F256385

General Info

Members Datasets Scaffolds Average Seq Length
170 116 161 106

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100918096|Ga0070665_1009180962
Length 98
Sequence MAFTLEALDARLAERAKASPDESYTAKLLSRGVEKVAQKLGEEAVGKKGELAKEAGDVLYHLLVLLRASGVGLAEVMAELETRTAQSGLAEKASRKKD

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2643221580 Devosia sp. Root635 Isolate Unclassified
3 2643221591 Devosia sp. Root685 Isolate Unclassified
4 2643221674 Devosia sp. Root436 Isolate Unclassified
5 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
6 2932401849 Devosia sp. 2618 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
108 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
109 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
115 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
116 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0.59
Rhizoplane 2.35
Rhizosphere 77.06
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10100664 3300003320 Bacteria 1378
2 Ga0070682_100123212 3300005337 Bacteria 1743
3 Ga0070689_100985701 3300005340 Bacteria 749
4 Ga0070661_100006904 3300005344 Bacteria 7831
5 Ga0070661_100472646 3300005344 Bacteria 1000
6 Ga0070668_100009043 3300005347 Bacteria 7398
7 Ga0070668_101945590 3300005347 Bacteria 542
8 Ga0070673_102209990 3300005364 Bacteria 523
9 Ga0070659_100844375 3300005366 Bacteria 798
10 Ga0070663_100296486 3300005455 Bacteria 1293
11 Ga0070684_100225958 3300005535 Bacteria 1708
12 Ga0068853_100022250 3300005539 Bacteria 5293
13 Ga0068853_100042906 3300005539 Bacteria 3869
14 Ga0070665_100594074 3300005548 Bacteria 1120
15 Ga0070665_100797254 3300005548 Bacteria 958
16 Ga0070665_100918096 3300005548 Bacteria 888
17 Ga0068855_100105128 3300005563 Bacteria 3246
18 Ga0070664_100980270 3300005564 Bacteria 794
19 Ga0068857_100556746 3300005577 Bacteria 1081
20 Ga0068854_100526016 3300005578 Bacteria 1000
21 Ga0068856_100323097 3300005614 Bacteria 1560
22 Ga0068856_100402400 3300005614 Bacteria 1389
23 Ga0068852_100028614 3300005616 Bacteria 4565
24 Ga0068852_100073376 3300005616 Bacteria 3010
25 Ga0068851_10000842 3300005834 Bacteria 13223
26 Ga0075365_10138556 3300006038 Bacteria 1688
27 Ga0075364_10059330 3300006051 Bacteria 2508
28 Ga0075362_10004505 3300006177 Bacteria 5018
29 Ga0075370_10075004 3300006353 Bacteria 1939
30 Ga0099794_10102816 3300007265 Bacteria 1427
31 Ga0105240_10038328 3300009093 Bacteria 6148
32 Ga0105245_10856062 3300009098 Bacteria 949
33 Ga0105241_10255440 3300009174 Bacteria 1488
34 Ga0105237_10111739 3300009545 Bacteria 2724
35 Ga0105238_10010350 3300009551 Bacteria 9359
36 Ga0105238_11471859 3300009551 Bacteria 709
37 Ga0105238_11592812 3300009551 Bacteria 683
38 Ga0105238_12070981 3300009551 Bacteria 603
39 Ga0099796_10400620 3300010159 Unclassified 602
40 Ga0105239_10019235 3300010375 Bacteria 7543
41 Ga0105239_11450905 3300010375 Bacteria 792
42 Ga0157370_11660713 3300013104 Bacteria 574
43 Ga0157369_11014553 3300013105 Bacteria 849
44 Ga0157380_11972306 3300014326 Bacteria 645
45 Ga0163161_10230141 3300017792 Bacteria 1438
46 Ga0207427_103013 3300025231 Bacteria 3895
47 Ga0209233_1000886 3300025261 Bacteria 13166
48 Ga0207656_10000920 3300025321 Bacteria 9602
49 Ga0207695_10699018 3300025913 Bacteria 894
50 Ga0207671_10076325 3300025914 Bacteria 2507
51 Ga0207649_10003449 3300025920 Bacteria 8641
