F245902

General Info

Members Datasets Scaffolds Average Seq Length
165 126 153 184

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100818891|Ga0075431_1008188912
Length 207
Sequence MFRAGSSRYSAYTALMRPLKLRVNDSVELRQLVRDDAEELTILIDLNRSYLREWLPWLDSSGSINDTARFIGRSVEQAEDENGLTLAIICSGRIAGVIGQHYVDSLNRRTEIGYWLDAAHQGRGIVTRATARLVDHAYREQDINRVILQCASGNVKSRAVAERLGFAQEGILREAEWLYDHYVDLVVYSMLKRTWVTRKAANANRGV

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
4 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
5 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
6 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
7 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
8 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
9 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
10 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
103 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
104 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
105 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
106 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
107 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
108 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
109 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
110 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
111 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
117 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
118 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
119 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
126 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 0
Isolates 7.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0.61
Rhizoplane 6.67
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000287 3300003751 Bacteria 25664
2 Ga0055536_1026004 3300003781 Bacteria 1652
3 Ga0070676_10168900 3300005328 Bacteria 1413
4 Ga0070689_100442309 3300005340 Bacteria 1105
5 Ga0070668_100002284 3300005347 Bacteria 14135
6 Ga0070675_100033424 3300005354 Bacteria 4170
7 Ga0070675_100059755 3300005354 Bacteria 3146
8 Ga0070674_100022086 3300005356 Bacteria 4099
9 Ga0070674_100032896 3300005356 Bacteria 3447
10 Ga0070667_100146124 3300005367 Bacteria 2074
11 Ga0070714_100134651 3300005435 Bacteria 2211
12 Ga0070710_10403312 3300005437 Bacteria 917
13 Ga0070663_100292760 3300005455 Bacteria 1301
14 Ga0068867_100120129 3300005459 Bacteria 2030
15 Ga0070685_10122727 3300005466 Bacteria 1615
16 Ga0070685_10237647 3300005466 Unclassified 1201
17 Ga0070707_100001538 3300005468 Bacteria 22428
18 Ga0070699_101079835 3300005518 Unclassified 736
19 Ga0070672_100008500 3300005543 Bacteria 7028
20 Ga0070686_100109988 3300005544 Bacteria 1876
21 Ga0068864_100289145 3300005618 Bacteria 1532
22 Ga0068864_100716964 3300005618 Bacteria 978
23 Ga0068860_100490817 3300005843 Bacteria 1225
24 Ga0068860_100997636 3300005843 Unclassified 855
25 Ga0081539_10065306 3300005985 Bacteria 1977
26 Ga0081539_10105798 3300005985 Bacteria 1425
27 Ga0075431_100818891 3300006847 Bacteria 904
28 Ga0075433_10429315 3300006852 Bacteria 1165
29 Ga0075433_10573014 3300006852 Bacteria 992
30 Ga0075434_100100539 3300006871 Bacteria 2898
31 Ga0075434_100114003 3300006871 Unclassified 2716
32 Ga0075434_100144794 3300006871 Bacteria 2396
33 Ga0075434_101104707 3300006871 Bacteria 806
34 Ga0068865_100027520 3300006881 Bacteria 3757
35 Ga0068865_100314508 3300006881 Unclassified 1257
