F255041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 169 | 117 | 169 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10363566|Ga0307406_103635662 |
| Length | 297 |
| Sequence | VFRLRMQSAGPGQRYNPDVGRRRTVSFQGEKGAFSQVAVQQLLGPEVEVRPCQRFEEVFRALADGDVDAAVVPIENTLHGSVHENYDHLVNFELQIHAETNVRISHTLIACPGVPFRKLRRVFSHPVALNQCVTFFRENPQLERVPFYDTAGSVKMLMEEKPADAAAIASAIAADLYGAKTLKRGIEDDPSNFTRFFLLKRPGSRQTRTGEVQWKTSLVFQTRNVPGALFRCLSAFALRDISCTKIESRPLRGKPWEYWFYLDFLGRADDEIPQKALGHLSEMADFLRVLGTYPKAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 24 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 25 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 41 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 42 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 43 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 57 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 58 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 59 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 60 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 61 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 62 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 63 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 64 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 66 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 67 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 68 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 69 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 70 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 71 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 72 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 73 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 74 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 75 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 76 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 77 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 78 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 106 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 107 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 108 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0 |
| Rhizoplane | 1.78 |
| Rhizosphere | 86.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100300456 | 3300005331 | Bacteria | 1404 |
| 2 | Ga0070680_100055274 | 3300005336 | Unclassified | 3244 |
| 3 | Ga0070680_100147847 | 3300005336 | Unclassified | 1972 |
| 4 | Ga0070714_100086027 | 3300005435 | Unclassified | 2747 |
| 5 | Ga0070711_100035076 | 3300005439 | Bacteria | 3351 |
| 6 | Ga0070705_100118144 | 3300005440 | Bacteria | 1707 |
| 7 | Ga0070708_100233544 | 3300005445 | Bacteria | 1726 |
| 8 | Ga0070663_100129745 | 3300005455 | Bacteria | 1913 |
| 9 | Ga0070681_10010865 | 3300005458 | Bacteria | 9000 |
| 10 | Ga0070681_10094872 | 3300005458 | Bacteria | 2932 |
| 11 | Ga0070681_10439787 | 3300005458 | Bacteria | 1216 |
| 12 | Ga0070685_10341458 | 3300005466 | Unclassified | 1021 |
| 13 | Ga0070699_100013927 | 3300005518 | Bacteria | 6917 |
| 14 | Ga0070679_100011196 | 3300005530 | Bacteria | 8549 |
| 15 | Ga0070684_100448972 | 3300005535 | Bacteria | 1192 |
| 16 | Ga0070697_100013288 | 3300005536 | Bacteria | 6459 |
| 17 | Ga0070695_100037810 | 3300005545 | Bacteria | 3043 |