52 Ga0207649_10703418 3300025920 Bacteria 784
53 Ga0207694_10013829 3300025924 Bacteria 6084
54 Ga0207694_11060068 3300025924 Bacteria 686
55 Ga0207687_10170190 3300025927 Bacteria 1679
56 Ga0207690_10151820 3300025932 Bacteria 1718
57 Ga0207670_10727915 3300025936 Bacteria 823
58 Ga0207679_10386811 3300025945 Bacteria 1228
59 Ga0207667_10105987 3300025949 Bacteria 2900
60 Ga0207668_10007293 3300025972 Bacteria 6566
61 Ga0207640_10012203 3300025981 Bacteria 4888
62 Ga0207639_10001067 3300026041 Bacteria 18614
63 Ga0207639_10005199 3300026041 Bacteria 8779
64 Ga0207678_11831026 3300026067 Bacteria 531
65 Ga0207702_10172263 3300026078 Bacteria 1986
66 Ga0207702_10317624 3300026078 Bacteria 1483
67 Ga0207702_11920060 3300026078 Bacteria 583
68 Ga0207674_10432397 3300026116 Bacteria 1272
69 Ga0207698_10003433 3300026142 Bacteria 9537
70 Ga0207698_10140862 3300026142 Bacteria 2078
71 Ga0207698_11096422 3300026142 Bacteria 809
72 Ga0268266_10423330 3300028379 Bacteria 1262
73 Ga0268265_11373360 3300028380 Bacteria 708
74 Ga0265334_10063648 3300028573 Bacteria 1386
75 Ga0265338_10016455 3300028800 Bacteria 8047
76 Ga0265330_10004787 3300031235 Bacteria 6831
77 Ga0265330_10013688 3300031235 Bacteria 3776
78 Ga0265330_10120752 3300031235 Bacteria 1117
79 Ga0265330_10174472 3300031235 Bacteria 911
80 Ga0265328_10008241 3300031239 Bacteria 4309
81 Ga0265328_10177299 3300031239 Bacteria 806
82 Ga0265328_10219507 3300031239 Bacteria 724
83 Ga0265328_10252624 3300031239 Bacteria 675
84 Ga0265325_10001104 3300031241 Bacteria 19384
85 Ga0265325_10004382 3300031241 Bacteria 8929
86 Ga0265329_10007118 3300031242 Bacteria 4357
87 Ga0265329_10058051 3300031242 Bacteria 1226
88 Ga0265339_10000700 3300031249 Bacteria 25973
89 Ga0265339_10035219 3300031249 Bacteria 2810
90 Ga0265331_10002631 3300031250 Bacteria 12053
91 Ga0265331_10027037 3300031250 Bacteria 2880
92 Ga0265327_10047085 3300031251 Bacteria 2277
93 Ga0265327_10090565 3300031251 Bacteria 1492
94 Ga0265316_10019064 3300031344 Bacteria 5878
95 Ga0265316_10052516 3300031344 Bacteria 3197
96 Ga0265316_10091064 3300031344 Bacteria 2327
97 Ga0265316_10928229 3300031344 Bacteria 607
98 Ga0265313_10001294 3300031595 Bacteria 23668
99 Ga0265314_10003337 3300031711 Bacteria 15632
100 Ga0265314_10011623 3300031711 Bacteria 7247
101 Ga0265314_10144396 3300031711 Bacteria 1467
102 Ga0265342_10005668 3300031712 Bacteria 9452
103 Ga0307413_10267138 3300031824 Bacteria 1279
104 Ga0307410_10676799 3300031852 Bacteria 868
105 Ga0307407_11600726 3300031903 Bacteria 517
106 Ga0307412_10354822 3300031911 Bacteria 1179
107 Ga0307412_11245942 3300031911 Bacteria 668
108 Ga0307409_100463474 3300031995 Bacteria 1226
109 Ga0307414_10026741 3300032004 Bacteria 3718
110 Ga0307414_10048870 3300032004 Bacteria 2921
111 Ga0307414_10123513 3300032004 Bacteria 1995
112 Ga0307414_10261505 3300032004 Bacteria 1444
113 Ga0307414_10265138 3300032004 Bacteria 1435
114 Ga0307414_10817688 3300032004 Bacteria 850
115 Ga0307414_10909446 3300032004 Bacteria 807
116 Ga0307414_11233776 3300032004 Bacteria 693
117 Ga0307414_11734655 3300032004 Bacteria 582
118 Ga0307414_11862128 3300032004 Bacteria 561
119 Ga0307414_11947393 3300032004 Bacteria 549
120 Ga0307411_10438910 3300032005 Bacteria 1089
121 Ga0373936_0234260 3300035113 Bacteria 817
122 Ga0373925_0241260 3300037068 Bacteria 1447
123 Ga0395899_0340960 3300037312 Bacteria 1005