36 Ga0111539_10787398 3300009094 Unclassified 1107
37 Ga0114129_10009942 3300009147 Bacteria 13559
38 Ga0114129_10118777 3300009147 Bacteria 3642
39 Ga0105243_10126989 3300009148 Bacteria 2159
40 Ga0105242_10306855 3300009176 Bacteria 1451
41 Ga0105248_10220608 3300009177 Bacteria 2135
42 Ga0105248_10385665 3300009177 Bacteria 1578
43 Ga0105249_10171567 3300009553 Bacteria 2104
44 Ga0157375_10189721 3300013308 Bacteria 2210
45 Ga0157375_10863378 3300013308 Bacteria 1051
46 Ga0157375_10989957 3300013308 Bacteria 981
47 Ga0163163_10673541 3300014325 Bacteria 1098
48 Ga0157380_10134965 3300014326 Bacteria 2111
49 Ga0157379_10036548 3300014968 Bacteria 4379
50 Ga0157379_10269467 3300014968 Bacteria 1548
51 Ga0157376_10065889 3300014969 Bacteria 3061
52 Ga0157376_10441684 3300014969 Unclassified 1267
53 Ga0157376_10744958 3300014969 Bacteria 988
54 Ga0209784_100031 3300025224 Bacteria 318854
55 Ga0209147_100098 3300025229 Bacteria 163978
56 Ga0209676_1001125 3300025292 Bacteria 29373
57 Ga0209676_1025603 3300025292 Bacteria 1889
58 Ga0209676_1072101 3300025292 Bacteria 817
59 Ga0209025_1005715 3300025294 Bacteria 9997
60 Ga0209025_1021148 3300025294 Bacteria 3519
61 Ga0209025_1029070 3300025294 Bacteria 2688
62 Ga0209025_1079864 3300025294 Bacteria 1116
63 Ga0207646_10000409 3300025922 Bacteria 57577
64 Ga0207687_10928280 3300025927 Unclassified 745
65 Ga0207664_10293343 3300025929 Bacteria 1429
66 Ga0207686_10570045 3300025934 Unclassified 887
67 Ga0207670_10074005 3300025936 Bacteria 2364
68 Ga0207670_10101652 3300025936 Bacteria 2054
69 Ga0207669_10012307 3300025937 Bacteria 4202
70 Ga0207691_10355118 3300025940 Bacteria 1254
71 Ga0207711_10511495 3300025941 Bacteria 1119
72 Ga0207651_10011059 3300025960 Bacteria 5033
73 Ga0207651_10032957 3300025960 Bacteria 3335
74 Ga0207678_10251957 3300026067 Bacteria 1512
75 Ga0207708_10039769 3300026075 Bacteria 3585
76 Ga0207648_10025506 3300026089 Bacteria 5264
77 Ga0207648_10253919 3300026089 Bacteria 1568
78 Ga0207676_10221383 3300026095 Bacteria 1686
79 Ga0207675_100221629 3300026118 Bacteria 1822
80 Ga0207683_10492292 3300026121 Bacteria 1132
81 Ga0268264_10129847 3300028381 Bacteria 2232
82 Ga0268264_10699296 3300028381 Bacteria 1007
83 Ga0307511_10007412 3300030521 Bacteria 11036
84 Ga0307408_100047200 3300031548 Unclassified 3083
85 Ga0307405_10007318 3300031731 Bacteria 5507
86 Ga0307413_10003632 3300031824 Bacteria 6545
87 Ga0307410_10004418 3300031852 Bacteria 7270
88 Ga0307406_10004630 3300031901 Bacteria 7489
89 Ga0307407_10037127 3300031903 Unclassified 2689
90 Ga0307412_10076058 3300031911 Bacteria 2305
91 Ga0307409_100005654 3300031995 Bacteria 7237
92 Ga0307409_101127432 3300031995 Bacteria 806
93 Ga0307416_100085943 3300032002 Unclassified 2679
94 Ga0307414_10030888 3300032004 Unclassified 3505
95 Ga0307414_10385566 3300032004 Bacteria 1213
96 Ga0307411_10003221 3300032005 Bacteria 7517
97 Ga0307411_10381290 3300032005 Bacteria 1160
98 Ga0307415_100159526 3300032126 Bacteria 1746
99 Ga0400483_010837 3300039062 Bacteria 1315
100 Ga0466965_0151268 3300044683 Bacteria 1213
101 Ga0466965_0275334 3300044683 Unclassified 908
102 Ga0466961_0007304 3300044693 Bacteria 7031
103 Ga0466960_0306751 3300044901 Bacteria 896
104 Ga0466959_0121173 3300045049 Bacteria 1859
105 Ga0466958_0068633 3300045836 Bacteria 2167
106 Ga0495663_0047875 3300046525 Bacteria 1317
107 Ga0495622_0088914 3300046557 Bacteria 1420