| 18 | Ga0070696_100041737 | 3300005546 | Bacteria | 3170 |
| 19 | Ga0070665_100041371 | 3300005548 | Unclassified | 4631 |
| 20 | Ga0070665_100342997 | 3300005548 | Unclassified | 1499 |
| 21 | Ga0068855_100161478 | 3300005563 | Bacteria | 2543 |
| 22 | Ga0068855_100360662 | 3300005563 | Bacteria | 1599 |
| 23 | Ga0068856_100448602 | 3300005614 | Bacteria | 1311 |
| 24 | Ga0068863_100091402 | 3300005841 | Unclassified | 2886 |
| 25 | Ga0068858_100078393 | 3300005842 | Unclassified | 3070 |
| 26 | Ga0081455_10032052 | 3300005937 | Bacteria | 4742 |
| 27 | Ga0070717_10075636 | 3300006028 | Bacteria | 2817 |
| 28 | Ga0070717_10144320 | 3300006028 | Bacteria | 2055 |
| 29 | Ga0068871_100164404 | 3300006358 | Bacteria | 1899 |
| 30 | Ga0068871_100192113 | 3300006358 | Bacteria | 1759 |
| 31 | Ga0068871_100208762 | 3300006358 | Unclassified | 1689 |
| 32 | Ga0075434_100174094 | 3300006871 | Bacteria | 2172 |
| 33 | Ga0075435_100133575 | 3300007076 | Bacteria | 2078 |
| 34 | Ga0105240_10003797 | 3300009093 | Bacteria | 23330 |
| 35 | Ga0105240_10239337 | 3300009093 | Bacteria | 2105 |
| 36 | Ga0105245_10237794 | 3300009098 | Unclassified | 1764 |
| 37 | Ga0105248_10187252 | 3300009177 | Unclassified | 2332 |
| 38 | Ga0105248_10532897 | 3300009177 | Bacteria | 1324 |
| 39 | Ga0105237_10001666 | 3300009545 | Bacteria | 28772 |
| 40 | Ga0157373_10119371 | 3300013100 | Bacteria | 1853 |
| 41 | Ga0157370_10100768 | 3300013104 | Bacteria | 2706 |
| 42 | Ga0157369_10017676 | 3300013105 | Bacteria | 8011 |
| 43 | Ga0157369_10122174 | 3300013105 | Bacteria | 2762 |
| 44 | Ga0157369_10179289 | 3300013105 | Bacteria | 2229 |
| 45 | Ga0157369_10245082 | 3300013105 | Bacteria | 1871 |
| 46 | Ga0157378_10656804 | 3300013297 | Bacteria | 1065 |
| 47 | Ga0163162_10085687 | 3300013306 | Unclassified | 3228 |
| 48 | Ga0163162_10106891 | 3300013306 | Unclassified | 2893 |
| 49 | Ga0157372_10321033 | 3300013307 | Bacteria | 1803 |
| 50 | Ga0157372_10361942 | 3300013307 | Bacteria | 1690 |
| 51 | Ga0157375_10146248 | 3300013308 | Bacteria | 2494 |
| 52 | Ga0163163_10066939 | 3300014325 | Bacteria | 3570 |
| 53 | Ga0163163_10138570 | 3300014325 | Unclassified | 2475 |
| 54 | Ga0157379_10012121 | 3300014968 | Bacteria | 7528 |
| 55 | Ga0157376_10378152 | 3300014969 | Bacteria | 1363 |
| 56 | Ga0213874_10017188 | 3300021377 | Bacteria | 1936 |
| 57 | Ga0213876_10049933 | 3300021384 | Bacteria | 2211 |
| 58 | Ga0213875_10000002 | 3300021388 | Bacteria | 921066 |
| 59 | Ga0213875_10001070 | 3300021388 | Bacteria | 19185 |
| 60 | Ga0213875_10014799 | 3300021388 | Bacteria | 3802 |
| 61 | Ga0213875_10106288 | 3300021388 | Bacteria | 1310 |
| 62 | Ga0207680_10198560 | 3300025903 | Unclassified | 1366 |
| 63 | Ga0207707_10004730 | 3300025912 | Bacteria | 11943 |
| 64 | Ga0207707_10106711 | 3300025912 | Bacteria | 2448 |
| 65 | Ga0207695_10005624 | 3300025913 | Bacteria | 16548 |
| 66 | Ga0207695_10190200 | 3300025913 | Bacteria | 1970 |
| 67 | Ga0207693_10123293 | 3300025915 | Bacteria | 2036 |
| 68 | Ga0207652_10014540 | 3300025921 | Bacteria | 6377 |
| 69 | Ga0207652_10534770 | 3300025921 | Bacteria | 1054 |
| 70 | Ga0207690_10326251 | 3300025932 | Bacteria | 1208 |
| 71 | Ga0207711_10242505 | 3300025941 | Bacteria | 1653 |
| 72 | Ga0207711_10266931 | 3300025941 | Unclassified | 1574 |
| 73 | Ga0207661_10063830 | 3300025944 | Unclassified | 2984 |
