F266324

General Info

Members Datasets Scaffolds Average Seq Length
175 130 175 118

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_12748533|Ga0105239_127485332
Length 135
Sequence VPGHNADAAAGSPGDVRAIFEEAARTPDAGRYVLRLYVTGMTPRSVRAVKNLQAICDEYLKGRYELEVIDIYQQPVLTKGEQIIAAPTLIKKLPLPIRRIIGDMSNRDRVLLGLDLVEAAGADRPSGDVKKADHE

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
73 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
74 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
75 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
76 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
79 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 2.29
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10216301 3300005290 Bacteria 1055
2 Ga0065715_10034843 3300005293 Bacteria 2319
3 Ga0070670_100906485 3300005331 Bacteria 799
4 Ga0070677_10232444 3300005333 Unclassified 906
5 Ga0070682_100573839 3300005337 Bacteria 886
6 Ga0070689_100002469 3300005340 Bacteria 12073
7 Ga0070689_100724421 3300005340 Unclassified 870
8 Ga0070691_10431055 3300005341 Unclassified 749
9 Ga0070687_100401852 3300005343 Bacteria 899
10 Ga0070692_10975932 3300005345 Unclassified 591
11 Ga0070671_100462339 3300005355 Unclassified 1089
12 Ga0070688_100097303 3300005365 Unclassified 1934
13 Ga0070659_100156192 3300005366 Bacteria 1863
14 Ga0070705_100002144 3300005440 Bacteria 10035
15 Ga0070705_101448309 3300005440 Bacteria 574
16 Ga0070694_100015097 3300005444 Bacteria 4843
17 Ga0070694_100119265 3300005444 Bacteria 1891
18 Ga0070694_100912150 3300005444 Bacteria 726
19 Ga0070708_102198117 3300005445 Unclassified 510
20 Ga0070685_10031489 3300005466 Bacteria 2964
21 Ga0070707_100453714 3300005468 Bacteria 1243
22 Ga0070707_100782197 3300005468 Bacteria 918
23 Ga0070698_100006248 3300005471 Bacteria 12959
24 Ga0070698_100343882 3300005471 Bacteria 1423
25 Ga0070679_100111243 3300005530 Bacteria 2725
26 Ga0070684_100137512 3300005535 Bacteria 2208
27 Ga0070686_100240777 3300005544 Unclassified 1317
28 Ga0070695_100022122 3300005545 Bacteria 3897
29 Ga0070695_100677100 3300005545 Unclassified 817
30 Ga0070696_100037264 3300005546 Bacteria 3354
31 Ga0070693_100006082 3300005547 Bacteria 5846
32 Ga0070665_100341933 3300005548 Bacteria 1501
33 Ga0070704_100042628 3300005549 Bacteria 3140
34 Ga0070704_100936022 3300005549 Unclassified 781
35 Ga0070704_101160232 3300005549 Unclassified 703
36 Ga0070704_101819886 3300005549 Unclassified 564
37 Ga0068857_100247470 3300005577 Unclassified 1633
38 Ga0068863_101223934 3300005841 Bacteria 757
39 Ga0075368_10097127 3300006042 Unclassified 1208
40 Ga0075362_10273114 3300006177 Unclassified 835
41 Ga0075367_10108879 3300006178 Bacteria 1699
42 Ga0075367_10567529 3300006178 Unclassified 721
43 Ga0097621_100965248 3300006237 Bacteria 796
44 Ga0075370_10016531 3300006353 Bacteria 3971
45 Ga0075428_100040296 3300006844 Bacteria 5140