108 Ga0495622_0147193 3300046557 Unclassified 1067
109 Ga0495634_0141226 3300046642 Bacteria 1529
110 Ga0495634_0197055 3300046642 Bacteria 1253
111 Ga0495658_0036058 3300046683 Unclassified 2726
112 Ga0495680_0370065 3300047322 Bacteria 994
113 Ga0496100_0536990 3300048903 Bacteria 904
114 Ga0496104_0044426 3300048907 Bacteria 4175
115 Ga0496108_0029167 3300048911 Bacteria 4568
116 Ga0496109_0107600 3300048912 Bacteria 2590
117 Ga0496109_0113445 3300048912 Bacteria 2521
118 Ga0496110_0003536 3300048913 Bacteria 11999
119 Ga0496110_0341717 3300048913 Unclassified 1363
120 Ga0496110_0483641 3300048913 Bacteria 1128
121 Ga0496112_0013335 3300048915 Bacteria 7586
122 Ga0496113_0001353 3300048916 Bacteria 13569
123 Ga0496124_0000001 3300048927 Bacteria 1747840
124 Ga0501034_0856406 3300049571 Unclassified 799
125 Ga0501067_0066953 3300049583 Bacteria 1988
126 Ga0501070_0021481 3300049586 Bacteria 5415
127 Ga0501073_0095062 3300049589 Bacteria 2070
128 Ga0501223_028213 3300049663 Unclassified 1093
129 Ga0501224_011945 3300049664 Bacteria 1279
130 Ga0501227_012335 3300049665 Unclassified 1871
131 Ga0501230_026371 3300049667 Unclassified 1055
132 Ga0501235_035059 3300049669 Unclassified 1139
133 Ga0501239_000969 3300049672 Unclassified 2360
134 Ga0501240_024213 3300049673 Unclassified 935
135 Ga0501242_013523 3300049674 Unclassified 1003
136 Ga0501247_010465 3300049677 Bacteria 1105
137 Ga0501248_004213 3300049678 Unclassified 1076
138 Ga0501249_000997 3300049679 Bacteria 6107
139 Ga0501225_0012113 3300049705 Bacteria 2423
140 Ga0501079_0665304 3300049741 Bacteria 820
141 Ga0501081_0193147 3300049743 Bacteria 1475
142 Ga0501263_001800 3300049760 Unclassified 2089
143 Ga0501268_000034 3300049765 Bacteria 11218
144 Ga0501270_000416 3300049767 Bacteria 3649
145 Ga0501273_002198 3300049770 Unclassified 1965
146 nmdc:mga05p37_268419_c1 3300050507 Bacteria 2040
147 nmdc:mga06r32_738988_c1 3300050510 Bacteria 948
148 nmdc:mga0n895_263090_c1 3300050512 Bacteria 1750
149 nmdc:mga0a205_328893_c1 3300050515 Bacteria 1398
150 nmdc:mga0a205_467715_c1 3300050515 Unclassified 1120
151 nmdc:mga0a205_565186_c1 3300050515 Bacteria 992
152 nmdc:mga0a205_592730_c1 3300050515 Bacteria 962
153 Ga0501082_0147014 3300060353 Bacteria 2046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10441684 Ga0157376_104416841 158
2 3300050515 nmdc:mga0a205_328893_c1 nmdc:mga0a205_328893_c1_636_1151 159
3 3300046557 Ga0495622_0088914 Ga0495622_0088914_27_548 167
4 3300005354 Ga0070675_100059755 Ga0070675_1000597552 170
5 3300009177 Ga0105248_10385665 Ga0105248_103856652 170
6 3300049583 Ga0501067_0066953 Ga0501067_0066953_1046_1573 171
7 3300039062 Ga0400483_010837 Ga0400483_010837_625_1167 172
8 3300005466 Ga0070685_10122727 Ga0070685_101227272 174
9 3300005544 Ga0070686_100109988 Ga0070686_1001099882 174
10 3300005843 Ga0068860_100997636 Ga0068860_1009976362 174
11 3300013308 Ga0157375_10989957 Ga0157375_109899572 174
12 3300028381 Ga0268264_10699296 Ga0268264_106992962 174
13 3300048903 Ga0496100_0536990 Ga0496100_0536990_273_809 174
14 3300048912 Ga0496109_0113445 Ga0496109_0113445_184_720 174
15 3300048913 Ga0496110_0483641 Ga0496110_0483641_43_579 174
16 3300005985 Ga0081539_10065306 Ga0081539_100653062 176
17 3300005985 Ga0081539_10105798 Ga0081539_101057982 176
18 3300049741 Ga0501079_0665304 Ga0501079_0665304_160_702 176
19 3300049743 Ga0501081_0193147 Ga0501081_0193147_595_1158 176