| 74 | Ga0207667_10139126 | 3300025949 | Bacteria | 2500 |
| 75 | Ga0207678_10055433 | 3300026067 | Bacteria | 3414 |
| 76 | Ga0207702_10368696 | 3300026078 | Bacteria | 1378 |
| 77 | Ga0207641_10137482 | 3300026088 | Unclassified | 2201 |
| 78 | Ga0268266_10168463 | 3300028379 | Unclassified | 1987 |
| 79 | Ga0265325_10108073 | 3300031241 | Unclassified | 1355 |
| 80 | Ga0265316_10002611 | 3300031344 | Bacteria | 18577 |
| 81 | Ga0265316_10019367 | 3300031344 | Bacteria | 5823 |
| 82 | Ga0265316_10038758 | 3300031344 | Bacteria | 3835 |
| 83 | Ga0265316_10088244 | 3300031344 | Bacteria | 2368 |
| 84 | Ga0316579_10120564 | 3300031691 | Bacteria | 1260 |
| 85 | Ga0316578_10034121 | 3300031728 | Bacteria | 2920 |
| 86 | Ga0316577_10001951 | 3300031733 | Bacteria | 10008 |
| 87 | Ga0307406_10363566 | 3300031901 | Unclassified | 1135 |
| 88 | Ga0373935_0289574 | 3300035692 | Unclassified | 1155 |
| 89 | Ga0373927_0006012 | 3300035695 | Bacteria | 8314 |
| 90 | Ga0373927_0136301 | 3300035695 | Bacteria | 1604 |
| 91 | Ga0373927_0391538 | 3300035695 | Bacteria | 917 |
| 92 | Ga0373937_0325808 | 3300036401 | Bacteria | 1454 |
| 93 | Ga0316584_0008721 | 3300036712 | Bacteria | 7002 |
| 94 | Ga0373925_0064393 | 3300037068 | Unclassified | 2760 |
| 95 | Ga0373925_0164832 | 3300037068 | Unclassified | 1747 |
| 96 | Ga0395900_0224907 | 3300037418 | Bacteria | 1890 |
| 97 | Ga0395898_0073202 | 3300037466 | Unclassified | 3310 |
| 98 | Ga0395898_0485286 | 3300037466 | Unclassified | 1176 |
| 99 | Ga0436364_0511907 | 3300037853 | Unclassified | 3258 |
| 100 | Ga0436364_0553624 | 3300037853 | Bacteria | 9853 |
| 101 | Ga0436364_0605045 | 3300037853 | Bacteria | 1272 |
| 102 | Ga0436364_0608451 | 3300037853 | Bacteria | 2798 |
| 103 | Ga0436364_0682831 | 3300037853 | Bacteria | 4433 |
| 104 | Ga0436364_0740820 | 3300037853 | Bacteria | 14233 |
| 105 | Ga0436364_0745657 | 3300037853 | Bacteria | 51254 |
| 106 | Ga0436364_0940248 | 3300037853 | Bacteria | 592364 |
| 107 | Ga0395901_0639838 | 3300038443 | Unclassified | 1068 |
| 108 | Ga0436365_1841024 | 3300039437 | Unclassified | 4805 |
| 109 | Ga0436360_0516738 | 3300039438 | Bacteria | 1645 |
| 110 | Ga0436363_1359409 | 3300039450 | Bacteria | 6112 |
| 111 | Ga0436363_1491356 | 3300039450 | Bacteria | 3079 |
| 112 | Ga0436362_0345916 | 3300039453 | Bacteria | 2230 |
| 113 | Ga0451577_0610479 | 3300042876 | Bacteria | 990 |
| 114 | Ga0466961_0345707 | 3300044693 | Bacteria | 906 |
| 115 | Ga0466961_0353112 | 3300044693 | Unclassified | 895 |
| 116 | Ga0466959_0084438 | 3300045049 | Bacteria | 2286 |
| 117 | Ga0495592_0018695 | 3300046454 | Bacteria | 5275 |
| 118 | Ga0495651_0009170 | 3300046462 | Bacteria | 7595 |
| 119 | Ga0495653_0056037 | 3300046463 | Bacteria | 3006 |
| 120 | Ga0495580_0001715 | 3300046472 | Bacteria | 19256 |
| 121 | Ga0495580_0011332 | 3300046472 | Bacteria | 6899 |
| 122 | Ga0495580_0035061 | 3300046472 | Bacteria | 3609 |
| 123 | Ga0495580_0038371 | 3300046472 | Bacteria | 3431 |
| 124 | Ga0495582_0281276 | 3300046473 | Bacteria | 955 |
| 125 | Ga0495662_0018586 | 3300046476 | Bacteria | 3364 |
| 126 | Ga0495664_0015531 | 3300046477 | Bacteria | 4329 |
| 127 | Ga0495664_0198931 | 3300046477 | Bacteria | 1214 |
| 128 | Ga0495594_0192386 | 3300046499 | Unclassified | 1162 |
