99_1193 360
47 3300039450 Ga0436363_1338435 Ga0436363_1338435_1266_2360 360
48 3300042876 Ga0451577_0045903 Ga0451577_0045903_1322_2461 360
49 3300044684 Ga0466966_0120072 Ga0466966_0120072_229_1323 360
50 3300044712 Ga0453684_0000048 Ga0453684_0000048_243789_244928 360
51 3300045049 Ga0466959_0097125 Ga0466959_0097125_229_1323 360
52 3300045051 Ga0451576_0000402 Ga0451576_0000402_84860_85999 360
53 3300029957 Ga0265324_10005689 Ga0265324_100056894 363
54 3300031250 Ga0265331_10000285 Ga0265331_1000028511 363
55 3300045051 Ga0451576_0000947 Ga0451576_0000947_18851_20026 363
56 3300005841 Ga0068863_100105575 Ga0068863_1001055752 365
57 3300021388 Ga0213875_10000973 Ga0213875_100009736 365
58 3300026088 Ga0207641_10087982 Ga0207641_100879822 365
59 3300031730 Ga0307516_10034523 Ga0307516_100345234 365
60 3300037853 Ga0436364_1255097 Ga0436364_1255097_17865_19016 365
61 3300042876 Ga0451577_0106936 Ga0451577_0106936_449_1624 365
62 3300046528 Ga0495642_0050733 Ga0495642_0050733_27_1127 365
63 3300039062 Ga0400483_267383 Ga0400483_267383_749_1867 366
64 3300009093 Ga0105240_10347565 Ga0105240_103475653 367
65 3300031249 Ga0265339_10000089 Ga0265339_1000008946 367
66 3300031344 Ga0265316_10020586 Ga0265316_100205866 367
67 3300031712 Ga0265342_10007775 Ga0265342_100077759 367
68 3300045976 Ga0466967_0115323 Ga0466967_0115323_81_1286 367
69 3300009093 Ga0105240_10001587 Ga0105240_100015874 368
70 3300025913 Ga0207695_10053739 Ga0207695_100537392 368
71 3300044712 Ga0453684_0248106 Ga0453684_0248106_310_1485 368
72 3300045051 Ga0451576_0007035 Ga0451576_0007035_4975_6150 368
73 3300053146 Ga0500588_0000406 Ga0500588_0000406_641_1759 368
74 3300003320 rootH2_10033716 rootH2_100337164 369
75 3300009093 Ga0105240_10000353 Ga0105240_1000035373 369
76 3300021361 Ga0213872_10027246 Ga0213872_100272463 369
77 3300025292 Ga0209676_1000019 Ga0209676_1000019327 369
78 3300025298 Ga0209050_1006994 Ga0209050_10069945 369
79 3300025913 Ga0207695_10001073 Ga0207695_1000107313 369
80 3300031344 Ga0265316_10056948 Ga0265316_100569483 369
81 3300039447 Ga0436361_0115674 Ga0436361_0115674_3031_4155 369
82 3300039447 Ga0436361_0307588 Ga0436361_0307588_1477_2601 369
83 3300039447 Ga0436361_0600428 Ga0436361_0600428_2201_3325 369
84 3300005530 Ga0070679_100033903 Ga0070679_1000339035 370
85 3300025921 Ga0207652_10152829 Ga0207652_101528291 370
86 3300049575 Ga0501039_0114655 Ga0501039_0114655_312_1424 370
87 3300049576 Ga0501040_0029100 Ga0501040_0029100_1736_2848 370
88 3300049587 Ga0501071_0068573 Ga0501071_0068573_353_1465 370
89 3300049591 Ga0501075_0033163 Ga0501075_0033163_471_1583 370
90 3300049743 Ga0501081_0010540 Ga0501081_0010540_3371_4483 370
91 3300060353 Ga0501082_0101883 Ga0501082_0101883_902_2014 370
92 3300003320 rootH2_10025783 rootH2_1002578313 371
93 3300005329 Ga0070683_100208750 Ga0070683_1002087501 371