46 Ga0075428_100277099 3300006844 Unclassified 1805
47 Ga0075428_100985092 3300006844 Bacteria 893
48 Ga0075428_101454457 3300006844 Bacteria 719
49 Ga0075430_101194440 3300006846 Bacteria 626
50 Ga0075431_100023832 3300006847 Bacteria 6264
51 Ga0075431_100572114 3300006847 Bacteria 1116
52 Ga0075433_10027520 3300006852 Bacteria 4823
53 Ga0075433_10057018 3300006852 Bacteria 3414
54 Ga0075434_100012033 3300006871 Bacteria 8188
55 Ga0075429_100023306 3300006880 Bacteria 5369
56 Ga0075429_100066667 3300006880 Bacteria 3134
57 Ga0075429_100522276 3300006880 Unclassified 1040
58 Ga0075429_100546526 3300006880 Unclassified 1015
59 Ga0075435_100048731 3300007076 Bacteria 3404
60 Ga0075435_100076118 3300007076 Bacteria 2749
61 Ga0075435_100362956 3300007076 Unclassified 1243
62 Ga0105240_10754371 3300009093 Unclassified 1058
63 Ga0111539_11425885 3300009094 Bacteria 803
64 Ga0111539_11454235 3300009094 Bacteria 795
65 Ga0114129_10009827 3300009147 Bacteria 13644
66 Ga0114129_10023989 3300009147 Bacteria 8644
67 Ga0114129_11382994 3300009147 Unclassified 869
68 Ga0105243_10117851 3300009148 Bacteria 2233
69 Ga0105241_10897611 3300009174 Unclassified 823
70 Ga0105242_10153790 3300009176 Bacteria 2008
71 Ga0105248_11288812 3300009177 Bacteria 826
72 Ga0105239_12748533 3300010375 Bacteria 574
73 Ga0105239_13331304 3300010375 Unclassified 523
74 Ga0157370_10087108 3300013104 Unclassified 2933
75 Ga0207682_10118453 3300025893 Bacteria 1172
76 Ga0207652_10086632 3300025921 Bacteria 2747
77 Ga0207646_10751138 3300025922 Bacteria 870
78 Ga0207690_10044930 3300025932 Bacteria 2915
79 Ga0207686_10078575 3300025934 Bacteria 2146
80 Ga0207709_10676295 3300025935 Unclassified 824
81 Ga0207709_10702265 3300025935 Bacteria 809
82 Ga0207670_10098407 3300025936 Unclassified 2084
83 Ga0207665_10936396 3300025939 Bacteria 688
84 Ga0207711_11442283 3300025941 Bacteria 631
85 Ga0207667_10309297 3300025949 Bacteria 1614
86 Ga0207641_11100482 3300026088 Bacteria 793
87 Ga0207674_10210991 3300026116 Unclassified 1891
88 Ga0209813_10060666 3300027866 Unclassified 1206
89 Ga0207428_10634928 3300027907 Bacteria 767
90 Ga0268266_12186963 3300028379 Unclassified 525
91 Ga0268265_10863090 3300028380 Bacteria 886
92 Ga0265334_10109487 3300028573 Bacteria 994
93 Ga0265338_10021978 3300028800 Bacteria 6629
94 Ga0265324_10003272 3300029957 Bacteria 7792
95 Ga0265316_10058685 3300031344 Archaea 2996
96 Ga0265316_11111543 3300031344 Bacteria 548
97 Ga0265342_10081428 3300031712 Bacteria 1869
98 Ga0307411_10595751 3300032005 Bacteria 950
99 Ga0373948_0001005 3300034817 Bacteria 3788
100 Ga0373958_0011178 3300034819 Bacteria 1512
101 Ga0373959_0001165 3300034820 Bacteria 4251
102 Ga0373938_0100258 3300034957 Bacteria 726
103 Ga0373929_0003255 3300035085 Bacteria 2938
104 Ga0373940_0004271 3300035088 Bacteria 3008
105 Ga0373949_0001178 3300035090 Bacteria 7767