| 129 | Ga0495608_0222758 | 3300046511 | Bacteria | 1183 |
| 130 | Ga0495618_0144362 | 3300046514 | Unclassified | 1522 |
| 131 | Ga0495628_0015057 | 3300046516 | Bacteria | 6460 |
| 132 | Ga0495630_0026293 | 3300046517 | Bacteria | 4308 |
| 133 | Ga0495652_0034361 | 3300046529 | Bacteria | 4419 |
| 134 | Ga0495665_0097849 | 3300046531 | Unclassified | 1540 |
| 135 | Ga0495640_0032172 | 3300046533 | Bacteria | 3738 |
| 136 | Ga0495640_0044841 | 3300046533 | Bacteria | 3072 |
| 137 | Ga0495645_0001071 | 3300046543 | Bacteria | 18598 |
| 138 | Ga0495645_0192380 | 3300046543 | Bacteria | 1389 |
| 139 | Ga0495667_0075280 | 3300046559 | Unclassified | 2197 |
| 140 | Ga0495635_0032977 | 3300046663 | Bacteria | 3593 |
| 141 | Ga0495657_0084803 | 3300046675 | Bacteria | 2043 |
| 142 | Ga0495646_0074208 | 3300046680 | Bacteria | 1997 |
| 143 | Ga0495613_0070566 | 3300046689 | Bacteria | 2547 |
| 144 | Ga0495604_0041653 | 3300047317 | Bacteria | 3601 |
| 145 | Ga0495674_0002548 | 3300047319 | Bacteria | 17756 |
| 146 | Ga0495674_0059026 | 3300047319 | Bacteria | 3352 |
| 147 | Ga0495680_0028484 | 3300047322 | Bacteria | 4579 |
| 148 | Ga0495675_0047309 | 3300047444 | Bacteria | 2737 |
| 149 | Ga0495675_0058885 | 3300047444 | Bacteria | 2436 |
| 150 | Ga0495684_0004614 | 3300047471 | Bacteria | 10755 |
| 151 | Ga0495684_0125922 | 3300047471 | Bacteria | 1927 |
| 152 | Ga0495602_0174328 | 3300048088 | Bacteria | 1666 |
| 153 | Ga0496112_0662387 | 3300048915 | Unclassified | 973 |
| 154 | Ga0496115_0109458 | 3300048918 | Bacteria | 2269 |
| 155 | Ga0496115_0122655 | 3300048918 | Unclassified | 2139 |
| 156 | Ga0496126_0184325 | 3300048929 | Unclassified | 1771 |
| 157 | Ga0501034_0063052 | 3300049571 | Bacteria | 3721 |
| 158 | Ga0501034_0448609 | 3300049571 | Bacteria | 1208 |
| 159 | Ga0501048_0397024 | 3300049582 | Bacteria | 985 |
| 160 | Ga0501070_0049681 | 3300049586 | Bacteria | 3483 |
| 161 | Ga0501035_0044284 | 3300049822 | Bacteria | 4008 |
| 162 | Ga0501035_0085573 | 3300049822 | Unclassified | 2779 |
| 163 | Ga0501035_0823709 | 3300049822 | Bacteria | 740 |
| 164 | Ga0501044_0079344 | 3300049823 | Bacteria | 3326 |
| 165 | nmdc:mga0n895_353921_c1 | 3300050512 | Bacteria | 1487 |
| 166 | nmdc:mga0rr50_535494_c1 | 3300050513 | Unclassified | 997 |
| 167 | nmdc:mga08x19_719_c1 | 3300050514 | Bacteria | 21175 |
| 168 | Ga0495619_0233355 | 3300053085 | Unclassified | 1275 |
| 169 | Ga0500568_0000292 | 3300053139 | Bacteria | 40978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046473 | Ga0495582_0281276 | Ga0495582_0281276_114_806 | 230 |
| 2 | 3300049822 | Ga0501035_0823709 | Ga0501035_0823709_20_724 | 234 |
| 3 | 3300048915 | Ga0496112_0662387 | Ga0496112_0662387_252_959 | 235 |
| 4 | 3300026067 | Ga0207678_10055433 | Ga0207678_100554333 | 247 |
| 5 | 3300021388 | Ga0213875_10000002 | Ga0213875_10000002734 | 248 |
| 6 | 3300044693 | Ga0466961_0353112 | Ga0466961_0353112_67_870 | 249 |
| 7 | 3300046463 | Ga0495653_0056037 | Ga0495653_0056037_25_786 | 253 |
| 8 | 3300025913 | Ga0207695_10005624 | Ga0207695_1000562414 | 261 |
| 9 | 3300006028 | Ga0070717_10144320 | Ga0070717_101443202 | 271 |
| 10 | 3300006871 | Ga0075434_100174094 | Ga0075434_1001740942 | 275 |
| 11 | 3300031691 | Ga0316579_10120564 | Ga0316579_101205641 | 275 |
| 12 | 3300031728 | Ga0316578_10034121 | Ga0316578_100341214 | 275 |