124 Ga0436363_0820809 3300039450 Bacteria 1080
125 Ga0436362_1144673 3300039453 Bacteria 669
126 Ga0451797_1583582 3300041453 Bacteria 815
127 Ga0451837_0819150 3300041494 Bacteria 607
128 Ga0466957_0274257 3300044842 Bacteria 1127
129 Ga0466960_0470689 3300044901 Bacteria 733
130 Ga0496110_0135781 3300048913 Bacteria 2223
131 Ga0496110_1512072 3300048913 Bacteria 581
132 Ga0496111_0014051 3300048914 Bacteria 5461
133 Ga0496116_0271164 3300048919 Bacteria 829
134 Ga0496121_0028678 3300048924 Bacteria 5176
135 Ga0496121_0486356 3300048924 Bacteria 787
136 Ga0496124_0061983 3300048927 Bacteria 3132
137 Ga0496124_0110779 3300048927 Bacteria 2210
138 Ga0496125_0000053 3300048928 Bacteria 279909
139 Ga0496125_0201366 3300048928 Bacteria 1303
140 Ga0496126_0033685 3300048929 Bacteria 4818
141 Ga0501034_0005596 3300049571 Bacteria 13683
142 Ga0501034_0062879 3300049571 Bacteria 3727
143 Ga0501034_0162946 3300049571 Bacteria 2200
144 Ga0501034_0330705 3300049571 Bacteria 1455
145 Ga0501034_0436101 3300049571 Bacteria 1229
146 Ga0501036_1539278 3300049572 Bacteria 538
147 Ga0501068_1027040 3300049584 Bacteria 544
148 Ga0501044_0508527 3300049823 Bacteria 1105
149 nmdc:mga03683_4347_c1 3300050489 Bacteria 4689
150 nmdc:mga03n38_175450_c1 3300050490 Bacteria 1095
151 nmdc:mga00v17_300143_c1 3300050491 Bacteria 1043
152 nmdc:mga07m45_27046_c1 3300050496 Bacteria 2038
153 Ga0500651_0278820 3300053093 Bacteria 965
154 Ga0500572_135394 3300053111 Bacteria 801
155 Ga0500652_011685 3300053131 Bacteria 3052
156 Ga0500604_0000406 3300053151 Bacteria 11862
157 Ga0500616_0000001 3300053153 Bacteria 1986011
158 Ga0500634_0053329 3300053161 Bacteria 2169
159 Ga0500645_000109 3300053730 Bacteria 65892
160 Ga0501084_0793093 3300054114 Bacteria 798
161 Ga0501084_1465520 3300054114 Bacteria 571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_11060068 Ga0207694_110600682 90
2 3300005548 Ga0070665_100918096 Ga0070665_1009180962 98
3 iso_pu_bacteria 2643221580 2643911005 100
4 iso_pu_bacteria 2643221591 2643966627 100
5 iso_pu_bacteria 2643221674 2644412251 100
6 iso_pu_bacteria 2932401849 2932405698 100
7 3300039450 Ga0436363_0820809 Ga0436363_0820809_719_1066 102
8 iso_pu_bacteria 8002060224 8002062454 102
9 iso_pu_bacteria 2534681786 2535485530 103
10 iso_pu_bacteria 2829745981 2829747140 103
11 iso_pu_bacteria 643348564 643605082 103
12 iso_pu_bacteria 8005658619 8005661009 103
13 3300005340 Ga0070689_100985701 Ga0070689_1009857012 104
14 3300005347 Ga0070668_100009043 Ga0070668_1000090438 104
15 3300006038 Ga0075365_10138556 Ga0075365_101385562 104
16 3300006051 Ga0075364_10059330 Ga0075364_100593305 104
17 3300006177 Ga0075362_10004505 Ga0075362_100045053 104
18 3300006353 Ga0075370_10075004 Ga0075370_100750042 104
19 3300025936 Ga0207670_10727915 Ga0207670_107279152 104
20 3300025972 Ga0207668_10007293 Ga0207668_1000729310 104
21 3300031235 Ga0265330_10013688 Ga0265330_100136883 104
22 3300031235 Ga0265330_10120752 Ga0265330_101207521 104
23 3300031235 Ga0265330_10174472 Ga0265330_101744722 104
24 3300031239 Ga0265328_10177299 Ga0265328_101772992 104
25 3300031241 Ga0265325_10004382 Ga0265325_1000438212 104
26 3300031249 Ga0265339_10035219 Ga0265339_100352192 104
27 3300031344 Ga0265316_10091064 Ga0265316_100910642 104
28 3300031344 Ga0265316_10928229 Ga0265316_109282292 104