106 Ga0373951_0007940 3300035091 Bacteria 2404
107 Ga0373932_0003250 3300035112 Bacteria 3934
108 Ga0373939_0001814 3300035114 Bacteria 5141
109 Ga0373941_0023771 3300035115 Bacteria 1753
110 Ga0373943_0074212 3300035170 Bacteria 1729
111 Ga0373961_0003041 3300035241 Bacteria 4225
112 Ga0373962_0005747 3300035242 Bacteria 2995
113 Ga0373931_0004948 3300035691 Bacteria 6127
114 Ga0373927_0120189 3300035695 Bacteria 1715
115 Ga0436364_1282664 3300037853 Unclassified 741
116 Ga0451835_0367811 3300041492 Unclassified 610
117 Ga0451839_1167560 3300041496 Bacteria 566
118 Ga0451577_0027102 3300042876 Bacteria 5188
119 Ga0451577_0158052 3300042876 Unclassified 2041
120 Ga0453683_0045848 3300044673 Bacteria 2741
121 Ga0453683_0069252 3300044673 Bacteria 2206
122 Ga0453683_0129643 3300044673 Bacteria 1589
123 Ga0453683_0265318 3300044673 Unclassified 1095
124 Ga0453684_0000007 3300044712 Bacteria 1301482
125 Ga0453684_0009224 3300044712 Bacteria 17331
126 Ga0453684_0011945 3300044712 Bacteria 14453
127 Ga0453684_0070441 3300044712 Bacteria 4428
128 Ga0453684_0383009 3300044712 Unclassified 1579
129 Ga0453684_0940642 3300044712 Unclassified 923
130 Ga0453684_1004719 3300044712 Unclassified 887
131 Ga0451576_2166810 3300045051 Unclassified 571
132 Ga0495580_0326635 3300046472 Bacteria 1042
133 Ga0495639_0011677 3300046475 Unclassified 3790
134 Ga0495594_0071021 3300046499 Bacteria 1936
135 Ga0495628_0255444 3300046516 Bacteria 1307
136 Ga0495644_0087691 3300046523 Bacteria 1173
137 Ga0495640_0849993 3300046533 Bacteria 542
138 Ga0495586_0416816 3300046535 Unclassified 773
139 Ga0495609_0202002 3300046538 Bacteria 830
140 Ga0495656_0546385 3300046615 Bacteria 617
141 Ga0495588_0034179 3300046674 Bacteria 2572
142 Ga0495599_0131915 3300046678 Bacteria 1552
143 Ga0495623_0598901 3300046679 Unclassified 573
144 Ga0495646_0664768 3300046680 Unclassified 526
145 Ga0496102_0416488 3300048905 Bacteria 1262
146 Ga0496113_1057588 3300048916 Bacteria 638
147 Ga0496114_0355954 3300048917 Bacteria 1295
148 Ga0496115_1057111 3300048918 Bacteria 617
149 Ga0501072_0198119 3300049588 Bacteria 1601
150 Ga0501075_0486544 3300049591 Bacteria 941
151 Ga0501081_0013504 3300049743 Bacteria 5368
152 nmdc:mga06z11_251289_c1 3300050494 Bacteria 1041
153 nmdc:mga04h51_193105_c1 3300050495 Unclassified 797
154 nmdc:mga07m45_116348_c1 3300050496 Bacteria 1542
155 nmdc:mga05p37_44037_c1 3300050507 Bacteria 5491
156 nmdc:mga05p37_86340_c1 3300050507 Bacteria 3867
157 nmdc:mga09592_287736_c2 3300050508 Unclassified 689
158 nmdc:mga0qj67_713327_c1 3300050509 Unclassified 797
159 nmdc:mga06r32_18014_c1 3300050510 Bacteria 6457
160 nmdc:mga06r32_954197_c1 3300050510 Unclassified 812
161 nmdc:mga08y16_610983_c1 3300050511 Bacteria 1098
162 nmdc:mga08y16_953750_c1 3300050511 Bacteria 841
163 nmdc:mga0n895_187443_c1 3300050512 Bacteria 2100
164 nmdc:mga0n895_2086475_c1 3300050512 Bacteria 523