| 13 | 3300031733 | Ga0316577_10001951 | Ga0316577_100019517 | 275 |
| 14 | 3300036712 | Ga0316584_0008721 | Ga0316584_0008721_1465_2298 | 275 |
| 15 | 3300053139 | Ga0500568_0000292 | Ga0500568_0000292_950_1777 | 275 |
| 16 | 3300031344 | Ga0265316_10002611 | Ga0265316_100026114 | 276 |
| 17 | 3300005435 | Ga0070714_100086027 | Ga0070714_1000860272 | 277 |
| 18 | 3300035695 | Ga0373927_0391538 | Ga0373927_0391538_46_879 | 277 |
| 19 | 3300021377 | Ga0213874_10017188 | Ga0213874_100171882 | 278 |
| 20 | 3300021388 | Ga0213875_10106288 | Ga0213875_101062882 | 278 |
| 21 | 3300035695 | Ga0373927_0136301 | Ga0373927_0136301_541_1380 | 278 |
| 22 | 3300037068 | Ga0373925_0064393 | Ga0373925_0064393_1869_2708 | 278 |
| 23 | 3300037853 | Ga0436364_0608451 | Ga0436364_0608451_1319_2158 | 278 |
| 24 | 3300039438 | Ga0436360_0516738 | Ga0436360_0516738_639_1475 | 278 |
| 25 | 3300039450 | Ga0436363_1359409 | Ga0436363_1359409_4065_4928 | 278 |
| 26 | 3300039453 | Ga0436362_0345916 | Ga0436362_0345916_337_1173 | 278 |
| 27 | 3300046472 | Ga0495580_0038371 | Ga0495580_0038371_1359_2198 | 278 |
| 28 | 3300046477 | Ga0495664_0198931 | Ga0495664_0198931_351_1187 | 278 |
| 29 | 3300046533 | Ga0495640_0044841 | Ga0495640_0044841_1821_2657 | 278 |
| 30 | 3300049571 | Ga0501034_0448609 | Ga0501034_0448609_40_879 | 278 |
| 31 | 3300049822 | Ga0501035_0085573 | Ga0501035_0085573_842_1681 | 278 |
| 32 | 3300050513 | nmdc:mga0rr50_535494_c1 | nmdc:mga0rr50_535494_c1_133_969 | 278 |
| 33 | 3300005455 | Ga0070663_100129745 | Ga0070663_1001297452 | 279 |
| 34 | 3300005458 | Ga0070681_10094872 | Ga0070681_100948721 | 279 |
| 35 | 3300005458 | Ga0070681_10439787 | Ga0070681_104397871 | 279 |
| 36 | 3300005530 | Ga0070679_100011196 | Ga0070679_1000111965 | 279 |
| 37 | 3300005535 | Ga0070684_100448972 | Ga0070684_1004489722 | 279 |
| 38 | 3300005563 | Ga0068855_100161478 | Ga0068855_1001614782 | 279 |
| 39 | 3300005563 | Ga0068855_100360662 | Ga0068855_1003606622 | 279 |
| 40 | 3300005614 | Ga0068856_100448602 | Ga0068856_1004486022 | 279 |
| 41 | 3300005937 | Ga0081455_10032052 | Ga0081455_100320523 | 279 |
| 42 | 3300006358 | Ga0068871_100164404 | Ga0068871_1001644042 | 279 |
| 43 | 3300013100 | Ga0157373_10119371 | Ga0157373_101193712 | 279 |
| 44 | 3300013104 | Ga0157370_10100768 | Ga0157370_101007683 | 279 |
| 45 | 3300013105 | Ga0157369_10017676 | Ga0157369_100176766 | 279 |
| 46 | 3300013105 | Ga0157369_10122174 | Ga0157369_101221743 | 279 |
| 47 | 3300013105 | Ga0157369_10179289 | Ga0157369_101792892 | 279 |
| 48 | 3300013105 | Ga0157369_10245082 | Ga0157369_102450822 | 279 |
| 49 | 3300013307 | Ga0157372_10361942 | Ga0157372_103619422 | 279 |
| 50 | 3300014969 | Ga0157376_10378152 | Ga0157376_103781522 | 279 |
| 51 | 3300021384 | Ga0213876_10049933 | Ga0213876_100499332 | 279 |
| 52 | 3300021388 | Ga0213875_10001070 | Ga0213875_1000107016 | 279 |
| 53 | 3300021388 | Ga0213875_10014799 | Ga0213875_100147991 | 279 |
| 54 | 3300025912 | Ga0207707_10106711 | Ga0207707_101067111 | 279 |
| 55 | 3300025915 | Ga0207693_10123293 | Ga0207693_101232932 | 279 |
| 56 | 3300025921 | Ga0207652_10014540 | Ga0207652_100145405 | 279 |
| 57 | 3300025932 | Ga0207690_10326251 | Ga0207690_103262511 | 279 |
| 58 | 3300025949 | Ga0207667_10139126 | Ga0207667_101391262 | 279 |
