F260226

General Info

Members Datasets Scaffolds Average Seq Length
172 135 159 94

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100203224|Ga0070714_1002032243
Length 104
Sequence MRKPMRLEWSAYALADRTAIFDYIEADSPRAAIAVDDRIREQVATLAQFPHSGRPGRIEGTRELVISRTPYIVACRITGDTVRILRVLHGSRRWPDEVSEESQE

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
5 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
6 2643221723 Ensifer sp. Root278 Isolate Unclassified
7 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
10 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
11 3004167301 Mesorhizobium loti 582 Isolate Unclassified
12 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
66 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
135 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 2.91
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 3.49
Rhizoplane 2.91
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10022727 3300001990 Bacteria 1993
2 Ga0070683_100085219 3300005329 Bacteria 2961
3 Ga0070683_100163373 3300005329 Bacteria 2112
4 Ga0070680_100069884 3300005336 Unclassified 2884
5 Ga0070680_100516695 3300005336 Bacteria 1022
6 Ga0068868_100085243 3300005338 Bacteria 2538
7 Ga0070661_100683449 3300005344 Bacteria 835
8 Ga0070714_100203224 3300005435 Bacteria 1813
9 Ga0070713_100926646 3300005436 Unclassified 839
10 Ga0070710_10544762 3300005437 Bacteria 800
11 Ga0070711_100049817 3300005439 Bacteria 2869
12 Ga0070711_101026267 3300005439 Bacteria 708
13 Ga0070694_100176521 3300005444 Bacteria 1577
14 Ga0070708_100300328 3300005445 Bacteria 1512
15 Ga0070681_10021114 3300005458 Bacteria 6524
16 Ga0070706_101499034 3300005467 Bacteria 616
17 Ga0070707_100097782 3300005468 Bacteria 2843
18 Ga0070707_100515028 3300005468 Bacteria 1158
19 Ga0070707_100800378 3300005468 Unclassified 906
20 Ga0070698_100991044 3300005471 Bacteria 787
21 Ga0070699_100579741 3300005518 Unclassified 1022
22 Ga0070684_100016161 3300005535 Bacteria 6097
23 Ga0070684_100513076 3300005535 Bacteria 1111
24 Ga0068853_100016021 3300005539 Bacteria 6164
25 Ga0068853_101238976 3300005539 Unclassified 721
26 Ga0070693_100055436 3300005547 Bacteria 2283
27 Ga0068855_100075620 3300005563 Bacteria 3910
28 Ga0068855_102427074 3300005563 Unclassified 523
29 Ga0068855_102437699 3300005563 Bacteria 521
30 Ga0068857_100004487 3300005577 Bacteria 11799
31 Ga0068857_100539237 3300005577 Bacteria 1098
32 Ga0068854_101124460 3300005578 Unclassified 701
33 Ga0068856_101193347 3300005614 Bacteria 777
34 Ga0068852_100104666 3300005616 Bacteria 2562
35 Ga0068861_100841340 3300005719 Plasmid 864
36 Ga0068851_10024144 3300005834 Bacteria 2976
37 Ga0070717_10855529 3300006028 Bacteria 827
38 Ga0070717_11132034 3300006028 Unclassified 713
39 Ga0070716_101335780 3300006173 Bacteria 581
40 Ga0070716_101758379 3300006173 Unclassified 512
41 Ga0070712_100073574 3300006175 Bacteria 2452
42 Ga0070712_101153497 3300006175 Unclassified 673
43 Ga0075367_10367090 3300006178 Plasmid 909
44 Ga0075366_10017709 3300006195 Bacteria 4105
45 Ga0097621_101433322 3300006237 Unclassified 654
46 Ga0075370_10034840 3300006353 Plasmid 2823
47 Ga0075431_102028071 3300006847 Bacteria 530
48 Ga0075436_101329129 3300006914 Bacteria 544
49 Ga0105240_10097138 3300009093 Unclassified 3590
