F256236

General Info

Members Datasets Scaffolds Average Seq Length
170 126 170 191

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000092|Ga0070713_10000009214
Length 216
Sequence MSRRGRAIGFLFGALLAAAAXXTIANGYGDSVVRGYGELRPVLVASGDLEAGKAIDPAIATEKLEVRRVPVRFVPPDALAAPAEAVGLVPAVSVPAGSYLLAAQLRAPEAHPLGAQLGGGRRPVEITVSGAGALAAFGARPVGAKVDVVVTTEPSGSGDGRTYVAAPAVPLLELGPGPEGPDGETATATLGLTRAQALRLIAAESFARRVTVIPRG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10257192 3300005327 Bacteria 1482
2 Ga0070683_100000304 3300005329 Bacteria 33703
3 Ga0070683_100003719 3300005329 Bacteria 12438
4 Ga0070683_100009164 3300005329 Bacteria 8449
5 Ga0070690_100232356 3300005330 Bacteria 1297
6 Ga0070677_10000080 3300005333 Bacteria 30587
7 Ga0070666_10086738 3300005335 Bacteria 2145
8 Ga0070682_100000017 3300005337 Bacteria 235228
9 Ga0070682_100000049 3300005337 Bacteria 127229
10 Ga0068868_100000026 3300005338 Bacteria 81980
11 Ga0070689_100168607 3300005340 Bacteria 1773
12 Ga0070661_100000199 3300005344 Bacteria 49733
13 Ga0070669_100058627 3300005353 Bacteria 2826
14 Ga0070675_100000025 3300005354 Bacteria 115134
15 Ga0070674_100139479 3300005356 Bacteria 1818
16 Ga0070673_100025990 3300005364 Bacteria 4318
17 Ga0070688_100000149 3300005365 Bacteria 37792
18 Ga0070659_100001957 3300005366 Bacteria 14721
19 Ga0070659_100005063 3300005366 Bacteria 9448
20 Ga0070713_100000092 3300005436 Bacteria 57390
21 Ga0070713_100110519 3300005436 Bacteria 2396
22 Ga0070711_100413773 3300005439 Bacteria 1097
23 Ga0070678_100013421 3300005456 Bacteria 5136
24 Ga0070685_10000024 3300005466 Bacteria 101602
25 Ga0070685_10114891 3300005466 Bacteria 1664
26 Ga0070684_100002617 3300005535 Bacteria 13300
27 Ga0070684_100020862 3300005535 Bacteria 5439
28 Ga0070684_100355763 3300005535 Bacteria 1347
29 Ga0070684_100472178 3300005535 Unclassified 1160
30 Ga0068853_100003511 3300005539 Bacteria 11992
31 Ga0068853_100237898 3300005539 Bacteria 1668
32 Ga0070672_100000025 3300005543 Bacteria 67313
33 Ga0070696_100477325 3300005546 Unclassified 988
34 Ga0070665_100003670 3300005548 Bacteria 16268
35 Ga0070665_100308796 3300005548 Bacteria 1585
36 Ga0068855_100068773 3300005563 Bacteria 4122
37 Ga0068854_100003838 3300005578 Bacteria 9413
38 Ga0068854_100013679 3300005578 Bacteria 5332
39 Ga0068856_100024539 3300005614 Bacteria 5870
40 Ga0068852_100020855 3300005616 Bacteria 5216
41 Ga0068864_100000031 3300005618 Bacteria 215331
42 Ga0068866_10094862 3300005718 Bacteria 1633
43 Ga0068858_100000009 3300005842 Bacteria 237748
44 Ga0068858_100000284 3300005842 Bacteria 54715
45 Ga0070712_100005336 3300006175 Bacteria 7957
46 Ga0105245_10000179 3300009098 Bacteria 60347
47 Ga0105245_10014695 3300009098 Bacteria 6816
48 Ga0105247_10023099 3300009101 Bacteria 3745
49 Ga0105241_10182931 3300009174 Bacteria 1740
50 Ga0105242_10100673 3300009176 Bacteria 2448
51 Ga0105248_10000008 3300009177 Bacteria 403910
52 Ga0105249_10602481 3300009553 Unclassified 1153
53 Ga0157374_10007122 3300013296 Bacteria 9526
54 Ga0157378_10001054 3300013297 Bacteria 25233
55 Ga0157378_10010088 3300013297 Bacteria 8235
56 Ga0157372_10008018 3300013307 Bacteria 11233
57 Ga0157375_10009995 3300013308 Bacteria 8340