| 59 | 3300026078 | Ga0207702_10368696 | Ga0207702_103686962 | 279 |
| 60 | 3300037418 | Ga0395900_0224907 | Ga0395900_0224907_494_1336 | 279 |
| 61 | 3300037466 | Ga0395898_0073202 | Ga0395898_0073202_627_1469 | 279 |
| 62 | 3300037466 | Ga0395898_0485286 | Ga0395898_0485286_283_1125 | 279 |
| 63 | 3300037853 | Ga0436364_0511907 | Ga0436364_0511907_2276_3118 | 279 |
| 64 | 3300037853 | Ga0436364_0553624 | Ga0436364_0553624_5469_6308 | 279 |
| 65 | 3300037853 | Ga0436364_0605045 | Ga0436364_0605045_86_952 | 279 |
| 66 | 3300037853 | Ga0436364_0682831 | Ga0436364_0682831_346_1188 | 279 |
| 67 | 3300037853 | Ga0436364_0740820 | Ga0436364_0740820_1691_2533 | 279 |
| 68 | 3300037853 | Ga0436364_0745657 | Ga0436364_0745657_41511_42353 | 279 |
| 69 | 3300037853 | Ga0436364_0940248 | Ga0436364_0940248_50391_51233 | 279 |
| 70 | 3300038443 | Ga0395901_0639838 | Ga0395901_0639838_178_1020 | 279 |
| 71 | 3300039437 | Ga0436365_1841024 | Ga0436365_1841024_779_1621 | 279 |
| 72 | 3300048929 | Ga0496126_0184325 | Ga0496126_0184325_556_1431 | 279 |
| 73 | 3300049571 | Ga0501034_0063052 | Ga0501034_0063052_2530_3384 | 279 |
| 74 | 3300049582 | Ga0501048_0397024 | Ga0501048_0397024_67_921 | 279 |
| 75 | 3300049586 | Ga0501070_0049681 | Ga0501070_0049681_2450_3304 | 279 |
| 76 | 3300049822 | Ga0501035_0044284 | Ga0501035_0044284_822_1676 | 279 |
| 77 | 3300049823 | Ga0501044_0079344 | Ga0501044_0079344_213_1067 | 279 |
| 78 | 3300005548 | Ga0070665_100342997 | Ga0070665_1003429972 | 280 |
| 79 | 3300009093 | Ga0105240_10003797 | Ga0105240_1000379717 | 280 |
| 80 | 3300009545 | Ga0105237_10001666 | Ga0105237_1000166617 | 280 |
| 81 | 3300014968 | Ga0157379_10012121 | Ga0157379_100121217 | 280 |
| 82 | 3300028379 | Ga0268266_10168463 | Ga0268266_101684632 | 280 |
| 83 | 3300031901 | Ga0307406_10363566 | Ga0307406_103635662 | 280 |
| 84 | 3300039450 | Ga0436363_1491356 | Ga0436363_1491356_99_944 | 280 |
| 85 | 3300048918 | Ga0496115_0109458 | Ga0496115_0109458_1276_2118 | 280 |
| 86 | 3300005548 | Ga0070665_100041371 | Ga0070665_1000413712 | 281 |
| 87 | 3300005842 | Ga0068858_100078393 | Ga0068858_1000783932 | 281 |
| 88 | 3300009093 | Ga0105240_10239337 | Ga0105240_102393373 | 281 |
| 89 | 3300013308 | Ga0157375_10146248 | Ga0157375_101462482 | 281 |
| 90 | 3300014325 | Ga0163163_10066939 | Ga0163163_100669392 | 281 |
| 91 | 3300025913 | Ga0207695_10190200 | Ga0207695_101902003 | 281 |
| 92 | 3300025941 | Ga0207711_10242505 | Ga0207711_102425052 | 281 |
| 93 | 3300031344 | Ga0265316_10038758 | Ga0265316_100387583 | 281 |
| 94 | 3300042876 | Ga0451577_0610479 | Ga0451577_0610479_66_917 | 281 |
| 95 | 3300005518 | Ga0070699_100013927 | Ga0070699_1000139275 | 282 |
| 96 | 3300005546 | Ga0070696_100041737 | Ga0070696_1000417372 | 282 |
| 97 | 3300044693 | Ga0466961_0345707 | Ga0466961_0345707_35_886 | 282 |
| 98 | 3300045049 | Ga0466959_0084438 | Ga0466959_0084438_1419_2270 | 282 |
| 99 | 3300035692 | Ga0373935_0289574 | Ga0373935_0289574_175_1032 | 283 |
| 100 | 3300005331 | Ga0070670_100300456 | Ga0070670_1003004562 | 284 |
| 101 | 3300005336 | Ga0070680_100055274 | Ga0070680_1000552742 | 284 |
| 102 | 3300005336 | Ga0070680_100147847 | Ga0070680_1001478472 | 284 |
| 103 | 3300005439 | Ga0070711_100035076 | Ga0070711_1000350763 | 284 |
| 104 | 3300005440 | Ga0070705_100118144 | Ga0070705_1001181441 | 284 |