50 Ga0105240_12067652 3300009093 Bacteria 591
51 Ga0111539_10483030 3300009094 Bacteria 1443
52 Ga0105245_10003885 3300009098 Bacteria 13293
53 Ga0105245_10556834 3300009098 Bacteria 1169
54 Ga0105247_11859449 3300009101 Unclassified 503
55 Ga0114129_13371959 3300009147 Bacteria 515
56 Ga0105241_10000051 3300009174 Bacteria 95075
57 Ga0105241_10503457 3300009174 Bacteria 1080
58 Ga0105237_12121886 3300009545 Unclassified 571
59 Ga0105238_10043433 3300009551 Bacteria 4548
60 Ga0105238_10208539 3300009551 Bacteria 1930
61 Ga0105239_10231892 3300010375 Bacteria 2071
62 Ga0157370_10031291 3300013104 Bacteria 5207
63 Ga0157369_10052872 3300013105 Bacteria 4392
64 Ga0157369_10814515 3300013105 Bacteria 959
65 Ga0157374_10321823 3300013296 Bacteria 1532
66 Ga0157374_11733124 3300013296 Unclassified 650
67 Ga0157372_10206141 3300013307 Bacteria 2278
68 Ga0157372_11405940 3300013307 Bacteria 804
69 Ga0163163_12099243 3300014325 Plasmid 625
70 Ga0213872_10000030 3300021361 Bacteria 144434
71 Ga0213872_10021005 3300021361 Bacteria 3006
72 Ga0213875_10000231 3300021388 Bacteria 56495
73 Ga0213875_10001759 3300021388 Bacteria 13555
74 Ga0224712_10119945 3300022467 Unclassified 1138
75 Ga0224712_10418304 3300022467 Plasmid 640
76 Ga0224570_106635 3300022730 Bacteria 708
77 Ga0224572_1004955 3300024225 Bacteria 2353
78 Ga0209025_1027376 3300025294 Bacteria 2828
79 Ga0209758_1005655 3300025297 Bacteria 9468
80 Ga0207656_10136835 3300025321 Unclassified 1152
81 Ga0207692_10511611 3300025898 Bacteria 763
82 Ga0207684_11043836 3300025910 Bacteria 682
83 Ga0207654_10000433 3300025911 Bacteria 23979
84 Ga0207654_10067906 3300025911 Bacteria 2108
85 Ga0207707_11284717 3300025912 Bacteria 589
86 Ga0207695_10396318 3300025913 Bacteria 1265
87 Ga0207695_10424862 3300025913 Unclassified 1213
88 Ga0207693_10034788 3300025915 Bacteria 3973
89 Ga0207646_10571201 3300025922 Bacteria 1016
90 Ga0207694_10024838 3300025924 Bacteria 4551
91 Ga0207687_10012461 3300025927 Bacteria 5554
92 Ga0207687_11439544 3300025927 Unclassified 592
93 Ga0207664_10202570 3300025929 Unclassified 1714
94 Ga0207664_11958296 3300025929 Unclassified 509
95 Ga0207665_10135266 3300025939 Bacteria 1753
96 Ga0207665_10826855 3300025939 Unclassified 733
97 Ga0207661_10020919 3300025944 Bacteria 4898
98 Ga0207667_10610199 3300025949 Unclassified 1099
99 Ga0207667_11747101 3300025949 Bacteria 587
100 Ga0207640_10674958 3300025981 Bacteria 883
101 Ga0207639_10313631 3300026041 Bacteria 1390
102 Ga0207639_10515628 3300026041 Bacteria 1094
103 Ga0207702_11973243 3300026078 Bacteria 574
104 Ga0207674_10010072 3300026116 Bacteria 10748
105 Ga0207674_10173139 3300026116 Bacteria 2112
106 Ga0207675_100924633 3300026118 Plasmid 889
107 Ga0207698_10027560 3300026142 Bacteria 4035
108 Ga0265318_10061021 3300028577 Bacteria 1405
109 Ga0265330_10028293 3300031235 Bacteria 2527
110 Ga0265330_10423031 3300031235 Bacteria 564
111 Ga0265329_10128973 3300031242 Bacteria 814
112 Ga0265340_10323551 3300031247 Bacteria 682
113 Ga0265340_10542796 3300031247 Unclassified 512
114 Ga0265339_10130900 3300031249 Bacteria 1283
115 Ga0265331_10053834 3300031250 Bacteria 1918
116 Ga0265327_10000481 3300031251 Bacteria 70259
117 Ga0265327_10338932 3300031251 Bacteria 658
118 Ga0265313_10046950 3300031595 Bacteria 2093
119 Ga0265314_10245235 3300031711 Bacteria 1031