20 iso_pu_bacteria 8055531788 8055533414 176
21 3300005356 Ga0070674_100032896 Ga0070674_1000328962 177
22 3300005455 Ga0070663_100292760 Ga0070663_1002927602 177
23 3300005459 Ga0068867_100120129 Ga0068867_1001201292 177
24 3300005466 Ga0070685_10237647 Ga0070685_102376471 177
25 3300005618 Ga0068864_100289145 Ga0068864_1002891452 177
26 3300005618 Ga0068864_100716964 Ga0068864_1007169642 177
27 3300005843 Ga0068860_100490817 Ga0068860_1004908171 177
28 3300006881 Ga0068865_100027520 Ga0068865_1000275203 177
29 3300009094 Ga0111539_10787398 Ga0111539_107873982 177
30 3300009148 Ga0105243_10126989 Ga0105243_101269892 177
31 3300009176 Ga0105242_10306855 Ga0105242_103068552 177
32 3300009553 Ga0105249_10171567 Ga0105249_101715672 177
33 3300013308 Ga0157375_10863378 Ga0157375_108633782 177
34 3300014326 Ga0157380_10134965 Ga0157380_101349652 177
35 3300014968 Ga0157379_10269467 Ga0157379_102694672 177
36 3300014969 Ga0157376_10744958 Ga0157376_107449582 177
37 3300025927 Ga0207687_10928280 Ga0207687_109282801 177
38 3300025934 Ga0207686_10570045 Ga0207686_105700452 177
39 3300025936 Ga0207670_10074005 Ga0207670_100740052 177
40 3300026067 Ga0207678_10251957 Ga0207678_102519572 177
41 3300026075 Ga0207708_10039769 Ga0207708_100397693 177
42 3300026089 Ga0207648_10253919 Ga0207648_102539192 177
43 3300026095 Ga0207676_10221383 Ga0207676_102213832 177
44 3300026121 Ga0207683_10492292 Ga0207683_104922922 177
45 3300028381 Ga0268264_10129847 Ga0268264_101298472 177
46 3300044683 Ga0466965_0151268 Ga0466965_0151268_629_1174 177
47 3300044683 Ga0466965_0275334 Ga0466965_0275334_32_571 177
48 3300046525 Ga0495663_0047875 Ga0495663_0047875_287_835 177
49 3300046642 Ga0495634_0197055 Ga0495634_0197055_214_765 177
50 3300048913 Ga0496110_0003536 Ga0496110_0003536_9310_9873 177
51 3300048927 Ga0496124_0000001 Ga0496124_0000001_607557_608120 177
52 iso_pu_bacteria 2510917027 2511176076 177
53 iso_pu_bacteria 2786546517 2787435308 177
54 iso_pu_bacteria 2857591370 2857594641 177
55 iso_pu_bacteria 2915606848 2915611492 177
56 iso_pu_bacteria 3006879489 3006879589 177
57 3300025929 Ga0207664_10293343 Ga0207664_102933432 178
58 3300044693 Ga0466961_0007304 Ga0466961_0007304_4234_4773 178
59 3300045049 Ga0466959_0121173 Ga0466959_0121173_552_1091 178
60 3300045836 Ga0466958_0068633 Ga0466958_0068633_1172_1711 178
61 3300046642 Ga0495634_0141226 Ga0495634_0141226_575_1111 178
62 3300047322 Ga0495680_0370065 Ga0495680_0370065_344_880 178
63 iso_pu_bacteria 2844852863 2844855515 178
64 iso_pu_bacteria 8056037122 8056037491 178
65 3300005435 Ga0070714_100134651 Ga0070714_1001346512 179
66 3300005437 Ga0070710_10403312 Ga0070710_104033122 179
67 3300044901 Ga0466960_0306751 Ga0466960_0306751_136_678 179
68 3300048907 Ga0496104_0044426 Ga0496104_0044426_2467_3015 179
69 3300048911 Ga0496108_0029167 Ga0496108_0029167_1895_2443 179
70 3300048912 Ga0496109_0107600 Ga0496109_0107600_693_1241 179
71 3300048913 Ga0496110_0341717 Ga0496110_0341717_238_786 179
72 3300048915 Ga0496112_0013335 Ga0496112_0013335_955_1503 179
73 3300048916 Ga0496113_0001353 Ga0496113_0001353_8640_9188 179
74 3300049586 Ga0501070_0021481 Ga0501070_0021481_3503_4102 179
75 3300003751 Ga0055538_1000287 Ga0055538_10002871 180
76 3300003781 Ga0055536_1026004 Ga0055536_10260042 180
77 3300005328 Ga0070676_10168900 Ga0070676_101689002 180
78 3300005340 Ga0070689_100442309 Ga0070689_1004423092 180
79 3300005347 Ga0070668_100002284 Ga0070668_1000022849 180
80 3300005354 Ga0070675_100033424 Ga0070675_1000334242 180
81 3300005356 Ga0070674_100022086 Ga0070674_1000220863 180
82 3300005367 Ga0070667_100146124 Ga0070667_1001461242 180
83 3300005468 Ga0070707_100001538 Ga0070707_10000153815 180
84 3300005518 Ga0070699_101079835 Ga0070699_1010798351 180
85 3300005543 Ga0070672_100008500 Ga0070672_1000085003 180
86 3300006847 Ga0075431_100818891 Ga0075431_1008188912 180
87 3300006852 Ga0075433_10429315 Ga0075433_104293152 180
88 3300006852 Ga0075433_10573014 Ga0075433_105730142 180
89 3300006871 Ga0075434_100100539 Ga0075434_1001005393 180
90 3300006871 Ga0075434_100114003 Ga0075434_1001140034 180
91 3300006871 Ga0075434_100144794 Ga0075434_1001447944 180
92 3300006871 Ga0075434_101104707 Ga0075434_1011047071 180
93 3300006881 Ga0068865_100314508 Ga0068865_1003145082 180
94 3300009147 Ga0114129_10009942 Ga0114129_1000994216 180
95 3300009147 Ga0114129_10118777 Ga0114129_101187773 180
96 3300009177 Ga0105248_10220608 Ga0105248_102206082 180
97 3300013308 Ga0157375_10189721 Ga0157375_101897212 180
98 3300014325 Ga0163163_10673541 Ga0163163_106735412 180
99 3300014968 Ga0157379_10036548 Ga0157379_100365483 180
100 3300014969 Ga0157376_10065889 Ga0157376_100658892 180
101 3300025224 Ga0209784_100031 Ga0209784_100031119 180
102 3300025229 Ga0209147_100098 Ga0209147_10009847 180
103 3300025292 Ga0209676_1001125 Ga0209676_100112517 180
104 3300025292 Ga0209676_1025603 Ga0209676_10256032 180
105 3300025292 Ga0209676_1072101 Ga0209676_10721011 180
106 3300025294 Ga0209025_1005715 Ga0209025_10057156 180
107 3300025294 Ga0209025_1021148 Ga0209025_10211483 180
108 3300025294 Ga0209025_1029070 Ga0209025_10290703 180
109 3300025294 Ga0209025_1079864 Ga0209025_10798641 180
110 3300025922 Ga0207646_10000409 Ga0207646_1000040917 180
111 3300025936 Ga0207670_10101652 Ga0207670_101016522 180
112 3300025937 Ga0207669_10012307 Ga0207669_100123072 180
113 3300025940 Ga0207691_10355118 Ga0207691_103551182 180
114 3300025941 Ga0207711_10511495 Ga0207711_105114952 180
115 3300025960 Ga0207651_10011059 Ga0207651_100110592 180
116 3300025960 Ga0207651_10032957 Ga0207651_100329572 180
117 3300026089 Ga0207648_10025506 Ga0207648_100255063 180
118 3300026118 Ga0207675_100221629 Ga0207675_1002216292 180
119 3300030521 Ga0307511_10007412 Ga0307511_100074127 180
120 3300031548 Ga0307408_100047200 Ga0307408_1000472002 180
121 3300031731 Ga0307405_10007318 Ga0307405_100073182 180
122 3300031824 Ga0307413_10003632 Ga0307413_100036325 180
123 3300031852 Ga0307410_10004418 Ga0307410_100044182 180
124 3300031901 Ga0307406_10004630 Ga0307406_100046306 180
125 3300031903 Ga0307407_10037127 Ga0307407_100371272 180
126 3300031911 Ga0307412_10076058 Ga0307412_100760582 180
127 3300031995 Ga0307409_100005654 Ga0307409_1000056542 180
128 3300031995 Ga0307409_101127432 Ga0307409_1011274322 180
129 3300032002 Ga0307416_100085943 Ga0307416_1000859432 180
130 3300032004 Ga0307414_10030888 Ga0307414_100308882 180
131 3300032004 Ga0307414_10385566 Ga0307414_103855661 180
132 3300032005 Ga0307411_10003221 Ga0307411_100032215 180
133 3300032005 Ga0307411_10381290 Ga0307411_103812902 180
134 3300032126 Ga0307415_100159526 Ga0307415_1001595262 180
135 3300046557 Ga0495622_0147193 Ga0495622_0147193_361_918 180
136 3300046683 Ga0495658_0036058 Ga0495658_0036058_1043_1612 180
137 3300049571 Ga0501034_0856406 Ga0501034_0856406_19_582 180
138 3300049589 Ga0501073_0095062 Ga0501073_0095062_261_818 180
139 3300049663 Ga0501223_028213 Ga0501223_028213_42_599 180
140 3300049664 Ga0501224_011945 Ga0501224_011945_350_907 180
141 3300049665 Ga0501227_012335 Ga0501227_012335_483_1040 180
142 3300049667 Ga0501230_026371 Ga0501230_026371_452_1009 180
143 3300049669 Ga0501235_035059 Ga0501235_035059_570_1127 180
144 3300049672 Ga0501239_000969 Ga0501239_000969_842_1399 180
145 3300049673 Ga0501240_024213 Ga0501240_024213_260_817 180
146 3300049674 Ga0501242_013523 Ga0501242_013523_202_759 180
147 3300049677 Ga0501247_010465 Ga0501247_010465_135_692 180
148 3300049678 Ga0501248_004213 Ga0501248_004213_480_1037 180
149 3300049679 Ga0501249_000997 Ga0501249_000997_701_1258 180
150 3300049705 Ga0501225_0012113 Ga0501225_0012113_639_1196 180
151 3300049760 Ga0501263_001800 Ga0501263_001800_840_1397 180
152 3300049765 Ga0501268_000034 Ga0501268_000034_5169_5726 180
153 3300049767 Ga0501270_000416 Ga0501270_000416_569_1126 180
154 3300049770 Ga0501273_002198 Ga0501273_002198_925_1482 180
155 3300050507 nmdc:mga05p37_268419_c1 nmdc:mga05p37_268419_c1_633_1202 180
156 3300050510 nmdc:mga06r32_738988_c1 nmdc:mga06r32_738988_c1_169_747 180
157 3300050512 nmdc:mga0n895_263090_c1 nmdc:mga0n895_263090_c1_139_684 180
158 3300050515 nmdc:mga0a205_467715_c1 nmdc:mga0a205_467715_c1_523_1068 180
159 3300050515 nmdc:mga0a205_565186_c1 nmdc:mga0a205_565186_c1_141_692 180
160 3300050515 nmdc:mga0a205_592730_c1 nmdc:mga0a205_592730_c1_346_915 180
161 3300060353 Ga0501082_0147014 Ga0501082_0147014_276_824 180
162 iso_pu_bacteria 2512564013 2512639940 180
163 iso_pu_bacteria 2857465823 2857467833 180
164 iso_pu_bacteria 2915597211 2915597305 180
165 iso_pu_bacteria 2929183550 2929188752 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

26

167

0.93

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

29

187

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

43

166

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.9698 1 173
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.9536 1 173
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.9519 1 177
1s7k-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) 0.9483 1 174
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.947 5 173
ID Description Score Start End Superfamily
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9889 3 174 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9721 3 174 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9603 4 173 3.40.630.30
1z9uA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9452 1 173 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9418 9 176 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V1GUZ3-F1-model_v4 N-acetyltransferase domain-containing protein 0.993 1 179 GO:0005737
GO:0008999
GO:1990189
AF-A0A7J4S5A7-F1-model_v4 GNAT family N-acetyltransferase 0.9917 2 179 GO:0005737
GO:0008999
GO:1990189
AF-A0A2E3LU10-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9905 1 178 GO:0005737
GO:0008999
GO:1990189
AF-R1GNU1-F1-model_v4 Ribosomal-protein-serine acetyltransferase 0.9895 1 179 GO:0005737
GO:0008999
GO:1990189
AF-A0A6N6VX14-F1-model_v4 GNAT family N-acetyltransferase 0.9893 1 180 GO:0005737
GO:0008999
GO:1990189

Feature Viewer

pLDDT pTM Quality
96.86 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map