| 105 | 3300005445 | Ga0070708_100233544 | Ga0070708_1002335442 | 284 |
| 106 | 3300005458 | Ga0070681_10010865 | Ga0070681_100108653 | 284 |
| 107 | 3300005466 | Ga0070685_10341458 | Ga0070685_103414581 | 284 |
| 108 | 3300005536 | Ga0070697_100013288 | Ga0070697_1000132887 | 284 |
| 109 | 3300005545 | Ga0070695_100037810 | Ga0070695_1000378102 | 284 |
| 110 | 3300005841 | Ga0068863_100091402 | Ga0068863_1000914023 | 284 |
| 111 | 3300006028 | Ga0070717_10075636 | Ga0070717_100756362 | 284 |
| 112 | 3300006358 | Ga0068871_100192113 | Ga0068871_1001921132 | 284 |
| 113 | 3300006358 | Ga0068871_100208762 | Ga0068871_1002087623 | 284 |
| 114 | 3300007076 | Ga0075435_100133575 | Ga0075435_1001335751 | 284 |
| 115 | 3300009098 | Ga0105245_10237794 | Ga0105245_102377942 | 284 |
| 116 | 3300009177 | Ga0105248_10187252 | Ga0105248_101872523 | 284 |
| 117 | 3300009177 | Ga0105248_10532897 | Ga0105248_105328972 | 284 |
| 118 | 3300013297 | Ga0157378_10656804 | Ga0157378_106568042 | 284 |
| 119 | 3300013306 | Ga0163162_10085687 | Ga0163162_100856873 | 284 |
| 120 | 3300013306 | Ga0163162_10106891 | Ga0163162_101068913 | 284 |
| 121 | 3300013307 | Ga0157372_10321033 | Ga0157372_103210332 | 284 |
| 122 | 3300014325 | Ga0163163_10138570 | Ga0163163_101385703 | 284 |
| 123 | 3300025903 | Ga0207680_10198560 | Ga0207680_101985602 | 284 |
| 124 | 3300025912 | Ga0207707_10004730 | Ga0207707_100047304 | 284 |
| 125 | 3300025921 | Ga0207652_10534770 | Ga0207652_105347702 | 284 |
| 126 | 3300025941 | Ga0207711_10266931 | Ga0207711_102669311 | 284 |
| 127 | 3300025944 | Ga0207661_10063830 | Ga0207661_100638302 | 284 |
| 128 | 3300026088 | Ga0207641_10137482 | Ga0207641_101374823 | 284 |
| 129 | 3300031241 | Ga0265325_10108073 | Ga0265325_101080732 | 284 |
| 130 | 3300031344 | Ga0265316_10019367 | Ga0265316_100193676 | 284 |
| 131 | 3300031344 | Ga0265316_10088244 | Ga0265316_100882442 | 284 |
| 132 | 3300035695 | Ga0373927_0006012 | Ga0373927_0006012_6776_7642 | 284 |
| 133 | 3300036401 | Ga0373937_0325808 | Ga0373937_0325808_47_910 | 284 |
| 134 | 3300037068 | Ga0373925_0164832 | Ga0373925_0164832_386_1252 | 284 |
| 135 | 3300046454 | Ga0495592_0018695 | Ga0495592_0018695_2486_3340 | 284 |
| 136 | 3300046462 | Ga0495651_0009170 | Ga0495651_0009170_1585_2439 | 284 |
| 137 | 3300046472 | Ga0495580_0001715 | Ga0495580_0001715_15009_15863 | 284 |
| 138 | 3300046472 | Ga0495580_0011332 | Ga0495580_0011332_5451_6317 | 284 |
| 139 | 3300046472 | Ga0495580_0035061 | Ga0495580_0035061_151_1017 | 284 |
| 140 | 3300046476 | Ga0495662_0018586 | Ga0495662_0018586_1464_2318 | 284 |
| 141 | 3300046477 | Ga0495664_0015531 | Ga0495664_0015531_2798_3652 | 284 |
| 142 | 3300046499 | Ga0495594_0192386 | Ga0495594_0192386_80_934 | 284 |
| 143 | 3300046511 | Ga0495608_0222758 | Ga0495608_0222758_232_1086 | 284 |
| 144 | 3300046514 | Ga0495618_0144362 | Ga0495618_0144362_332_1186 | 284 |
| 145 | 3300046516 | Ga0495628_0015057 | Ga0495628_0015057_4483_5337 | 284 |
| 146 | 3300046517 | Ga0495630_0026293 | Ga0495630_0026293_3413_4267 | 284 |
| 147 | 3300046529 | Ga0495652_0034361 | Ga0495652_0034361_2229_3083 | 284 |
| 148 | 3300046531 | Ga0495665_0097849 | Ga0495665_0097849_403_1257 | 284 |
| 149 | 3300046533 | Ga0495640_0032172 | Ga0495640_0032172_560_1414 | 284 |