120 Ga0265342_10045192 3300031712 Bacteria 2652
121 Ga0265342_10314502 3300031712 Bacteria 822
122 Ga0316576_10000012 3300031727 Bacteria 50505
123 Ga0316578_10005828 3300031728 Bacteria 6023
124 Ga0316593_10106854 3300032168 Bacteria 997
125 Ga0316592_1061635 3300033524 Bacteria 842
126 Ga0316596_1146651 3300033541 Bacteria 647
127 Ga0373927_0212070 3300035695 Bacteria 1272
128 Ga0436364_0207585 3300037853 Bacteria 136246
129 Ga0436364_0717007 3300037853 Bacteria 89692
130 Ga0400484_27968 3300038725 Bacteria 1696
131 Ga0400483_055315 3300039062 Bacteria 4336
132 Ga0436361_0137633 3300039447 Bacteria 60583
133 Ga0436361_0872724 3300039447 Bacteria 57229
134 Ga0436363_0634054 3300039450 Unclassified 641
135 Ga0451802_1345468 3300041460 Bacteria 669
136 Ga0466972_0004872 3300044658 Bacteria 6731
137 Ga0466964_0259817 3300044706 Bacteria 860
138 Ga0466968_0276028 3300044735 Bacteria 803
139 Ga0466960_0049519 3300044901 Bacteria 2023
140 Ga0451576_0006250 3300045051 Bacteria 14662
141 Ga0495664_0469973 3300046477 Bacteria 752
142 Ga0495628_0104332 3300046516 Bacteria 2185
143 Ga0495672_0075919 3300047320 Bacteria 1889
144 Ga0495683_0115042 3300047323 Bacteria 1281
145 Ga0496100_0522074 3300048903 Bacteria 917
146 Ga0496110_1688489 3300048913 Unclassified 543
147 Ga0496115_0017660 3300048918 Bacteria 5461
148 Ga0501038_0078400 3300049574 Bacteria 2787
149 Ga0501047_0001511 3300049581 Bacteria 22699
150 nmdc:mga0k408_38575_c1 3300050493 Plasmid 2742
151 nmdc:mga06z11_314303_c1 3300050494 Plasmid 933
152 nmdc:mga07m45_127167_c1 3300050496 Plasmid 1474
153 nmdc:mga08y16_1497980_c1 3300050511 Bacteria 635
154 Ga0495601_0902552 3300053077 Unclassified 558
155 Ga0495655_0303902 3300053083 Bacteria 549
156 Ga0500556_0101212 3300053104 Bacteria 1110
157 Ga0500562_030287 3300053108 Bacteria 1425
158 Ga0500616_0017207 3300053153 Bacteria 4104
159 Ga0500611_023761 3300053727 Bacteria 1197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_055315 Ga0400483_055315_3948_4208 86
2 3300005439 Ga0070711_101026267 Ga0070711_1010262671 88
3 iso_pu_bacteria 2830075706 2830077439 88
4 3300048903 Ga0496100_0522074 Ga0496100_0522074_20_295 89
5 iso_pu_bacteria 2558860100 2558864984 89
6 3300039450 Ga0436363_0634054 Ga0436363_0634054_270_545 90
7 3300046516 Ga0495628_0104332 Ga0495628_0104332_1025_1297 90
8 3300028577 Ga0265318_10061021 Ga0265318_100610212 91
9 3300038725 Ga0400484_27968 Ga0400484_27968_1255_1530 91
10 3300048913 Ga0496110_1688489 Ga0496110_1688489_116_391 91
11 3300053077 Ga0495601_0902552 Ga0495601_0902552_202_477 91
12 3300005329 Ga0070683_100085219 Ga0070683_1000852192 92
13 3300005329 Ga0070683_100163373 Ga0070683_1001633733 92
14 3300005336 Ga0070680_100069884 Ga0070680_1000698845 92
15 3300005338 Ga0068868_100085243 Ga0068868_1000852435 92
16 3300005344 Ga0070661_100683449 Ga0070661_1006834491 92
17 3300005436 Ga0070713_100926646 Ga0070713_1009266462 92
18 3300005437 Ga0070710_10544762 Ga0070710_105447623 92
19 3300005439 Ga0070711_100049817 Ga0070711_1000498174 92
20 3300005458 Ga0070681_10021114 Ga0070681_100211146 92
21 3300005535 Ga0070684_100016161 Ga0070684_1000161614 92
22 3300005535 Ga0070684_100513076 Ga0070684_1005130762 92
23 3300005539 Ga0068853_100016021 Ga0068853_1000160216 92
24 3300005539 Ga0068853_101238976 Ga0068853_1012389762 92
25 3300005547 Ga0070693_100055436 Ga0070693_1000554363 92
26 3300005563 Ga0068855_100075620 Ga0068855_1000756203 92
27 3300005563 Ga0068855_102437699 Ga0068855_1024376992 92
28 3300005577 Ga0068857_100539237 Ga0068857_1005392372 92
29 3300005578 Ga0068854_101124460 Ga0068854_1011244602 92
30 3300005614 Ga0068856_101193347 Ga0068856_1011933472 92
31 3300005616 Ga0068852_100104666 Ga0068852_1001046663 92
32 3300005834 Ga0068851_10024144 Ga0068851_100241445 92
33 3300006028 Ga0070717_10855529 Ga0070717_108555292 92
34 3300006028 Ga0070717_11132034 Ga0070717_111320342 92
35 3300006173 Ga0070716_101758379 Ga0070716_1017583792 92
36 3300006175 Ga0070712_100073574 Ga0070712_1000735745 92
37 3300006175 Ga0070712_101153497 Ga0070712_1011534972 92
38 3300006914 Ga0075436_101329129 Ga0075436_1013291292 92
39 3300009093 Ga0105240_10097138 Ga0105240_100971385 92
40 3300009098 Ga0105245_10003885 Ga0105245_1000388514 92
41 3300009098 Ga0105245_10556834 Ga0105245_105568342 92
42 3300009174 Ga0105241_10503457 Ga0105241_105034572 92
43 3300009551 Ga0105238_10043433 Ga0105238_100434336 92
44 3300009551 Ga0105238_10208539 Ga0105238_102085392 92
45 3300010375 Ga0105239_10231892 Ga0105239_102318922 92
46 3300013105 Ga0157369_10052872 Ga0157369_100528722 92
47 3300013105 Ga0157369_10814515 Ga0157369_108145152 92
48 3300013296 Ga0157374_10321823 Ga0157374_103218232 92
49 3300013307 Ga0157372_10206141 Ga0157372_102061412 92
50 3300021361 Ga0213872_10000030 Ga0213872_10000030106 92
51 3300022467 Ga0224712_10119945 Ga0224712_101199452 92
52 3300025321 Ga0207656_10136835 Ga0207656_101368352 92
53 3300025898 Ga0207692_10511611 Ga0207692_105116112 92
54 3300025911 Ga0207654_10067906 Ga0207654_100679062 92
55 3300025913 Ga0207695_10424862 Ga0207695_104248622 92
56 3300025915 Ga0207693_10034788 Ga0207693_100347885 92
57 3300025924 Ga0207694_10024838 Ga0207694_100248386 92
58 3300025927 Ga0207687_10012461 Ga0207687_100124612 92
59 3300025927 Ga0207687_11439544 Ga0207687_114395441 92
60 3300025929 Ga0207664_11958296 Ga0207664_119582961 92
61 3300025939 Ga0207665_10135266 Ga0207665_101352663 92
62 3300025939 Ga0207665_10826855 Ga0207665_108268552 92
63 3300025944 Ga0207661_10020919 Ga0207661_100209193 92
64 3300025949 Ga0207667_10610199 Ga0207667_106101992 92
65 3300025949 Ga0207667_11747101 Ga0207667_117471012 92
66 3300025981 Ga0207640_10674958 Ga0207640_106749582 92
67 3300026041 Ga0207639_10515628 Ga0207639_105156282 92
68 3300026078 Ga0207702_11973243 Ga0207702_119732432 92
69 3300026116 Ga0207674_10173139 Ga0207674_101731392 92
70 3300026142 Ga0207698_10027560 Ga0207698_100275602 92
71 3300039447 Ga0436361_0137633 Ga0436361_0137633_510_794 92
72 iso_pu_bacteria 2643221564 2643837211 92
73 3300006237 Ga0097621_101433322 Ga0097621_1014333222 93
74 3300031727 Ga0316576_10000012 Ga0316576_1000001238 93
75 3300031728 Ga0316578_10005828 Ga0316578_100058284 93
76 3300032168 Ga0316593_10106854 Ga0316593_101068543 93
77 3300033524 Ga0316592_1061635 Ga0316592_10616353 93
78 3300033541 Ga0316596_1146651 Ga0316596_11466512 93
79 iso_pu_bacteria 2643221723 2644672331 93
80 iso_pu_bacteria 2767802442 2770199539 93
81 iso_pu_bacteria 2941499720 2941506947 93
82 iso_pu_bacteria 3004167301 3004174857 93
83 iso_pu_bacteria 3004334049 3004342088 93
84 3300005468 Ga0070707_100097782 Ga0070707_1000977822 94
85 3300005468 Ga0070707_100800378 Ga0070707_1008003782 94
86 3300005518 Ga0070699_100579741 Ga0070699_1005797412 94
87 3300005577 Ga0068857_100004487 Ga0068857_10000448721 94
88 3300009094 Ga0111539_10483030 Ga0111539_104830303 94
89 3300009147 Ga0114129_13371959 Ga0114129_133719592 94
90 3300009545 Ga0105237_12121886 Ga0105237_121218861 94
91 3300013307 Ga0157372_11405940 Ga0157372_114059401 94
92 3300014325 Ga0163163_12099243 Ga0163163_120992432 94
93 3300021388 Ga0213875_10000231 Ga0213875_1000023124 94
94 3300021388 Ga0213875_10001759 Ga0213875_100017595 94
95 3300025294 Ga0209025_1027376 Ga0209025_10273764 94
96 3300026116 Ga0207674_10010072 Ga0207674_1001007216 94
97 3300037853 Ga0436364_0207585 Ga0436364_0207585_44685_44969 94
98 3300037853 Ga0436364_0717007 Ga0436364_0717007_48347_48631 94
99 3300045051 Ga0451576_0006250 Ga0451576_0006250_2655_2939 94
100 3300049574 Ga0501038_0078400 Ga0501038_0078400_306_590 94
101 3300050511 nmdc:mga08y16_1497980_c1 nmdc:mga08y16_1497980_c1_213_497 94
102 3300053104 Ga0500556_0101212 Ga0500556_0101212_25_309 94
103 iso_pu_bacteria 2513237102 2513706992 94
104 iso_pu_bacteria 2513237137 2513862203 94
105 iso_pu_bacteria 2517572143 2517896280 94
106 iso_pu_bacteria 2879099564 2879099972 94
107 iso_pu_bacteria 8019648815 8019659333 94
108 3300005336 Ga0070680_100516695 Ga0070680_1005166952 95
109 3300005563 Ga0068855_102427074 Ga0068855_1024270741 95
110 3300009174 Ga0105241_10000051 Ga0105241_1000005110 95
111 3300022467 Ga0224712_10418304 Ga0224712_104183042 95
112 3300025911 Ga0207654_10000433 Ga0207654_1000043323 95
113 3300025912 Ga0207707_11284717 Ga0207707_112847172 95
114 3300031242 Ga0265329_10128973 Ga0265329_101289731 95
115 3300031247 Ga0265340_10542796 Ga0265340_105427962 95
116 3300031249 Ga0265339_10130900 Ga0265339_101309001 95
117 3300031250 Ga0265331_10053834 Ga0265331_100538342 95
118 3300031595 Ga0265313_10046950 Ga0265313_100469503 95
119 3300031712 Ga0265342_10045192 Ga0265342_100451922 95
120 3300048918 Ga0496115_0017660 Ga0496115_0017660_4786_5082 95
121 3300053153 Ga0500616_0017207 Ga0500616_0017207_1006_1293 95
122 3300005719 Ga0068861_100841340 Ga0068861_1008413401 96
123 3300006178 Ga0075367_10367090 Ga0075367_103670902 96
124 3300006195 Ga0075366_10017709 Ga0075366_100177093 96
125 3300006353 Ga0075370_10034840 Ga0075370_100348404 96
126 3300009093 Ga0105240_12067652 Ga0105240_120676521 96
127 3300013104 Ga0157370_10031291 Ga0157370_100312916 96
128 3300013296 Ga0157374_11733124 Ga0157374_117331242 96
129 3300021361 Ga0213872_10021005 Ga0213872_100210053 96
130 3300025913 Ga0207695_10396318 Ga0207695_103963183 96
131 3300026041 Ga0207639_10313631 Ga0207639_103136311 96
132 3300026118 Ga0207675_100924633 Ga0207675_1009246331 96
133 3300031251 Ga0265327_10000481 Ga0265327_1000048140 96
134 3300031712 Ga0265342_10314502 Ga0265342_103145022 96
135 3300039447 Ga0436361_0872724 Ga0436361_0872724_55879_56175 96
136 3300046477 Ga0495664_0469973 Ga0495664_0469973_376_672 96
137 3300047320 Ga0495672_0075919 Ga0495672_0075919_835_1125 96
138 3300047323 Ga0495683_0115042 Ga0495683_0115042_567_857 96
139 3300050493 nmdc:mga0k408_38575_c1 nmdc:mga0k408_38575_c1_1567_1860 96
140 3300050494 nmdc:mga06z11_314303_c1 nmdc:mga06z11_314303_c1_101_394 96
141 3300050496 nmdc:mga07m45_127167_c1 nmdc:mga07m45_127167_c1_1065_1358 96
142 3300053108 Ga0500562_030287 Ga0500562_030287_33_323 96
143 3300053727 Ga0500611_023761 Ga0500611_023761_586_876 96
144 3300005444 Ga0070694_100176521 Ga0070694_1001765213 97
145 3300031251 Ga0265327_10338932 Ga0265327_103389321 97
146 3300035695 Ga0373927_0212070 Ga0373927_0212070_784_1077 97
147 3300041460 Ga0451802_1345468 Ga0451802_1345468_314_607 97
148 3300044706 Ga0466964_0259817 Ga0466964_0259817_381_674 97
149 3300049581 Ga0501047_0001511 Ga0501047_0001511_20209_20502 97
150 3300053083 Ga0495655_0303902 Ga0495655_0303902_31_324 97
151 3300006173 Ga0070716_101335780 Ga0070716_1013357801 98
152 3300025297 Ga0209758_1005655 Ga0209758_10056553 98
153 3300031235 Ga0265330_10028293 Ga0265330_100282932 98
154 3300031247 Ga0265340_10323551 Ga0265340_103235511 98
155 3300031711 Ga0265314_10245235 Ga0265314_102452352 98
156 3300044658 Ga0466972_0004872 Ga0466972_0004872_3683_3979 98
157 3300044735 Ga0466968_0276028 Ga0466968_0276028_104_400 98
158 3300044901 Ga0466960_0049519 Ga0466960_0049519_955_1251 98
159 3300001990 JGI24737J22298_10022727 JGI24737J22298_100227273 99
160 3300005435 Ga0070714_100203224 Ga0070714_1002032243 99
161 3300005445 Ga0070708_100300328 Ga0070708_1003003283 99
162 3300005467 Ga0070706_101499034 Ga0070706_1014990341 99
163 3300005468 Ga0070707_100515028 Ga0070707_1005150281 99
164 3300005471 Ga0070698_100991044 Ga0070698_1009910442 99
165 3300006847 Ga0075431_102028071 Ga0075431_1020280712 99
166 3300009101 Ga0105247_11859449 Ga0105247_118594492 99
167 3300022730 Ga0224570_106635 Ga0224570_1066351 99
168 3300024225 Ga0224572_1004955 Ga0224572_10049553 99
169 3300025910 Ga0207684_11043836 Ga0207684_110438361 99
170 3300025922 Ga0207646_10571201 Ga0207646_105712011 99
171 3300025929 Ga0207664_10202570 Ga0207664_102025704 99
172 3300031235 Ga0265330_10423031 Ga0265330_104230311 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

7

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9008 1 91
5ceg-assembly1.cif.gz_B x-ray structure of toxin/anti-toxin complex from mesorhizobium opportunistum 0.889 1 92
6xrw-assembly2.cif.gz_C chromosomal parde ta system from p. aeruginosa 0.8881 1 85
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.8795 3 89
8c26-assembly1.cif.gz_A parde2 toxin-antitoxin complex from mycobacterium tuberculosis (rv2142a-rv2142c) 0.8759 2 86
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9312 2 89 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8951 1 93 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8922 2 89 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8805 1 90 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8741 2 89 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A2V8ZJP4-F1-model_v4 Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family 1.005 1 85
AF-A0A7W8ECF1-F1-model_v4 Toxin ParE1/3/4 0.9993 1 91
AF-A0A1W6Q3S0-F1-model_v4 Toxin-antitoxin system toxin RelE/ParE family protein 0.997 1 87
AF-A0A2V9APZ6-F1-model_v4 Type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family 0.9965 1 79
AF-A0A6B3MBY2-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9962 1 87

Feature Viewer

pLDDT pTM Quality
89.97 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map