29 3300031711 Ga0265314_10144396 Ga0265314_101443962 104
30 3300031824 Ga0307413_10267138 Ga0307413_102671381 104
31 3300031852 Ga0307410_10676799 Ga0307410_106767992 104
32 3300031903 Ga0307407_11600726 Ga0307407_116007262 104
33 3300031911 Ga0307412_11245942 Ga0307412_112459422 104
34 3300031995 Ga0307409_100463474 Ga0307409_1004634742 104
35 3300032004 Ga0307414_10026741 Ga0307414_100267413 104
36 3300032004 Ga0307414_10048870 Ga0307414_100488705 104
37 3300032004 Ga0307414_10123513 Ga0307414_101235132 104
38 3300032004 Ga0307414_10261505 Ga0307414_102615052 104
39 3300032004 Ga0307414_10817688 Ga0307414_108176882 104
40 3300032004 Ga0307414_10909446 Ga0307414_109094462 104
41 3300032004 Ga0307414_11233776 Ga0307414_112337762 104
42 3300032004 Ga0307414_11734655 Ga0307414_117346551 104
43 3300032005 Ga0307411_10438910 Ga0307411_104389102 104
44 3300041494 Ga0451837_0819150 Ga0451837_0819150_91_408 104
45 3300048913 Ga0496110_1512072 Ga0496110_1512072_175_492 104
46 3300048914 Ga0496111_0014051 Ga0496111_0014051_4629_4946 104
47 3300048919 Ga0496116_0271164 Ga0496116_0271164_382_699 104
48 3300048924 Ga0496121_0486356 Ga0496121_0486356_155_472 104
49 3300048927 Ga0496124_0061983 Ga0496124_0061983_759_1076 104
50 3300048928 Ga0496125_0000053 Ga0496125_0000053_101145_101462 104
51 3300048929 Ga0496126_0033685 Ga0496126_0033685_784_1098 104
52 3300049571 Ga0501034_0005596 Ga0501034_0005596_1014_1331 104
53 3300049571 Ga0501034_0330705 Ga0501034_0330705_873_1190 104
54 3300049571 Ga0501034_0436101 Ga0501034_0436101_403_720 104
55 3300049584 Ga0501068_1027040 Ga0501068_1027040_51_365 104
56 3300049823 Ga0501044_0508527 Ga0501044_0508527_175_489 104
57 3300050489 nmdc:mga03683_4347_c1 nmdc:mga03683_4347_c1_1782_2096 104
58 3300050490 nmdc:mga03n38_175450_c1 nmdc:mga03n38_175450_c1_640_954 104
59 3300050491 nmdc:mga00v17_300143_c1 nmdc:mga00v17_300143_c1_44_358 104
60 3300050496 nmdc:mga07m45_27046_c1 nmdc:mga07m45_27046_c1_1529_1843 104
61 3300053151 Ga0500604_0000406 Ga0500604_0000406_1703_2020 104
62 3300005337 Ga0070682_100123212 Ga0070682_1001232123 105
63 3300005344 Ga0070661_100006904 Ga0070661_1000069049 105
64 3300005344 Ga0070661_100472646 Ga0070661_1004726462 105
65 3300005347 Ga0070668_101945590 Ga0070668_1019455901 105
66 3300005364 Ga0070673_102209990 Ga0070673_1022099901 105
67 3300005366 Ga0070659_100844375 Ga0070659_1008443752 105
68 3300005455 Ga0070663_100296486 Ga0070663_1002964862 105
69 3300005535 Ga0070684_100225958 Ga0070684_1002259582 105
70 3300005539 Ga0068853_100042906 Ga0068853_1000429063 105
71 3300005563 Ga0068855_100105128 Ga0068855_1001051282 105
72 3300005564 Ga0070664_100980270 Ga0070664_1009802702 105
73 3300005577 Ga0068857_100556746 Ga0068857_1005567462 105
74 3300005578 Ga0068854_100526016 Ga0068854_1005260162 105
75 3300005614 Ga0068856_100323097 Ga0068856_1003230971 105
76 3300005614 Ga0068856_100402400 Ga0068856_1004024003 105
77 3300005616 Ga0068852_100028614 Ga0068852_1000286144 105
78 3300005616 Ga0068852_100073376 Ga0068852_1000733766 105
79 3300005834 Ga0068851_10000842 Ga0068851_1000084211 105
80 3300009093 Ga0105240_10038328 Ga0105240_100383286 105
81 3300009098 Ga0105245_10856062 Ga0105245_108560622 105
82 3300009174 Ga0105241_10255440 Ga0105241_102554402 105
83 3300009545 Ga0105237_10111739 Ga0105237_101117392 105
84 3300009551 Ga0105238_10010350 Ga0105238_100103508 105