| 150 | 3300046543 | Ga0495645_0001071 | Ga0495645_0001071_10414_11268 | 284 |
| 151 | 3300046543 | Ga0495645_0192380 | Ga0495645_0192380_18_890 | 284 |
| 152 | 3300046559 | Ga0495667_0075280 | Ga0495667_0075280_146_1000 | 284 |
| 153 | 3300046663 | Ga0495635_0032977 | Ga0495635_0032977_2182_3036 | 284 |
| 154 | 3300046675 | Ga0495657_0084803 | Ga0495657_0084803_1150_2004 | 284 |
| 155 | 3300046680 | Ga0495646_0074208 | Ga0495646_0074208_989_1843 | 284 |
| 156 | 3300046689 | Ga0495613_0070566 | Ga0495613_0070566_172_1026 | 284 |
| 157 | 3300047317 | Ga0495604_0041653 | Ga0495604_0041653_260_1114 | 284 |
| 158 | 3300047319 | Ga0495674_0002548 | Ga0495674_0002548_2452_3306 | 284 |
| 159 | 3300047319 | Ga0495674_0059026 | Ga0495674_0059026_2109_2963 | 284 |
| 160 | 3300047322 | Ga0495680_0028484 | Ga0495680_0028484_2124_2978 | 284 |
| 161 | 3300047444 | Ga0495675_0047309 | Ga0495675_0047309_1155_2021 | 284 |
| 162 | 3300047444 | Ga0495675_0058885 | Ga0495675_0058885_1209_2063 | 284 |
| 163 | 3300047471 | Ga0495684_0004614 | Ga0495684_0004614_9664_10518 | 284 |
| 164 | 3300047471 | Ga0495684_0125922 | Ga0495684_0125922_126_980 | 284 |
| 165 | 3300048088 | Ga0495602_0174328 | Ga0495602_0174328_45_899 | 284 |
| 166 | 3300048918 | Ga0496115_0122655 | Ga0496115_0122655_256_1110 | 284 |
| 167 | 3300050512 | nmdc:mga0n895_353921_c1 | nmdc:mga0n895_353921_c1_134_1000 | 284 |
| 168 | 3300050514 | nmdc:mga08x19_719_c1 | nmdc:mga08x19_719_c1_8932_9798 | 284 |
| 169 | 3300053085 | Ga0495619_0233355 | Ga0495619_0233355_112_966 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qmx-assembly1.cif.gz_A | the crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls | 0.9369 | 7 | 281 |
| 6vh5-assembly1.cif.gz_C | crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine | 0.9348 | 7 | 282 |
| 7am0-assembly2.cif.gz_C | gqqa- a novel type of quorum quenching acylases | 0.9162 | 7 | 281 |
| 2qmx-assembly1.cif.gz_A | the crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls | 0.9142 | 7 | 281 |
| 7alz-assembly1.cif.gz_B | gqqa- a novel type of quorum quenching acylases | 0.9066 | 7 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qmxB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9808 | 89 | 172 | 3.40.190.10 |
| af_A0A1D6ELY8_206_287_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9685 | 93 | 172 | 3.40.190.10 |
| af_A0A1D6ICV1_89_167_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9617 | 93 | 166 | 3.40.190.10 |
| af_A0A1D6P6Q8_117_201_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9524 | 3 | 81 | 3.40.190.10 |
| 2qmxB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9518 | 6 | 85 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6S424-F1-model_v4 | Prephenate dehydratase | 0.9858 | 200 | 282 |
GO:0004664
GO:0005737 GO:0009094 |
| AF-A0A3M2D6V2-F1-model_v4 | prephenate dehydratase (EC 4.2.1.51) | 0.9837 | 1 | 182 |
GO:0004664
GO:0005737 GO:0009094 |
| AF-A0A4Q5WQC8-F1-model_v4 | prephenate dehydratase (EC 4.2.1.51) | 0.9836 | 5 | 172 |
GO:0004664
GO:0005737 GO:0009094 |
| AF-A0A7T5RUZ1-F1-model_v4 | prephenate dehydratase (EC 4.2.1.51) | 0.9814 | 7 | 183 |
GO:0004664
GO:0005737 GO:0009094 |
| AF-A0A2P0B4N6-F1-model_v4 | prephenate dehydratase (EC 4.2.1.51) | 0.9795 | 7 | 184 |
GO:0004664
GO:0005737 GO:0009094 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar