F255041

General Info

Members Datasets Scaffolds Average Seq Length
169 117 169 281

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10363566|Ga0307406_103635662
Length 297
Sequence VFRLRMQSAGPGQRYNPDVGRRRTVSFQGEKGAFSQVAVQQLLGPEVEVRPCQRFEEVFRALADGDVDAAVVPIENTLHGSVHENYDHLVNFELQIHAETNVRISHTLIACPGVPFRKLRRVFSHPVALNQCVTFFRENPQLERVPFYDTAGSVKMLMEEKPADAAAIASAIAADLYGAKTLKRGIEDDPSNFTRFFLLKRPGSRQTRTGEVQWKTSLVFQTRNVPGALFRCLSAFALRDISCTKIESRPLRGKPWEYWFYLDFLGRADDEIPQKALGHLSEMADFLRVLGTYPKAV

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.78
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100300456 3300005331 Bacteria 1404
2 Ga0070680_100055274 3300005336 Unclassified 3244
3 Ga0070680_100147847 3300005336 Unclassified 1972
4 Ga0070714_100086027 3300005435 Unclassified 2747
5 Ga0070711_100035076 3300005439 Bacteria 3351
6 Ga0070705_100118144 3300005440 Bacteria 1707
7 Ga0070708_100233544 3300005445 Bacteria 1726
8 Ga0070663_100129745 3300005455 Bacteria 1913
9 Ga0070681_10010865 3300005458 Bacteria 9000
10 Ga0070681_10094872 3300005458 Bacteria 2932
11 Ga0070681_10439787 3300005458 Bacteria 1216
12 Ga0070685_10341458 3300005466 Unclassified 1021
13 Ga0070699_100013927 3300005518 Bacteria 6917
14 Ga0070679_100011196 3300005530 Bacteria 8549
15 Ga0070684_100448972 3300005535 Bacteria 1192
16 Ga0070697_100013288 3300005536 Bacteria 6459
17 Ga0070695_100037810 3300005545 Bacteria 3043
18 Ga0070696_100041737 3300005546 Bacteria 3170
19 Ga0070665_100041371 3300005548 Unclassified 4631
20 Ga0070665_100342997 3300005548 Unclassified 1499
21 Ga0068855_100161478 3300005563 Bacteria 2543
22 Ga0068855_100360662 3300005563 Bacteria 1599
23 Ga0068856_100448602 3300005614 Bacteria 1311
24 Ga0068863_100091402 3300005841 Unclassified 2886
25 Ga0068858_100078393 3300005842 Unclassified 3070
26 Ga0081455_10032052 3300005937 Bacteria 4742
27 Ga0070717_10075636 3300006028 Bacteria 2817
28 Ga0070717_10144320 3300006028 Bacteria 2055
29 Ga0068871_100164404 3300006358 Bacteria 1899
30 Ga0068871_100192113 3300006358 Bacteria 1759
31 Ga0068871_100208762 3300006358 Unclassified 1689
32 Ga0075434_100174094 3300006871 Bacteria 2172
33 Ga0075435_100133575 3300007076 Bacteria 2078
34 Ga0105240_10003797 3300009093 Bacteria 23330
35 Ga0105240_10239337 3300009093 Bacteria 2105
36 Ga0105245_10237794 3300009098 Unclassified 1764
37 Ga0105248_10187252 3300009177 Unclassified 2332
38 Ga0105248_10532897 3300009177 Bacteria 1324
39 Ga0105237_10001666 3300009545 Bacteria 28772
40 Ga0157373_10119371 3300013100 Bacteria 1853
41 Ga0157370_10100768 3300013104 Bacteria 2706
42 Ga0157369_10017676 3300013105 Bacteria 8011
43 Ga0157369_10122174 3300013105 Bacteria 2762
44 Ga0157369_10179289 3300013105 Bacteria 2229
45 Ga0157369_10245082 3300013105 Bacteria 1871
46 Ga0157378_10656804 3300013297 Bacteria 1065
47 Ga0163162_10085687 3300013306 Unclassified 3228
48 Ga0163162_10106891 3300013306 Unclassified 2893
49 Ga0157372_10321033 3300013307 Bacteria 1803
50 Ga0157372_10361942 3300013307 Bacteria 1690
51 Ga0157375_10146248 3300013308 Bacteria 2494
52 Ga0163163_10066939 3300014325 Bacteria 3570
53 Ga0163163_10138570 3300014325 Unclassified 2475
54 Ga0157379_10012121 3300014968 Bacteria 7528
55 Ga0157376_10378152 3300014969 Bacteria 1363
56 Ga0213874_10017188 3300021377 Bacteria 1936
57 Ga0213876_10049933 3300021384 Bacteria 2211
58 Ga0213875_10000002 3300021388 Bacteria 921066
59 Ga0213875_10001070 3300021388 Bacteria 19185
60 Ga0213875_10014799 3300021388 Bacteria 3802
61 Ga0213875_10106288 3300021388 Bacteria 1310
62 Ga0207680_10198560 3300025903 Unclassified 1366
63 Ga0207707_10004730 3300025912 Bacteria 11943
64 Ga0207707_10106711 3300025912 Bacteria 2448
65 Ga0207695_10005624 3300025913 Bacteria 16548
66 Ga0207695_10190200 3300025913 Bacteria 1970
67 Ga0207693_10123293 3300025915 Bacteria 2036
68 Ga0207652_10014540 3300025921 Bacteria 6377
69 Ga0207652_10534770 3300025921 Bacteria 1054
70 Ga0207690_10326251 3300025932 Bacteria 1208
71 Ga0207711_10242505 3300025941 Bacteria 1653
72 Ga0207711_10266931 3300025941 Unclassified 1574
73 Ga0207661_10063830 3300025944 Unclassified 2984
74 Ga0207667_10139126 3300025949 Bacteria 2500
75 Ga0207678_10055433 3300026067 Bacteria 3414
76 Ga0207702_10368696 3300026078 Bacteria 1378
77 Ga0207641_10137482 3300026088 Unclassified 2201
78 Ga0268266_10168463 3300028379 Unclassified 1987
79 Ga0265325_10108073 3300031241 Unclassified 1355
80 Ga0265316_10002611 3300031344 Bacteria 18577
81 Ga0265316_10019367 3300031344 Bacteria 5823
82 Ga0265316_10038758 3300031344 Bacteria 3835
83 Ga0265316_10088244 3300031344 Bacteria 2368
84 Ga0316579_10120564 3300031691 Bacteria 1260
85 Ga0316578_10034121 3300031728 Bacteria 2920
86 Ga0316577_10001951 3300031733 Bacteria 10008
87 Ga0307406_10363566 3300031901 Unclassified 1135
88 Ga0373935_0289574 3300035692 Unclassified 1155
89 Ga0373927_0006012 3300035695 Bacteria 8314
90 Ga0373927_0136301 3300035695 Bacteria 1604
91 Ga0373927_0391538 3300035695 Bacteria 917
92 Ga0373937_0325808 3300036401 Bacteria 1454
93 Ga0316584_0008721 3300036712 Bacteria 7002
94 Ga0373925_0064393 3300037068 Unclassified 2760
95 Ga0373925_0164832 3300037068 Unclassified 1747
96 Ga0395900_0224907 3300037418 Bacteria 1890
97 Ga0395898_0073202 3300037466 Unclassified 3310
98 Ga0395898_0485286 3300037466 Unclassified 1176
99 Ga0436364_0511907 3300037853 Unclassified 3258
100 Ga0436364_0553624 3300037853 Bacteria 9853
101 Ga0436364_0605045 3300037853 Bacteria 1272
102 Ga0436364_0608451 3300037853 Bacteria 2798
103 Ga0436364_0682831 3300037853 Bacteria 4433
104 Ga0436364_0740820 3300037853 Bacteria 14233
105 Ga0436364_0745657 3300037853 Bacteria 51254
106 Ga0436364_0940248 3300037853 Bacteria 592364
107 Ga0395901_0639838 3300038443 Unclassified 1068
108 Ga0436365_1841024 3300039437 Unclassified 4805
109 Ga0436360_0516738 3300039438 Bacteria 1645
110 Ga0436363_1359409 3300039450 Bacteria 6112
111 Ga0436363_1491356 3300039450 Bacteria 3079
112 Ga0436362_0345916 3300039453 Bacteria 2230
113 Ga0451577_0610479 3300042876 Bacteria 990
114 Ga0466961_0345707 3300044693 Bacteria 906
115 Ga0466961_0353112 3300044693 Unclassified 895
116 Ga0466959_0084438 3300045049 Bacteria 2286
117 Ga0495592_0018695 3300046454 Bacteria 5275
118 Ga0495651_0009170 3300046462 Bacteria 7595
119 Ga0495653_0056037 3300046463 Bacteria 3006
120 Ga0495580_0001715 3300046472 Bacteria 19256
121 Ga0495580_0011332 3300046472 Bacteria 6899
122 Ga0495580_0035061 3300046472 Bacteria 3609
123 Ga0495580_0038371 3300046472 Bacteria 3431
124 Ga0495582_0281276 3300046473 Bacteria 955
125 Ga0495662_0018586 3300046476 Bacteria 3364
126 Ga0495664_0015531 3300046477 Bacteria 4329
127 Ga0495664_0198931 3300046477 Bacteria 1214
128 Ga0495594_0192386 3300046499 Unclassified 1162
129 Ga0495608_0222758 3300046511 Bacteria 1183
130 Ga0495618_0144362 3300046514 Unclassified 1522
131 Ga0495628_0015057 3300046516 Bacteria 6460
132 Ga0495630_0026293 3300046517 Bacteria 4308
133 Ga0495652_0034361 3300046529 Bacteria 4419
134 Ga0495665_0097849 3300046531 Unclassified 1540
135 Ga0495640_0032172 3300046533 Bacteria 3738
136 Ga0495640_0044841 3300046533 Bacteria 3072
137 Ga0495645_0001071 3300046543 Bacteria 18598
138 Ga0495645_0192380 3300046543 Bacteria 1389
139 Ga0495667_0075280 3300046559 Unclassified 2197
140 Ga0495635_0032977 3300046663 Bacteria 3593
141 Ga0495657_0084803 3300046675 Bacteria 2043
142 Ga0495646_0074208 3300046680 Bacteria 1997
143 Ga0495613_0070566 3300046689 Bacteria 2547
144 Ga0495604_0041653 3300047317 Bacteria 3601
145 Ga0495674_0002548 3300047319 Bacteria 17756
146 Ga0495674_0059026 3300047319 Bacteria 3352
147 Ga0495680_0028484 3300047322 Bacteria 4579
148 Ga0495675_0047309 3300047444 Bacteria 2737
149 Ga0495675_0058885 3300047444 Bacteria 2436
150 Ga0495684_0004614 3300047471 Bacteria 10755
151 Ga0495684_0125922 3300047471 Bacteria 1927
152 Ga0495602_0174328 3300048088 Bacteria 1666
153 Ga0496112_0662387 3300048915 Unclassified 973
154 Ga0496115_0109458 3300048918 Bacteria 2269
155 Ga0496115_0122655 3300048918 Unclassified 2139
156 Ga0496126_0184325 3300048929 Unclassified 1771
157 Ga0501034_0063052 3300049571 Bacteria 3721
158 Ga0501034_0448609 3300049571 Bacteria 1208
159 Ga0501048_0397024 3300049582 Bacteria 985
160 Ga0501070_0049681 3300049586 Bacteria 3483
161 Ga0501035_0044284 3300049822 Bacteria 4008
162 Ga0501035_0085573 3300049822 Unclassified 2779
163 Ga0501035_0823709 3300049822 Bacteria 740
164 Ga0501044_0079344 3300049823 Bacteria 3326
165 nmdc:mga0n895_353921_c1 3300050512 Bacteria 1487
166 nmdc:mga0rr50_535494_c1 3300050513 Unclassified 997
167 nmdc:mga08x19_719_c1 3300050514 Bacteria 21175
168 Ga0495619_0233355 3300053085 Unclassified 1275
169 Ga0500568_0000292 3300053139 Bacteria 40978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0281276 Ga0495582_0281276_114_806 230
2 3300049822 Ga0501035_0823709 Ga0501035_0823709_20_724 234
3 3300048915 Ga0496112_0662387 Ga0496112_0662387_252_959 235
4 3300026067 Ga0207678_10055433 Ga0207678_100554333 247
5 3300021388 Ga0213875_10000002 Ga0213875_10000002734 248
6 3300044693 Ga0466961_0353112 Ga0466961_0353112_67_870 249
7 3300046463 Ga0495653_0056037 Ga0495653_0056037_25_786 253
8 3300025913 Ga0207695_10005624 Ga0207695_1000562414 261
9 3300006028 Ga0070717_10144320 Ga0070717_101443202 271
10 3300006871 Ga0075434_100174094 Ga0075434_1001740942 275
11 3300031691 Ga0316579_10120564 Ga0316579_101205641 275
12 3300031728 Ga0316578_10034121 Ga0316578_100341214 275
13 3300031733 Ga0316577_10001951 Ga0316577_100019517 275
14 3300036712 Ga0316584_0008721 Ga0316584_0008721_1465_2298 275
15 3300053139 Ga0500568_0000292 Ga0500568_0000292_950_1777 275
16 3300031344 Ga0265316_10002611 Ga0265316_100026114 276
17 3300005435 Ga0070714_100086027 Ga0070714_1000860272 277
18 3300035695 Ga0373927_0391538 Ga0373927_0391538_46_879 277
19 3300021377 Ga0213874_10017188 Ga0213874_100171882 278
20 3300021388 Ga0213875_10106288 Ga0213875_101062882 278
21 3300035695 Ga0373927_0136301 Ga0373927_0136301_541_1380 278
22 3300037068 Ga0373925_0064393 Ga0373925_0064393_1869_2708 278
23 3300037853 Ga0436364_0608451 Ga0436364_0608451_1319_2158 278
24 3300039438 Ga0436360_0516738 Ga0436360_0516738_639_1475 278
25 3300039450 Ga0436363_1359409 Ga0436363_1359409_4065_4928 278
26 3300039453 Ga0436362_0345916 Ga0436362_0345916_337_1173 278
27 3300046472 Ga0495580_0038371 Ga0495580_0038371_1359_2198 278
28 3300046477 Ga0495664_0198931 Ga0495664_0198931_351_1187 278
29 3300046533 Ga0495640_0044841 Ga0495640_0044841_1821_2657 278
30 3300049571 Ga0501034_0448609 Ga0501034_0448609_40_879 278
31 3300049822 Ga0501035_0085573 Ga0501035_0085573_842_1681 278
32 3300050513 nmdc:mga0rr50_535494_c1 nmdc:mga0rr50_535494_c1_133_969 278
33 3300005455 Ga0070663_100129745 Ga0070663_1001297452 279
34 3300005458 Ga0070681_10094872 Ga0070681_100948721 279
35 3300005458 Ga0070681_10439787 Ga0070681_104397871 279
36 3300005530 Ga0070679_100011196 Ga0070679_1000111965 279
37 3300005535 Ga0070684_100448972 Ga0070684_1004489722 279
38 3300005563 Ga0068855_100161478 Ga0068855_1001614782 279
39 3300005563 Ga0068855_100360662 Ga0068855_1003606622 279
40 3300005614 Ga0068856_100448602 Ga0068856_1004486022 279
41 3300005937 Ga0081455_10032052 Ga0081455_100320523 279
42 3300006358 Ga0068871_100164404 Ga0068871_1001644042 279
43 3300013100 Ga0157373_10119371 Ga0157373_101193712 279
44 3300013104 Ga0157370_10100768 Ga0157370_101007683 279
45 3300013105 Ga0157369_10017676 Ga0157369_100176766 279
46 3300013105 Ga0157369_10122174 Ga0157369_101221743 279
47 3300013105 Ga0157369_10179289 Ga0157369_101792892 279
48 3300013105 Ga0157369_10245082 Ga0157369_102450822 279
49 3300013307 Ga0157372_10361942 Ga0157372_103619422 279
50 3300014969 Ga0157376_10378152 Ga0157376_103781522 279
51 3300021384 Ga0213876_10049933 Ga0213876_100499332 279
52 3300021388 Ga0213875_10001070 Ga0213875_1000107016 279
53 3300021388 Ga0213875_10014799 Ga0213875_100147991 279
54 3300025912 Ga0207707_10106711 Ga0207707_101067111 279
55 3300025915 Ga0207693_10123293 Ga0207693_101232932 279
56 3300025921 Ga0207652_10014540 Ga0207652_100145405 279
57 3300025932 Ga0207690_10326251 Ga0207690_103262511 279
58 3300025949 Ga0207667_10139126 Ga0207667_101391262 279
59 3300026078 Ga0207702_10368696 Ga0207702_103686962 279
60 3300037418 Ga0395900_0224907 Ga0395900_0224907_494_1336 279
61 3300037466 Ga0395898_0073202 Ga0395898_0073202_627_1469 279
62 3300037466 Ga0395898_0485286 Ga0395898_0485286_283_1125 279
63 3300037853 Ga0436364_0511907 Ga0436364_0511907_2276_3118 279
64 3300037853 Ga0436364_0553624 Ga0436364_0553624_5469_6308 279
65 3300037853 Ga0436364_0605045 Ga0436364_0605045_86_952 279
66 3300037853 Ga0436364_0682831 Ga0436364_0682831_346_1188 279
67 3300037853 Ga0436364_0740820 Ga0436364_0740820_1691_2533 279
68 3300037853 Ga0436364_0745657 Ga0436364_0745657_41511_42353 279
69 3300037853 Ga0436364_0940248 Ga0436364_0940248_50391_51233 279
70 3300038443 Ga0395901_0639838 Ga0395901_0639838_178_1020 279
71 3300039437 Ga0436365_1841024 Ga0436365_1841024_779_1621 279
72 3300048929 Ga0496126_0184325 Ga0496126_0184325_556_1431 279
73 3300049571 Ga0501034_0063052 Ga0501034_0063052_2530_3384 279
74 3300049582 Ga0501048_0397024 Ga0501048_0397024_67_921 279
75 3300049586 Ga0501070_0049681 Ga0501070_0049681_2450_3304 279
76 3300049822 Ga0501035_0044284 Ga0501035_0044284_822_1676 279
77 3300049823 Ga0501044_0079344 Ga0501044_0079344_213_1067 279
78 3300005548 Ga0070665_100342997 Ga0070665_1003429972 280
79 3300009093 Ga0105240_10003797 Ga0105240_1000379717 280
80 3300009545 Ga0105237_10001666 Ga0105237_1000166617 280
81 3300014968 Ga0157379_10012121 Ga0157379_100121217 280
82 3300028379 Ga0268266_10168463 Ga0268266_101684632 280
83 3300031901 Ga0307406_10363566 Ga0307406_103635662 280
84 3300039450 Ga0436363_1491356 Ga0436363_1491356_99_944 280
85 3300048918 Ga0496115_0109458 Ga0496115_0109458_1276_2118 280
86 3300005548 Ga0070665_100041371 Ga0070665_1000413712 281
87 3300005842 Ga0068858_100078393 Ga0068858_1000783932 281
88 3300009093 Ga0105240_10239337 Ga0105240_102393373 281
89 3300013308 Ga0157375_10146248 Ga0157375_101462482 281
90 3300014325 Ga0163163_10066939 Ga0163163_100669392 281
91 3300025913 Ga0207695_10190200 Ga0207695_101902003 281
92 3300025941 Ga0207711_10242505 Ga0207711_102425052 281
93 3300031344 Ga0265316_10038758 Ga0265316_100387583 281
94 3300042876 Ga0451577_0610479 Ga0451577_0610479_66_917 281
95 3300005518 Ga0070699_100013927 Ga0070699_1000139275 282
96 3300005546 Ga0070696_100041737 Ga0070696_1000417372 282
97 3300044693 Ga0466961_0345707 Ga0466961_0345707_35_886 282
98 3300045049 Ga0466959_0084438 Ga0466959_0084438_1419_2270 282
99 3300035692 Ga0373935_0289574 Ga0373935_0289574_175_1032 283
100 3300005331 Ga0070670_100300456 Ga0070670_1003004562 284
101 3300005336 Ga0070680_100055274 Ga0070680_1000552742 284
102 3300005336 Ga0070680_100147847 Ga0070680_1001478472 284
103 3300005439 Ga0070711_100035076 Ga0070711_1000350763 284
104 3300005440 Ga0070705_100118144 Ga0070705_1001181441 284
105 3300005445 Ga0070708_100233544 Ga0070708_1002335442 284
106 3300005458 Ga0070681_10010865 Ga0070681_100108653 284
107 3300005466 Ga0070685_10341458 Ga0070685_103414581 284
108 3300005536 Ga0070697_100013288 Ga0070697_1000132887 284
109 3300005545 Ga0070695_100037810 Ga0070695_1000378102 284
110 3300005841 Ga0068863_100091402 Ga0068863_1000914023 284
111 3300006028 Ga0070717_10075636 Ga0070717_100756362 284
112 3300006358 Ga0068871_100192113 Ga0068871_1001921132 284
113 3300006358 Ga0068871_100208762 Ga0068871_1002087623 284
114 3300007076 Ga0075435_100133575 Ga0075435_1001335751 284
115 3300009098 Ga0105245_10237794 Ga0105245_102377942 284
116 3300009177 Ga0105248_10187252 Ga0105248_101872523 284
117 3300009177 Ga0105248_10532897 Ga0105248_105328972 284
118 3300013297 Ga0157378_10656804 Ga0157378_106568042 284
119 3300013306 Ga0163162_10085687 Ga0163162_100856873 284
120 3300013306 Ga0163162_10106891 Ga0163162_101068913 284
121 3300013307 Ga0157372_10321033 Ga0157372_103210332 284
122 3300014325 Ga0163163_10138570 Ga0163163_101385703 284
123 3300025903 Ga0207680_10198560 Ga0207680_101985602 284
124 3300025912 Ga0207707_10004730 Ga0207707_100047304 284
125 3300025921 Ga0207652_10534770 Ga0207652_105347702 284
126 3300025941 Ga0207711_10266931 Ga0207711_102669311 284
127 3300025944 Ga0207661_10063830 Ga0207661_100638302 284
128 3300026088 Ga0207641_10137482 Ga0207641_101374823 284
129 3300031241 Ga0265325_10108073 Ga0265325_101080732 284
130 3300031344 Ga0265316_10019367 Ga0265316_100193676 284
131 3300031344 Ga0265316_10088244 Ga0265316_100882442 284
132 3300035695 Ga0373927_0006012 Ga0373927_0006012_6776_7642 284
133 3300036401 Ga0373937_0325808 Ga0373937_0325808_47_910 284
134 3300037068 Ga0373925_0164832 Ga0373925_0164832_386_1252 284
135 3300046454 Ga0495592_0018695 Ga0495592_0018695_2486_3340 284
136 3300046462 Ga0495651_0009170 Ga0495651_0009170_1585_2439 284
137 3300046472 Ga0495580_0001715 Ga0495580_0001715_15009_15863 284
138 3300046472 Ga0495580_0011332 Ga0495580_0011332_5451_6317 284
139 3300046472 Ga0495580_0035061 Ga0495580_0035061_151_1017 284
140 3300046476 Ga0495662_0018586 Ga0495662_0018586_1464_2318 284
141 3300046477 Ga0495664_0015531 Ga0495664_0015531_2798_3652 284
142 3300046499 Ga0495594_0192386 Ga0495594_0192386_80_934 284
143 3300046511 Ga0495608_0222758 Ga0495608_0222758_232_1086 284
144 3300046514 Ga0495618_0144362 Ga0495618_0144362_332_1186 284
145 3300046516 Ga0495628_0015057 Ga0495628_0015057_4483_5337 284
146 3300046517 Ga0495630_0026293 Ga0495630_0026293_3413_4267 284
147 3300046529 Ga0495652_0034361 Ga0495652_0034361_2229_3083 284
148 3300046531 Ga0495665_0097849 Ga0495665_0097849_403_1257 284
149 3300046533 Ga0495640_0032172 Ga0495640_0032172_560_1414 284
150 3300046543 Ga0495645_0001071 Ga0495645_0001071_10414_11268 284
151 3300046543 Ga0495645_0192380 Ga0495645_0192380_18_890 284
152 3300046559 Ga0495667_0075280 Ga0495667_0075280_146_1000 284
153 3300046663 Ga0495635_0032977 Ga0495635_0032977_2182_3036 284
154 3300046675 Ga0495657_0084803 Ga0495657_0084803_1150_2004 284
155 3300046680 Ga0495646_0074208 Ga0495646_0074208_989_1843 284
156 3300046689 Ga0495613_0070566 Ga0495613_0070566_172_1026 284
157 3300047317 Ga0495604_0041653 Ga0495604_0041653_260_1114 284
158 3300047319 Ga0495674_0002548 Ga0495674_0002548_2452_3306 284
159 3300047319 Ga0495674_0059026 Ga0495674_0059026_2109_2963 284
160 3300047322 Ga0495680_0028484 Ga0495680_0028484_2124_2978 284
161 3300047444 Ga0495675_0047309 Ga0495675_0047309_1155_2021 284
162 3300047444 Ga0495675_0058885 Ga0495675_0058885_1209_2063 284
163 3300047471 Ga0495684_0004614 Ga0495684_0004614_9664_10518 284
164 3300047471 Ga0495684_0125922 Ga0495684_0125922_126_980 284
165 3300048088 Ga0495602_0174328 Ga0495602_0174328_45_899 284
166 3300048918 Ga0496115_0122655 Ga0496115_0122655_256_1110 284
167 3300050512 nmdc:mga0n895_353921_c1 nmdc:mga0n895_353921_c1_134_1000 284
168 3300050514 nmdc:mga08x19_719_c1 nmdc:mga08x19_719_c1_8932_9798 284
169 3300053085 Ga0495619_0233355 Ga0495619_0233355_112_966 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00800

PDT

Prephenate dehydratase

25

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qmx-assembly1.cif.gz_A the crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls 0.9369 7 281
6vh5-assembly1.cif.gz_C crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine 0.9348 7 282
7am0-assembly2.cif.gz_C gqqa- a novel type of quorum quenching acylases 0.9162 7 281
2qmx-assembly1.cif.gz_A the crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls 0.9142 7 281
7alz-assembly1.cif.gz_B gqqa- a novel type of quorum quenching acylases 0.9066 7 282
ID Description Score Start End Superfamily
2qmxB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9808 89 172 3.40.190.10
af_A0A1D6ELY8_206_287_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9685 93 172 3.40.190.10
af_A0A1D6ICV1_89_167_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9617 93 166 3.40.190.10
af_A0A1D6P6Q8_117_201_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9524 3 81 3.40.190.10
2qmxB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9518 6 85 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V6S424-F1-model_v4 Prephenate dehydratase 0.9858 200 282 GO:0004664
GO:0005737
GO:0009094
AF-A0A3M2D6V2-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9837 1 182 GO:0004664
GO:0005737
GO:0009094
AF-A0A4Q5WQC8-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9836 5 172 GO:0004664
GO:0005737
GO:0009094
AF-A0A7T5RUZ1-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9814 7 183 GO:0004664
GO:0005737
GO:0009094
AF-A0A2P0B4N6-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9795 7 184 GO:0004664
GO:0005737
GO:0009094

Feature Viewer

pLDDT pTM Quality
93.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map