58 Ga0163163_10157941 3300014325 Bacteria 2312
59 Ga0163163_10252770 3300014325 Unclassified 1813
60 Ga0157380_10000037 3300014326 Bacteria 80856
61 Ga0206353_11131953 3300020082 Bacteria 1533
62 Ga0207682_10000045 3300025893 Bacteria 51744
63 Ga0207642_10006561 3300025899 Bacteria 3879
64 Ga0207710_10020608 3300025900 Unclassified 2820
65 Ga0207680_10039185 3300025903 Bacteria 2748
66 Ga0207705_10098466 3300025909 Bacteria 2149
67 Ga0207654_10311332 3300025911 Bacteria 1073
68 Ga0207693_10009829 3300025915 Bacteria 7784
69 Ga0207663_10408778 3300025916 Unclassified 1039
70 Ga0207649_10000009 3300025920 Bacteria 295544
71 Ga0207681_10082816 3300025923 Bacteria 2269
72 Ga0207659_10000033 3300025926 Bacteria 113729
73 Ga0207687_10000609 3300025927 Bacteria 24091
74 Ga0207687_10005615 3300025927 Bacteria 8292
75 Ga0207700_10000007 3300025928 Bacteria 345720
76 Ga0207700_10132243 3300025928 Bacteria 2039
77 Ga0207690_10043841 3300025932 Bacteria 2946
78 Ga0207686_10380843 3300025934 Bacteria 1070
79 Ga0207691_10000135 3300025940 Bacteria 67302
80 Ga0207711_10000006 3300025941 Bacteria 792692
81 Ga0207661_10000056 3300025944 Bacteria 85250
82 Ga0207661_10000986 3300025944 Bacteria 18816
83 Ga0207661_10003365 3300025944 Bacteria 11111
84 Ga0207667_10056853 3300025949 Bacteria 4108
85 Ga0207712_10070543 3300025961 Bacteria 2510
86 Ga0207640_10000225 3300025981 Bacteria 39704
87 Ga0207640_10002332 3300025981 Bacteria 10205
88 Ga0207677_10000106 3300026023 Bacteria 68108
89 Ga0207703_10000018 3300026035 Bacteria 271377
90 Ga0207703_10000207 3300026035 Bacteria 68866
91 Ga0207639_10002631 3300026041 Bacteria 12052
92 Ga0207702_10007336 3300026078 Bacteria 9418
93 Ga0207676_10000031 3300026095 Bacteria 215877
94 Ga0207683_10040054 3300026121 Bacteria 4087
95 Ga0207698_10002365 3300026142 Bacteria 11183
96 Ga0268266_10000047 3300028379 Bacteria 310996
97 Ga0268266_10002714 3300028379 Bacteria 18561
98 Ga0268266_10258751 3300028379 Bacteria 1612
99 Ga0268266_11410028 3300028379 Unclassified 672
100 Ga0307415_100009525 3300032126 Bacteria 5451
101 Ga0373937_0340452 3300036401 Bacteria 1420
102 Ga0466963_0131805 3300044694 Unclassified 1727
103 Ga0466967_0013813 3300045976 Bacteria 6260
104 Ga0495592_0000494 3300046454 Bacteria 28719
105 Ga0495592_0082287 3300046454 Bacteria 2327
106 Ga0495629_0000145 3300046459 Bacteria 61915
107 Ga0495629_0421125 3300046459 Bacteria 906
108 Ga0495582_0000004 3300046473 Bacteria 168322
109 Ga0495662_0137647 3300046476 Bacteria 1201
110 Ga0495594_0000010 3300046499 Bacteria 118481
111 Ga0495606_0000072 3300046507 Bacteria 173678
112 Ga0495608_0000023 3300046511 Bacteria 160090
113 Ga0495608_0000080 3300046511 Bacteria 71060
114 Ga0495620_0000820 3300046515 Bacteria 19163
115 Ga0495628_0077859 3300046516 Bacteria 2579
116 Ga0495628_0107755 3300046516 Bacteria 2145
117 Ga0495644_0003485 3300046523 Bacteria 6225
118 Ga0495652_0473410 3300046529 Unclassified 873
119 Ga0495587_0003597 3300046536 Bacteria 10320
120 Ga0495621_0003088 3300046539 Bacteria 4548
121 Ga0495645_0477147 3300046543 Bacteria 783
122 Ga0495622_0000104 3300046557 Bacteria 73828
123 Ga0495667_0120103 3300046559 Bacteria 1697
124 Ga0495634_0000034 3300046642 Bacteria 106338
125 Ga0495634_0001636 3300046642 Bacteria 19506
126 Ga0495634_0037330 3300046642 Bacteria 3320
127 Ga0495588_0000244 3300046674 Bacteria 45880
128 Ga0495657_0000020 3300046675 Bacteria 160089
129 Ga0495658_0000004 3300046683 Bacteria 173598
130 Ga0495613_0000251 3300046689 Bacteria 50730
131 Ga0495604_0000106 3300047317 Bacteria 69765
132 Ga0495604_0003919 3300047317 Bacteria 11849
133 Ga0495672_0081870 3300047320 Unclassified 1796
134 Ga0495676_0002352 3300047321 Bacteria 16760
135 Ga0495680_0000183 3300047322 Bacteria 66401
136 Ga0495680_0000447 3300047322 Bacteria 46180
137 Ga0495675_0000506 3300047444 Bacteria 25254
138 Ga0495679_006203 3300047446 Bacteria 5184
139 Ga0495602_0000142 3300048088 Bacteria 66941
140 Ga0496100_0000005 3300048903 Bacteria 312112
141 Ga0496101_0000022 3300048904 Bacteria 216728
142 Ga0496104_0044610 3300048907 Bacteria 4166
143 Ga0496104_0329464 3300048907 Bacteria 1440
144 Ga0496105_0032391 3300048908 Bacteria 4288
145 Ga0496106_0001128 3300048909 Bacteria 19755
146 Ga0496107_0000011 3300048910 Bacteria 201631
147 Ga0496108_0002235 3300048911 Bacteria 15513
148 Ga0496108_0024200 3300048911 Bacteria 5000
149 Ga0496109_0001590 3300048912 Bacteria 18943
150 Ga0496110_0000240 3300048913 Bacteria 35546
151 Ga0496110_0040984 3300048913 Bacteria 4038
152 Ga0496111_0000355 3300048914 Bacteria 22710
153 Ga0496112_0000013 3300048915 Bacteria 237194
154 Ga0496112_0486213 3300048915 Bacteria 1171
155 Ga0496113_0000090 3300048916 Bacteria 39733
156 Ga0496113_0756964 3300048916 Bacteria 773
157 Ga0501072_0067044 3300049588 Bacteria 2832
158 Ga0501045_0082369 3300049824 Bacteria 2373
159 Ga0495601_0000027 3300053077 Bacteria 116790
160 Ga0495601_0000066 3300053077 Bacteria 56855
161 Ga0495601_0063738 3300053077 Bacteria 2343
162 Ga0495601_0156279 3300053077 Bacteria 1489
163 Ga0495612_0005804 3300053078 Bacteria 5097
164 Ga0495655_0000478 3300053083 Bacteria 6692
165 Ga0495595_0000022 3300053084 Bacteria 110598
166 Ga0495595_0003370 3300053084 Bacteria 6343
167 Ga0495619_0000008 3300053085 Bacteria 305999
168 Ga0495619_0000152 3300053085 Bacteria 51090
169 Ga0495619_0000222 3300053085 Bacteria 41071
170 Ga0501082_0285435 3300060353 Bacteria 1437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10100673 Ga0105242_101006733 130
2 3300047322 Ga0495680_0000447 Ga0495680_0000447_19640_20269 139
3 3300014325 Ga0163163_10157941 Ga0163163_101579412 144
4 3300048915 Ga0496112_0486213 Ga0496112_0486213_373_1020 144
5 3300053077 Ga0495601_0000066 Ga0495601_0000066_52334_52990 146
6 3300005539 Ga0068853_100237898 Ga0068853_1002378981 147
7 3300025934 Ga0207686_10380843 Ga0207686_103808432 148
8 3300009098 Ga0105245_10000179 Ga0105245_1000017949 149
9 3300025927 Ga0207687_10000609 Ga0207687_1000060922 149
10 3300047446 Ga0495679_006203 Ga0495679_006203_903_1559 149
11 3300046516 Ga0495628_0077859 Ga0495628_0077859_529_1185 150
12 3300005539 Ga0068853_100003511 Ga0068853_1000035114 151
13 3300026041 Ga0207639_10002631 Ga0207639_1000263111 151
14 3300046454 Ga0495592_0000494 Ga0495592_0000494_25278_25934 151
15 3300009553 Ga0105249_10602481 Ga0105249_106024812 152
16 3300025961 Ga0207712_10070543 Ga0207712_100705432 152
17 3300053077 Ga0495601_0063738 Ga0495601_0063738_108_755 153
18 3300005842 Ga0068858_100000009 Ga0068858_10000000933 155
19 3300026035 Ga0207703_10000207 Ga0207703_1000020739 155
20 3300028379 Ga0268266_10000047 Ga0268266_1000004733 155
21 3300047322 Ga0495680_0000183 Ga0495680_0000183_57415_58050 155
22 3300005353 Ga0070669_100058627 Ga0070669_1000586273 158
23 3300025923 Ga0207681_10082816 Ga0207681_100828162 158
24 3300046529 Ga0495652_0473410 Ga0495652_0473410_174_809 158
25 3300046473 Ga0495582_0000004 Ga0495582_0000004_52737_53393 159
26 3300046683 Ga0495658_0000004 Ga0495658_0000004_86163_86819 159
27 3300048915 Ga0496112_0000013 Ga0496112_0000013_125410_126066 160
28 3300013296 Ga0157374_10007122 Ga0157374_100071227 161
29 3300005333 Ga0070677_10000080 Ga0070677_100000807 163
30 3300025893 Ga0207682_10000045 Ga0207682_100000457 163
31 3300005614 Ga0068856_100024539 Ga0068856_1000245395 165
32 3300026078 Ga0207702_10007336 Ga0207702_100073369 165
33 3300046511 Ga0495608_0000080 Ga0495608_0000080_21790_22425 167
34 3300046523 Ga0495644_0003485 Ga0495644_0003485_4516_5172 167
35 3300046642 Ga0495634_0037330 Ga0495634_0037330_2588_3235 167
36 3300005364 Ga0070673_100025990 Ga0070673_1000259905 168
37 3300005366 Ga0070659_100005063 Ga0070659_1000050637 169
38 3300005842 Ga0068858_100000284 Ga0068858_10000028439 169
39 3300026035 Ga0207703_10000018 Ga0207703_10000018150 169
40 3300046543 Ga0495645_0477147 Ga0495645_0477147_69_716 169
41 3300036401 Ga0373937_0340452 Ga0373937_0340452_772_1383 170
42 3300046557 Ga0495622_0000104 Ga0495622_0000104_36722_37378 170
43 3300048911 Ga0496108_0024200 Ga0496108_0024200_1707_2363 170
44 3300048916 Ga0496113_0756964 Ga0496113_0756964_81_737 170
45 3300013297 Ga0157378_10010088 Ga0157378_100100884 171
46 3300048088 Ga0495602_0000142 Ga0495602_0000142_12000_12656 171
47 3300005356 Ga0070674_100139479 Ga0070674_1001394792 174
48 3300014325 Ga0163163_10252770 Ga0163163_102527703 174
49 3300046476 Ga0495662_0137647 Ga0495662_0137647_11_538 174
50 3300032126 Ga0307415_100009525 Ga0307415_1000095257 175
51 3300046515 Ga0495620_0000820 Ga0495620_0000820_8702_9370 175
52 3300046559 Ga0495667_0120103 Ga0495667_0120103_312_968 175
53 3300045976 Ga0466967_0013813 Ga0466967_0013813_5152_5808 177
54 3300046459 Ga0495629_0000145 Ga0495629_0000145_50222_50869 177
55 3300046642 Ga0495634_0001636 Ga0495634_0001636_3319_3975 177
56 3300005546 Ga0070696_100477325 Ga0070696_1004773252 178
57 3300005548 Ga0070665_100308796 Ga0070665_1003087962 179
58 3300005718 Ga0068866_10094862 Ga0068866_100948622 179
59 3300025899 Ga0207642_10006561 Ga0207642_100065612 179
60 3300028379 Ga0268266_10258751 Ga0268266_102587512 179
61 3300046454 Ga0495592_0082287 Ga0495592_0082287_114_770 179
62 3300005329 Ga0070683_100003719 Ga0070683_10000371910 181
63 3300005535 Ga0070684_100002617 Ga0070684_1000026179 181
64 3300006175 Ga0070712_100005336 Ga0070712_1000053364 181
65 3300009174 Ga0105241_10182931 Ga0105241_101829312 181
66 3300025911 Ga0207654_10311332 Ga0207654_103113322 181
67 3300025915 Ga0207693_10009829 Ga0207693_100098297 181
68 3300025944 Ga0207661_10003365 Ga0207661_1000336510 181
69 3300046459 Ga0495629_0421125 Ga0495629_0421125_118_774 183