85 3300009551 Ga0105238_11471859 Ga0105238_114718592 105
86 3300009551 Ga0105238_11592812 Ga0105238_115928122 105
87 3300010375 Ga0105239_10019235 Ga0105239_100192352 105
88 3300010375 Ga0105239_11450905 Ga0105239_114509052 105
89 3300013104 Ga0157370_11660713 Ga0157370_116607132 105
90 3300013105 Ga0157369_11014553 Ga0157369_110145532 105
91 3300014326 Ga0157380_11972306 Ga0157380_119723061 105
92 3300017792 Ga0163161_10230141 Ga0163161_102301412 105
93 3300025321 Ga0207656_10000920 Ga0207656_100009209 105
94 3300025913 Ga0207695_10699018 Ga0207695_106990182 105
95 3300025914 Ga0207671_10076325 Ga0207671_100763253 105
96 3300025920 Ga0207649_10003449 Ga0207649_1000344910 105
97 3300025920 Ga0207649_10703418 Ga0207649_107034182 105
98 3300025924 Ga0207694_10013829 Ga0207694_100138298 105
99 3300025927 Ga0207687_10170190 Ga0207687_101701902 105
100 3300025932 Ga0207690_10151820 Ga0207690_101518202 105
101 3300025945 Ga0207679_10386811 Ga0207679_103868111 105
102 3300025949 Ga0207667_10105987 Ga0207667_101059872 105
103 3300025981 Ga0207640_10012203 Ga0207640_100122039 105
104 3300026041 Ga0207639_10001067 Ga0207639_1000106718 105
105 3300026067 Ga0207678_11831026 Ga0207678_118310262 105
106 3300026078 Ga0207702_10172263 Ga0207702_101722633 105
107 3300026078 Ga0207702_10317624 Ga0207702_103176241 105
108 3300026078 Ga0207702_11920060 Ga0207702_119200601 105
109 3300026116 Ga0207674_10432397 Ga0207674_104323972 105
110 3300026142 Ga0207698_10003433 Ga0207698_100034339 105
111 3300026142 Ga0207698_10140862 Ga0207698_101408623 105
112 3300026142 Ga0207698_11096422 Ga0207698_110964222 105
113 3300028380 Ga0268265_11373360 Ga0268265_113733602 105
114 3300028573 Ga0265334_10063648 Ga0265334_100636482 105
115 3300028800 Ga0265338_10016455 Ga0265338_100164556 105
116 3300031235 Ga0265330_10004787 Ga0265330_100047879 105
117 3300031239 Ga0265328_10252624 Ga0265328_102526241 105
118 3300031241 Ga0265325_10001104 Ga0265325_1000110417 105
119 3300031242 Ga0265329_10007118 Ga0265329_100071183 105
120 3300031249 Ga0265339_10000700 Ga0265339_1000070023 105
121 3300031250 Ga0265331_10027037 Ga0265331_100270375 105
122 3300031344 Ga0265316_10052516 Ga0265316_100525162 105
123 3300031595 Ga0265313_10001294 Ga0265313_1000129410 105
124 3300031711 Ga0265314_10003337 Ga0265314_1000333710 105
125 3300031711 Ga0265314_10011623 Ga0265314_100116232 105
126 3300031712 Ga0265342_10005668 Ga0265342_1000566812 105
127 3300031911 Ga0307412_10354822 Ga0307412_103548222 105
128 3300053093 Ga0500651_0278820 Ga0500651_0278820_379_702 105
129 3300053111 Ga0500572_135394 Ga0500572_135394_44_367 105
130 3300053131 Ga0500652_011685 Ga0500652_011685_285_608 105
131 3300053153 Ga0500616_0000001 Ga0500616_0000001_1194396_1194719 105
132 3300053730 Ga0500645_000109 Ga0500645_000109_44854_45177 105
133 3300054114 Ga0501084_1465520 Ga0501084_1465520_141_464 105
134 3300003320 rootH2_10100664 rootH2_101006643 106
135 3300005539 Ga0068853_100022250 Ga0068853_1000222507 106
136 3300005548 Ga0070665_100594074 Ga0070665_1005940742 106
137 3300005548 Ga0070665_100797254 Ga0070665_1007972542 106
138 3300007265 Ga0099794_10102816 Ga0099794_101028163 106
139 3300009551 Ga0105238_12070981 Ga0105238_120709812 106
140 3300010159 Ga0099796_10400620 Ga0099796_104006202 106
141 3300025231 Ga0207427_103013 Ga0207427_1030132 106
142 3300025261 Ga0209233_1000886 Ga0209233_10008865 106
143 3300026041 Ga0207639_10005199 Ga0207639_1000519912 106
144 3300028379 Ga0268266_10423330 Ga0268266_104233302 106
145 3300031239 Ga0265328_10008241 Ga0265328_100082415 106
146 3300031239 Ga0265328_10219507 Ga0265328_102195072 106
147 3300031242 Ga0265329_10058051 Ga0265329_100580512 106
148 3300031250 Ga0265331_10002631 Ga0265331_100026317 106
149 3300031251 Ga0265327_10047085 Ga0265327_100470853 106
150 3300031251 Ga0265327_10090565 Ga0265327_100905652 106
151 3300031344 Ga0265316_10019064 Ga0265316_100190644 106
152 3300032004 Ga0307414_10265138 Ga0307414_102651382 106
153 3300032004 Ga0307414_11862128 Ga0307414_118621281 106
154 3300032004 Ga0307414_11947393 Ga0307414_119473932 106
155 3300035113 Ga0373936_0234260 Ga0373936_0234260_110_433 106
156 3300037068 Ga0373925_0241260 Ga0373925_0241260_477_800 106
157 3300037312 Ga0395899_0340960 Ga0395899_0340960_321_641 106
158 3300039453 Ga0436362_1144673 Ga0436362_1144673_244_573 106
159 3300041453 Ga0451797_1583582 Ga0451797_1583582_281_601 106
160 3300044842 Ga0466957_0274257 Ga0466957_0274257_686_1024 106
161 3300044901 Ga0466960_0470689 Ga0466960_0470689_146_466 106
162 3300048913 Ga0496110_0135781 Ga0496110_0135781_1743_2063 106
163 3300048924 Ga0496121_0028678 Ga0496121_0028678_577_897 106
164 3300048927 Ga0496124_0110779 Ga0496124_0110779_1592_1936 106
165 3300048928 Ga0496125_0201366 Ga0496125_0201366_386_709 106
166 3300049571 Ga0501034_0062879 Ga0501034_0062879_474_794 106
167 3300049571 Ga0501034_0162946 Ga0501034_0162946_22_357 106
168 3300049572 Ga0501036_1539278 Ga0501036_1539278_71_406 106
169 3300053161 Ga0500634_0053329 Ga0500634_0053329_1629_1952 106
170 3300054114 Ga0501084_0793093 Ga0501084_0793093_20_349 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

5

84

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vrc-assembly1.cif.gz_A crystal structure of cytochrome c' from thermochromatium tepidum 0.9715 33 75
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9453 5 90
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9416 4 94
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.939 5 90
7t8u-assembly1.cif.gz_C structure of psmbeta2 nanotubes 0.9334 38 75
ID Description Score Start End Superfamily
3vrcA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9728 33 75 1.20.120.10
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9625 4 94 1.10.287.1080
4u1cA01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 0.9538 33 69 4.10.860.10
af_P06989_113_203_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9484 5 92 1.10.287.1080
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9424 4 94 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A355RHT4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 1.003 3 75 GO:0000105
GO:0004636
GO:0005524
AF-A0A6B0Z7N5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9886 5 91 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A6L8FI29-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9877 5 91 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A528B9Z4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9809 3 89 GO:0000105
GO:0004636
GO:0005524
AF-A0A355RHT4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9761 3 75 GO:0000105
GO:0004636
GO:0005524

Feature Viewer

pLDDT pTM Quality
92.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map