165 nmdc:mga0n895_338415_c1 3300050512 Bacteria 1524
166 nmdc:mga0n895_46044_c1 3300050512 Bacteria 4260
167 nmdc:mga0rr50_30855_c1 3300050513 Bacteria 3800
168 nmdc:mga0rr50_646703_c1 3300050513 Bacteria 902
169 nmdc:mga0rr50_91373_c1 3300050513 Bacteria 2371
170 nmdc:mga0a205_87724_c1 3300050515 Bacteria 3006
171 Ga0495601_0255091 3300053077 Bacteria 1145
172 Ga0495619_0356729 3300053085 Bacteria 1011
173 Ga0501084_0869600 3300054114 Bacteria 758
174 Ga0501082_0299870 3300060353 Bacteria 1399
175 Ga0530510_0154699 3300061734 Unclassified 1694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_2166810 Ga0451576_2166810_99_443 105
2 3300006042 Ga0075368_10097127 Ga0075368_100971273 106
3 3300006177 Ga0075362_10273114 Ga0075362_102731142 106
4 3300006178 Ga0075367_10108879 Ga0075367_101088792 106
5 3300006178 Ga0075367_10567529 Ga0075367_105675292 106
6 3300006353 Ga0075370_10016531 Ga0075370_100165314 106
7 3300027866 Ga0209813_10060666 Ga0209813_100606663 106
8 3300050494 nmdc:mga06z11_251289_c1 nmdc:mga06z11_251289_c1_38_370 106
9 3300050495 nmdc:mga04h51_193105_c1 nmdc:mga04h51_193105_c1_201_533 106
10 3300050496 nmdc:mga07m45_116348_c1 nmdc:mga07m45_116348_c1_53_385 106
11 3300006237 Ga0097621_100965248 Ga0097621_1009652482 107
12 3300009094 Ga0111539_11425885 Ga0111539_114258852 107
13 3300028573 Ga0265334_10109487 Ga0265334_101094872 107
14 3300028800 Ga0265338_10021978 Ga0265338_100219783 107
15 3300029957 Ga0265324_10003272 Ga0265324_100032726 107
16 3300031712 Ga0265342_10081428 Ga0265342_100814282 107
17 3300041492 Ga0451835_0367811 Ga0451835_0367811_244_579 107
18 3300048917 Ga0496114_0355954 Ga0496114_0355954_244_573 107
19 3300048918 Ga0496115_1057111 Ga0496115_1057111_131_460 107
20 3300050511 nmdc:mga08y16_610983_c1 nmdc:mga08y16_610983_c1_301_636 107
21 3300005333 Ga0070677_10232444 Ga0070677_102324442 108
22 3300005340 Ga0070689_100002469 Ga0070689_1000024696 108
23 3300005365 Ga0070688_100097303 Ga0070688_1000973033 108
24 3300005466 Ga0070685_10031489 Ga0070685_100314892 108
25 3300005548 Ga0070665_100341933 Ga0070665_1003419333 108
26 3300005577 Ga0068857_100247470 Ga0068857_1002474702 108
27 3300006844 Ga0075428_101454457 Ga0075428_1014544571 108
28 3300006880 Ga0075429_100066667 Ga0075429_1000666672 108
29 3300009094 Ga0111539_11454235 Ga0111539_114542352 108
30 3300025893 Ga0207682_10118453 Ga0207682_101184532 108
31 3300025936 Ga0207670_10098407 Ga0207670_100984072 108
32 3300025939 Ga0207665_10936396 Ga0207665_109363962 108
33 3300026116 Ga0207674_10210991 Ga0207674_102109912 108
34 3300027907 Ga0207428_10634928 Ga0207428_106349282 108
35 3300028379 Ga0268266_12186963 Ga0268266_121869632 108
36 3300037853 Ga0436364_1282664 Ga0436364_1282664_283_618 108
37 3300044673 Ga0453683_0069252 Ga0453683_0069252_952_1287 108
38 3300050508 nmdc:mga09592_287736_c2 nmdc:mga09592_287736_c2_221_562 108