94 3300014497 Ga0182008_10005257 Ga0182008_100052571 371
95 3300021388 Ga0213875_10000417 Ga0213875_100004177 371
96 3300025915 Ga0207693_10124093 Ga0207693_101240933 371
97 3300026116 Ga0207674_10019606 Ga0207674_100196065 371
98 3300031728 Ga0316578_10097362 Ga0316578_100973621 371
99 3300036401 Ga0373937_0004373 Ga0373937_0004373_2399_3760 371
100 3300037853 Ga0436364_1017767 Ga0436364_1017767_2075_3214 371
101 3300039062 Ga0400483_187940 Ga0400483_187940_1545_2672 371
102 3300049571 Ga0501034_0123169 Ga0501034_0123169_221_1405 371
103 3300049579 Ga0501043_0196943 Ga0501043_0196943_86_1270 371
104 3300049581 Ga0501047_0013854 Ga0501047_0013854_6503_7642 371
105 iso_pu_bacteria 2524023250 2524613041 371
106 3300005458 Ga0070681_10022065 Ga0070681_100220652 372
107 3300025912 Ga0207707_10032285 Ga0207707_100322854 372
108 3300049742 Ga0501080_0203045 Ga0501080_0203045_261_1406 372
109 3300053136 Ga0500559_0045361 Ga0500559_0045361_562_1695 372
110 3300028800 Ga0265338_10083857 Ga0265338_100838573 373
111 3300031344 Ga0265316_10049989 Ga0265316_100499894 373
112 3300036712 Ga0316584_0028632 Ga0316584_0028632_1653_2798 373
113 3300036712 Ga0316584_0050720 Ga0316584_0050720_765_1916 373
114 3300049823 Ga0501044_0038721 Ga0501044_0038721_3223_4362 373
115 3300003215 JGI25153J46596_10000250 JGI25153J46596_1000025028 374
116 3300005937 Ga0081455_10001491 Ga0081455_1000149125 374
117 3300009551 Ga0105238_10076588 Ga0105238_100765884 374
118 3300009553 Ga0105249_10152313 Ga0105249_101523132 374
119 3300025919 Ga0207657_10189512 Ga0207657_101895122 374
120 3300031241 Ga0265325_10000916 Ga0265325_100009162 374
121 3300031249 Ga0265339_10022632 Ga0265339_100226324 374
122 3300031344 Ga0265316_10022121 Ga0265316_100221212 374
123 3300031344 Ga0265316_10032462 Ga0265316_100324624 374
124 3300031595 Ga0265313_10001887 Ga0265313_1000188718 374
125 3300031711 Ga0265314_10068852 Ga0265314_100688523 374
126 3300049571 Ga0501034_0039537 Ga0501034_0039537_1443_2588 374
127 3300049574 Ga0501038_0080600 Ga0501038_0080600_1506_2651 374
128 3300049581 Ga0501047_0026575 Ga0501047_0026575_517_1662 374
129 3300053151 Ga0500604_0000485 Ga0500604_0000485_1681_2871 374
130 3300053153 Ga0500616_0000921 Ga0500616_0000921_18898_20058 374
131 3300005336 Ga0070680_100001143 Ga0070680_10000114316 375
132 3300010375 Ga0105239_10006571 Ga0105239_100065714 375
133 3300025929 Ga0207664_10103859 Ga0207664_101038593 375
134 3300031235 Ga0265330_10024945 Ga0265330_100249454 375
135 3300031247 Ga0265340_10000016 Ga0265340_1000001620 375
136 3300031247 Ga0265340_10005674 Ga0265340_100056745 375
137 3300031249 Ga0265339_10029614 Ga0265339_100296144 375
138 3300031251 Ga0265327_10000543 Ga0265327_100005439 375
139 3300031344 Ga0265316_10018413 Ga0265316_100184133 375
140 3300031595 Ga0265313_10026307 Ga0265313_100263073 375
141 3300031712 Ga0265342_10036745 Ga0265342_100367453 375
142 3300038443 Ga0395901_0248264 Ga0395901_0248264_233_1384 375
143 3300046455 Ga0495603_0029338 Ga0495603_0029338_594_1787 375
144 3300046557 Ga0495622_0007229 Ga0495622_0007229_731_1924 375
145 3300046694 Ga0495649_0022995 Ga0495649_0022995_1440_2633 375
146 3300047320 Ga0495672_0000485 Ga0495672_0000485_20410_21603 375
147 3300049593 Ga0501077_0047780 Ga0501077_0047780_230_1414 375
148 3300049742 Ga0501080_0194227 Ga0501080_0194227_202_1359 375
149 3300049823 Ga0501044_0035028 Ga0501044_0035028_3139_4464 375
150 3300003215 JGI25153J46596_10001230 JGI25153J46596_100012304 376
151 3300005327 Ga0070658_10305990 Ga0070658_103059901 376
152 3300005328 Ga0070676_10089175 Ga0070676_100891753 376
153 3300005455 Ga0070663_100215704 Ga0070663_1002157041 376
154 3300005563 Ga0068855_100003403 Ga0068855_10000340312 376
155 3300005563 Ga0068855_100498305 Ga0068855_1004983051 376
156 3300005577 Ga0068857_100066350 Ga0068857_1000663503 376
157 3300005614 Ga0068856_100350968 Ga0068856_1003509682 376
158 3300009093 Ga0105240_10028822 Ga0105240_100288225 376
159 3300009093 Ga0105240_10175165 Ga0105240_101751654 376
160 3300009551 Ga0105238_10037504 Ga0105238_100375042 376
161 3300010375 Ga0105239_10304658 Ga0105239_103046582 376
162 3300014969 Ga0157376_10170130 Ga0157376_101701302 376
163 3300025912 Ga0207707_10143494 Ga0207707_101434943 376
164 3300025913 Ga0207695_10005924 Ga0207695_100059242 376
165 3300025913 Ga0207695_10036272 Ga0207695_100362722 376
166 3300025924 Ga0207694_10088686 Ga0207694_100886862 376
167 3300025924 Ga0207694_10089301 Ga0207694_100893012 376
168 3300026116 Ga0207674_10041118 Ga0207674_100411183 376
169 3300037418 Ga0395900_0054740 Ga0395900_0054740_2903_4033 376
170 3300038443 Ga0395901_0012750 Ga0395901_0012750_1633_2763 376
171 3300046536 Ga0495587_0004994 Ga0495587_0004994_5919_7097 376
172 3300049569 Ga0501032_0150076 Ga0501032_0150076_318_1493 376
173 3300049570 Ga0501033_0002881 Ga0501033_0002881_10696_11871 376
174 3300049581 Ga0501047_0071134 Ga0501047_0071134_1642_2775 376
175 3300049822 Ga0501035_0015465 Ga0501035_0015465_4406_5677 376
176 3300049823 Ga0501044_0155254 Ga0501044_0155254_157_1332 376
177 3300053087 Ga0500643_000027 Ga0500643_000027_133194_134324 376
178 3300053103 Ga0500555_019324 Ga0500555_019324_18_1148 376
179 3300053727 Ga0500611_013922 Ga0500611_013922_196_1326 376
180 3300060353 Ga0501082_0039382 Ga0501082_0039382_871_2001 376
181 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035240 379
182 3300025261 Ga0209233_1000006 Ga0209233_1000006735 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02119

FlgI

Flagellar P-ring protein

30

328

0.97

PF02119

FlgI

Flagellar P-ring protein

359

439

0.91

Feature Viewer

pLDDT pTM Quality
60.72 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map