70 3300005578 Ga0068854_100003838 Ga0068854_1000038388 184
71 3300025981 Ga0207640_10002332 Ga0207640_100023328 184
72 3300053085 Ga0495619_0000008 Ga0495619_0000008_15571_16227 185
73 3300020082 Ga0206353_11131953 Ga0206353_111319532 188
74 3300044694 Ga0466963_0131805 Ga0466963_0131805_43_687 188
75 3300005330 Ga0070690_100232356 Ga0070690_1002323562 189
76 3300005335 Ga0070666_10086738 Ga0070666_100867382 189
77 3300005548 Ga0070665_100003670 Ga0070665_10000367012 189
78 3300005618 Ga0068864_100000031 Ga0068864_100000031194 189
79 3300014326 Ga0157380_10000037 Ga0157380_1000003780 189
80 3300025903 Ga0207680_10039185 Ga0207680_100391853 189
81 3300026095 Ga0207676_10000031 Ga0207676_10000031193 189
82 3300028379 Ga0268266_10002714 Ga0268266_100027148 189
83 3300046539 Ga0495621_0003088 Ga0495621_0003088_3803_4459 189
84 3300005329 Ga0070683_100000304 Ga0070683_10000030425 190
85 3300005535 Ga0070684_100020862 Ga0070684_1000208626 190
86 3300013297 Ga0157378_10001054 Ga0157378_1000105419 190
87 3300025944 Ga0207661_10000056 Ga0207661_1000005682 190
88 3300048911 Ga0496108_0002235 Ga0496108_0002235_7377_8030 190
89 3300048912 Ga0496109_0001590 Ga0496109_0001590_7554_8207 190
90 3300005354 Ga0070675_100000025 Ga0070675_10000002572 191
91 3300025926 Ga0207659_10000033 Ga0207659_1000003364 191
92 3300046511 Ga0495608_0000023 Ga0495608_0000023_8970_9593 191
93 3300046675 Ga0495657_0000020 Ga0495657_0000020_8970_9593 191
94 3300047444 Ga0495675_0000506 Ga0495675_0000506_8952_9575 191
95 3300048907 Ga0496104_0329464 Ga0496104_0329464_13_669 191
96 3300048908 Ga0496105_0032391 Ga0496105_0032391_951_1607 191
97 3300048916 Ga0496113_0000090 Ga0496113_0000090_20428_21075 191
98 3300053084 Ga0495595_0000022 Ga0495595_0000022_101006_101629 191
99 3300053085 Ga0495619_0000152 Ga0495619_0000152_20379_21002 191
100 3300060353 Ga0501082_0285435 Ga0501082_0285435_389_1012 191
101 3300005337 Ga0070682_100000049 Ga0070682_10000004955 192
102 3300005535 Ga0070684_100355763 Ga0070684_1003557631 192
103 3300009098 Ga0105245_10014695 Ga0105245_100146956 192
104 3300013307 Ga0157372_10008018 Ga0157372_100080184 192
105 3300025927 Ga0207687_10005615 Ga0207687_100056158 192
106 3300046536 Ga0495587_0003597 Ga0495587_0003597_9280_9936 192
107 3300048913 Ga0496110_0000240 Ga0496110_0000240_23468_24115 192
108 3300048914 Ga0496111_0000355 Ga0496111_0000355_5139_5786 192
109 3300005340 Ga0070689_100168607 Ga0070689_1001686072 193
110 3300005436 Ga0070713_100110519 Ga0070713_1001105193 193
111 3300005439 Ga0070711_100413773 Ga0070711_1004137732 193
112 3300005563 Ga0068855_100068773 Ga0068855_1000687735 193
113 3300005616 Ga0068852_100020855 Ga0068852_1000208552 193
114 3300013308 Ga0157375_10009995 Ga0157375_100099959 193
115 3300025916 Ga0207663_10408778 Ga0207663_104087782 193
116 3300025928 Ga0207700_10132243 Ga0207700_101322432 193
117 3300025949 Ga0207667_10056853 Ga0207667_100568535 193
118 3300026142 Ga0207698_10002365 Ga0207698_1000236513 193
119 3300053085 Ga0495619_0000222 Ga0495619_0000222_19141_19788 193
120 3300005344 Ga0070661_100000199 Ga0070661_10000019912 194
121 3300005543 Ga0070672_100000025 Ga0070672_10000002522 194
122 3300025920 Ga0207649_10000009 Ga0207649_1000000984 194