39 3300050511 nmdc:mga08y16_953750_c1 nmdc:mga08y16_953750_c1_126_467 108
40 3300006847 Ga0075431_100572114 Ga0075431_1005721143 109
41 3300010375 Ga0105239_13331304 Ga0105239_133313041 109
42 3300031344 Ga0265316_10058685 Ga0265316_100586853 109
43 3300031344 Ga0265316_11111543 Ga0265316_111115431 109
44 3300042876 Ga0451577_0027102 Ga0451577_0027102_975_1316 109
45 3300044673 Ga0453683_0265318 Ga0453683_0265318_66_407 109
46 3300044712 Ga0453684_0000007 Ga0453684_0000007_1185266_1185607 109
47 3300044712 Ga0453684_0011945 Ga0453684_0011945_11569_11910 109
48 3300044712 Ga0453684_0383009 Ga0453684_0383009_1218_1559 109
49 3300044712 Ga0453684_1004719 Ga0453684_1004719_436_777 109
50 3300050510 nmdc:mga06r32_954197_c1 nmdc:mga06r32_954197_c1_156_503 109
51 3300005549 Ga0070704_101160232 Ga0070704_1011602321 110
52 3300032005 Ga0307411_10595751 Ga0307411_105957512 110
53 3300034817 Ga0373948_0001005 Ga0373948_0001005_2326_2688 110
54 3300034819 Ga0373958_0011178 Ga0373958_0011178_103_465 110
55 3300034820 Ga0373959_0001165 Ga0373959_0001165_2789_3151 110
56 3300034957 Ga0373938_0100258 Ga0373938_0100258_170_532 110
57 3300035085 Ga0373929_0003255 Ga0373929_0003255_2411_2773 110
58 3300035088 Ga0373940_0004271 Ga0373940_0004271_486_848 110
59 3300035090 Ga0373949_0001178 Ga0373949_0001178_3005_3367 110
60 3300035091 Ga0373951_0007940 Ga0373951_0007940_1972_2334 110
61 3300035112 Ga0373932_0003250 Ga0373932_0003250_169_531 110
62 3300035114 Ga0373939_0001814 Ga0373939_0001814_1894_2256 110
63 3300035115 Ga0373941_0023771 Ga0373941_0023771_672_1034 110
64 3300035241 Ga0373961_0003041 Ga0373961_0003041_2575_2937 110
65 3300035242 Ga0373962_0005747 Ga0373962_0005747_245_607 110
66 3300035691 Ga0373931_0004948 Ga0373931_0004948_4567_4929 110
67 3300042876 Ga0451577_0158052 Ga0451577_0158052_892_1236 110
68 3300044673 Ga0453683_0045848 Ga0453683_0045848_1616_1960 110
69 3300044673 Ga0453683_0129643 Ga0453683_0129643_833_1177 110
70 3300044712 Ga0453684_0009224 Ga0453684_0009224_2481_2825 110
71 3300005331 Ga0070670_100906485 Ga0070670_1009064852 112
72 3300005355 Ga0070671_100462339 Ga0070671_1004623392 112
73 3300044712 Ga0453684_0070441 Ga0453684_0070441_3094_3444 112
74 3300050512 nmdc:mga0n895_2086475_c1 nmdc:mga0n895_2086475_c1_96_449 112
75 3300005340 Ga0070689_100724421 Ga0070689_1007244211 113
76 3300005343 Ga0070687_100401852 Ga0070687_1004018521 113
77 3300005440 Ga0070705_101448309 Ga0070705_1014483091 113
78 3300005445 Ga0070708_102198117 Ga0070708_1021981171 113
79 3300005471 Ga0070698_100343882 Ga0070698_1003438822 113
80 3300005545 Ga0070695_100677100 Ga0070695_1006771002 113
81 3300005841 Ga0068863_101223934 Ga0068863_1012239342 113
82 3300006844 Ga0075428_100040296 Ga0075428_1000402968 113
83 3300006846 Ga0075430_101194440 Ga0075430_1011944402 113
84 3300009147 Ga0114129_11382994 Ga0114129_113829942 113
85 3300009174 Ga0105241_10897611 Ga0105241_108976112 113
86 3300009177 Ga0105248_11288812 Ga0105248_112888122 113
87 3300025922 Ga0207646_10751138 Ga0207646_107511382 113
88 3300025941 Ga0207711_11442283 Ga0207711_114422832 113
89 3300026088 Ga0207641_11100482 Ga0207641_111004822 113
90 3300035170 Ga0373943_0074212 Ga0373943_0074212_1241_1591 113
91 3300035695 Ga0373927_0120189 Ga0373927_0120189_85_435 113
92 3300046516 Ga0495628_0255444 Ga0495628_0255444_367_717 113
93 3300046533 Ga0495640_0849993 Ga0495640_0849993_34_387 113
94 3300046535 Ga0495586_0416816 Ga0495586_0416816_259_609 113
95 3300046678 Ga0495599_0131915 Ga0495599_0131915_692_1042 113
96 3300046679 Ga0495623_0598901 Ga0495623_0598901_94_444 113
97 3300046680 Ga0495646_0664768 Ga0495646_0664768_95_445 113
98 3300050509 nmdc:mga0qj67_713327_c1 nmdc:mga0qj67_713327_c1_240_590 113
99 3300053077 Ga0495601_0255091 Ga0495601_0255091_713_1063 113
100 3300053085 Ga0495619_0356729 Ga0495619_0356729_620_970 113
101 3300005468 Ga0070707_100782197 Ga0070707_1007821972 114
102 3300006847 Ga0075431_100023832 Ga0075431_1000238322 114
103 3300006880 Ga0075429_100522276 Ga0075429_1005222762 114
104 3300044712 Ga0453684_0940642 Ga0453684_0940642_501_857 114
105 3300005293 Ga0065715_10034843 Ga0065715_100348432 115
106 3300005337 Ga0070682_100573839 Ga0070682_1005738391 115
107 3300005345 Ga0070692_10975932 Ga0070692_109759322 115
108 3300005366 Ga0070659_100156192 Ga0070659_1001561922 115
109 3300005530 Ga0070679_100111243 Ga0070679_1001112431 115
110 3300005544 Ga0070686_100240777 Ga0070686_1002407772 115
111 3300005547 Ga0070693_100006082 Ga0070693_1000060823 115
112 3300006844 Ga0075428_100277099 Ga0075428_1002770991 115
113 3300006844 Ga0075428_100985092 Ga0075428_1009850922 115
114 3300006852 Ga0075433_10027520 Ga0075433_100275202 115
115 3300006880 Ga0075429_100023306 Ga0075429_1000233063 115
116 3300006880 Ga0075429_100546526 Ga0075429_1005465262 115
117 3300007076 Ga0075435_100362956 Ga0075435_1003629563 115
118 3300009093 Ga0105240_10754371 Ga0105240_107543712 115
119 3300009147 Ga0114129_10009827 Ga0114129_1000982712 115
120 3300009147 Ga0114129_10023989 Ga0114129_100239895 115
121 3300013104 Ga0157370_10087108 Ga0157370_100871082 115
122 3300025921 Ga0207652_10086632 Ga0207652_100866321 115
123 3300025932 Ga0207690_10044930 Ga0207690_100449303 115
124 3300025935 Ga0207709_10702265 Ga0207709_107022651 115
125 3300025949 Ga0207667_10309297 Ga0207667_103092973 115
126 3300028380 Ga0268265_10863090 Ga0268265_108630903 115
127 3300046499 Ga0495594_0071021 Ga0495594_0071021_346_708 115
128 3300048905 Ga0496102_0416488 Ga0496102_0416488_592_990 115
129 3300049588 Ga0501072_0198119 Ga0501072_0198119_545_910 115
130 3300049591 Ga0501075_0486544 Ga0501075_0486544_522_887 115
131 3300049743 Ga0501081_0013504 Ga0501081_0013504_1718_2083 115
132 3300050507 nmdc:mga05p37_44037_c1 nmdc:mga05p37_44037_c1_1853_2212 115