123 3300025940 Ga0207691_10000135 Ga0207691_1000013553 194
124 3300046516 Ga0495628_0107755 Ga0495628_0107755_486_1133 194
125 3300047317 Ga0495604_0000106 Ga0495604_0000106_23157_23810 194
126 3300047317 Ga0495604_0003919 Ga0495604_0003919_2660_3310 194
127 3300053083 Ga0495655_0000478 Ga0495655_0000478_2072_2719 194
128 3300053084 Ga0495595_0003370 Ga0495595_0003370_4038_4688 194
129 3300005329 Ga0070683_100009164 Ga0070683_1000091646 195
130 3300005337 Ga0070682_100000017 Ga0070682_100000017121 195
131 3300005535 Ga0070684_100472178 Ga0070684_1004721782 195
132 3300009177 Ga0105248_10000008 Ga0105248_10000008185 195
133 3300025941 Ga0207711_10000006 Ga0207711_10000006580 195
134 3300025944 Ga0207661_10000986 Ga0207661_1000098610 195
135 3300049588 Ga0501072_0067044 Ga0501072_0067044_947_1597 195
136 3300049824 Ga0501045_0082369 Ga0501045_0082369_852_1502 195
137 3300005338 Ga0068868_100000026 Ga0068868_10000002624 196
138 3300026023 Ga0207677_10000106 Ga0207677_1000010611 196
139 3300046499 Ga0495594_0000010 Ga0495594_0000010_85389_86045 196
140 3300046689 Ga0495613_0000251 Ga0495613_0000251_38213_38863 196
141 3300047320 Ga0495672_0081870 Ga0495672_0081870_212_859 196
142 3300053077 Ga0495601_0000027 Ga0495601_0000027_26649_27299 196
143 3300005456 Ga0070678_100013421 Ga0070678_1000134212 197
144 3300005466 Ga0070685_10114891 Ga0070685_101148913 197
145 3300026121 Ga0207683_10040054 Ga0207683_100400542 197
146 3300046642 Ga0495634_0000034 Ga0495634_0000034_92406_93062 197
147 3300053078 Ga0495612_0005804 Ga0495612_0005804_266_913 197
148 3300005365 Ga0070688_100000149 Ga0070688_10000014927 198
149 3300005466 Ga0070685_10000024 Ga0070685_1000002427 198
150 3300005366 Ga0070659_100001957 Ga0070659_1000019576 199
151 3300005578 Ga0068854_100013679 Ga0068854_1000136796 199
152 3300025932 Ga0207690_10043841 Ga0207690_100438413 199
153 3300025981 Ga0207640_10000225 Ga0207640_1000022536 199
154 3300028379 Ga0268266_11410028 Ga0268266_114100281 200
155 3300046674 Ga0495588_0000244 Ga0495588_0000244_34057_34701 200
156 3300047321 Ga0495676_0002352 Ga0495676_0002352_16090_16746 200
157 3300048903 Ga0496100_0000005 Ga0496100_0000005_189615_190271 200
158 3300048904 Ga0496101_0000022 Ga0496101_0000022_51415_52071 200
159 3300048909 Ga0496106_0001128 Ga0496106_0001128_7745_8401 200
160 3300048910 Ga0496107_0000011 Ga0496107_0000011_121612_122268 200
161 3300053077 Ga0495601_0156279 Ga0495601_0156279_138_785 200
162 3300005327 Ga0070658_10257192 Ga0070658_102571922 201
163 3300005436 Ga0070713_100000092 Ga0070713_10000009214 201
164 3300009101 Ga0105247_10023099 Ga0105247_100230993 201
165 3300025900 Ga0207710_10020608 Ga0207710_100206082 201
166 3300025909 Ga0207705_10098466 Ga0207705_100984662 201
167 3300025928 Ga0207700_10000007 Ga0207700_1000000747 201
168 3300046507 Ga0495606_0000072 Ga0495606_0000072_122187_122834 201
169 3300048907 Ga0496104_0044610 Ga0496104_0044610_2067_2720 201
170 3300048913 Ga0496110_0040984 Ga0496110_0040984_1155_1802 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08666

SAF

SAF domain

40

106

0.94

Feature Viewer

pLDDT pTM Quality
79.38 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map