133 3300050507 nmdc:mga05p37_86340_c1 nmdc:mga05p37_86340_c1_1675_2034 115
134 3300050512 nmdc:mga0n895_338415_c1 nmdc:mga0n895_338415_c1_502_861 115
135 3300054114 Ga0501084_0869600 Ga0501084_0869600_240_605 115
136 3300060353 Ga0501082_0299870 Ga0501082_0299870_591_956 115
137 3300061734 Ga0530510_0154699 Ga0530510_0154699_389_754 115
138 3300005468 Ga0070707_100453714 Ga0070707_1004537142 116
139 3300005535 Ga0070684_100137512 Ga0070684_1001375122 116
140 3300046472 Ga0495580_0326635 Ga0495580_0326635_270_635 116
141 3300046674 Ga0495588_0034179 Ga0495588_0034179_1999_2364 116
142 3300050510 nmdc:mga06r32_18014_c1 nmdc:mga06r32_18014_c1_4066_4428 116
143 3300005290 Ga0065712_10216301 Ga0065712_102163012 117
144 3300005341 Ga0070691_10431055 Ga0070691_104310552 117
145 3300005440 Ga0070705_100002144 Ga0070705_1000021442 117
146 3300005444 Ga0070694_100015097 Ga0070694_1000150972 117
147 3300005444 Ga0070694_100119265 Ga0070694_1001192652 117
148 3300005444 Ga0070694_100912150 Ga0070694_1009121502 117
149 3300005471 Ga0070698_100006248 Ga0070698_1000062484 117
150 3300005545 Ga0070695_100022122 Ga0070695_1000221223 117
151 3300005546 Ga0070696_100037264 Ga0070696_1000372643 117
152 3300005549 Ga0070704_100042628 Ga0070704_1000426283 117
153 3300005549 Ga0070704_100936022 Ga0070704_1009360222 117
154 3300005549 Ga0070704_101819886 Ga0070704_1018198861 117
155 3300006852 Ga0075433_10057018 Ga0075433_100570184 117
156 3300006871 Ga0075434_100012033 Ga0075434_1000120335 117
157 3300007076 Ga0075435_100048731 Ga0075435_1000487312 117
158 3300007076 Ga0075435_100076118 Ga0075435_1000761183 117
159 3300009148 Ga0105243_10117851 Ga0105243_101178512 117
160 3300009176 Ga0105242_10153790 Ga0105242_101537902 117
161 3300010375 Ga0105239_12748533 Ga0105239_127485332 117
162 3300025934 Ga0207686_10078575 Ga0207686_100785752 117
163 3300025935 Ga0207709_10676295 Ga0207709_106762952 117
164 3300041496 Ga0451839_1167560 Ga0451839_1167560_145_513 117
165 3300046475 Ga0495639_0011677 Ga0495639_0011677_3030_3437 117
166 3300046523 Ga0495644_0087691 Ga0495644_0087691_35_412 117
167 3300046538 Ga0495609_0202002 Ga0495609_0202002_134_511 117
168 3300046615 Ga0495656_0546385 Ga0495656_0546385_199_567 117
169 3300048916 Ga0496113_1057588 Ga0496113_1057588_29_382 117
170 3300050512 nmdc:mga0n895_187443_c1 nmdc:mga0n895_187443_c1_1630_1998 117
171 3300050512 nmdc:mga0n895_46044_c1 nmdc:mga0n895_46044_c1_289_648 117
172 3300050513 nmdc:mga0rr50_30855_c1 nmdc:mga0rr50_30855_c1_216_575 117
173 3300050513 nmdc:mga0rr50_646703_c1 nmdc:mga0rr50_646703_c1_412_780 117
174 3300050513 nmdc:mga0rr50_91373_c1 nmdc:mga0rr50_91373_c1_1852_2205 117
175 3300050515 nmdc:mga0a205_87724_c1 nmdc:mga0a205_87724_c1_616_975 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

35

116

0.98

Feature Viewer

pLDDT pTM Quality
60.83 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map