F239608

General Info

Members Datasets Scaffolds Average Seq Length
162 134 148 70

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10386670|Ga0307513_103866702
Length 66
Sequence MTNPFEDQDGTYLVLVNDENQHSLWPSYVPAGWRTAHGPTDRQSCVDFVERNWTDMRPQSLIDAME

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2643221593 Lysobacter sp. Root690 Isolate Unclassified
3 2773857933 Frankia sp. BMG5.30 Isolate Nodule
4 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
5 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
6 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
7 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
8 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
128 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
129 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
130 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
131 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
132 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
133 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
134 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.12
Metatranscriptomes 1.23
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 1.23
Rhizoplane 1.85
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100005889 3300005347 Bacteria 9087
2 Ga0070659_101020241 3300005366 Bacteria 727
3 Ga0070714_100213386 3300005435 Bacteria 1770
4 Ga0070714_100954644 3300005435 Bacteria 833
5 Ga0070710_10655539 3300005437 Bacteria 736
6 Ga0070663_101746617 3300005455 Bacteria 557
7 Ga0070681_10568742 3300005458 Bacteria 1047
8 Ga0070706_100569113 3300005467 Bacteria 1054
9 Ga0070665_101913924 3300005548 Bacteria 599
10 Ga0070664_100558503 3300005564 Bacteria 1059
11 Ga0081455_10573451 3300005937 Bacteria 741
12 Ga0070717_10954043 3300006028 Bacteria 781
13 Ga0075367_11129620 3300006178 Bacteria 501
14 Ga0075366_10238792 3300006195 Bacteria 1108
15 Ga0075428_100309674 3300006844 Bacteria 1697
16 Ga0075428_102685319 3300006844 Bacteria 508
17 Ga0075430_100772120 3300006846 Bacteria 792
18 Ga0075431_100303604 3300006847 Bacteria 1612
19 Ga0075431_101063295 3300006847 Bacteria 775
20 Ga0075433_10287661 3300006852 Bacteria 1456
21 Ga0075434_100312214 3300006871 Bacteria 1592
22 Ga0075429_100056463 3300006880 Bacteria 3417
23 Ga0075429_100573519 3300006880 Bacteria 989
24 Ga0075435_100926162 3300007076 Bacteria 760
25 Ga0105240_10615813 3300009093 Bacteria 1194
26 Ga0111539_11936575 3300009094 Bacteria 683
27 Ga0114129_10232523 3300009147 Bacteria 2482
28 Ga0114129_10533583 3300009147 Bacteria 1528
29 Ga0105237_10387075 3300009545 Bacteria 1403
30 Ga0099796_10334814 3300010159 Unclassified 649
31 Ga0157369_10099269 3300013105 Bacteria 3104
32 Ga0182008_10090262 3300014497 Bacteria 1510
33 Ga0157377_11257406 3300014745 Bacteria 576
34 Ga0182005_1172972 3300015265 Bacteria 638
35 Ga0197907_10656801 3300020069 Bacteria 585
36 Ga0206356_11541446 3300020070 Bacteria 562
37 Ga0213876_10445904 3300021384 Bacteria 688
38 Ga0207425_1001769 3300025245 Bacteria 8420
39 Ga0209025_1000005 3300025294 Bacteria 1272149
40 Ga0209758_1022113 3300025297 Bacteria 2934
41 Ga0207692_10453624 3300025898 Bacteria 807
42 Ga0207684_10629450 3300025910 Bacteria 915
43 Ga0207663_10690512 3300025916 Bacteria 808
44 Ga0207652_11235163 3300025921 Bacteria 649
45 Ga0207700_10091319 3300025928 Bacteria 2405
46 Ga0207664_10861521 3300025929 Bacteria 814
47 Ga0207664_11404417 3300025929 Bacteria 619
48 Ga0207668_10009322 3300025972 Bacteria 5877
49 Ga0207678_11178248 3300026067 Bacteria 678
50 Ga0268266_10928995 3300028379 Bacteria 842
51 Ga0307515_10012651 3300028794 Bacteria 15851
52 Ga0307515_10303967 3300028794 Bacteria 1277
53 Ga0307511_10000070 3300030521 Bacteria 85179
54 Ga0307511_10000075 3300030521 Bacteria 82985
55 Ga0307512_10238831 3300030522 Bacteria 922
56 Ga0307513_10386670 3300031456 Bacteria 1137
57 Ga0307516_10601481 3300031730 Unclassified 754
58 Ga0307405_10101044 3300031731 Bacteria 1934
59 Ga0307413_10529699 3300031824 Bacteria 952
60 Ga0307413_11349506 3300031824 Bacteria 625
61 Ga0307410_10406109 3300031852 Bacteria 1102
62 Ga0307406_10089007 3300031901 Bacteria 2073
63 Ga0307407_10220616 3300031903 Bacteria 1282
64 Ga0307409_100198606 3300031995 Bacteria 1792
65 Ga0307416_101463174 3300032002 Bacteria 789
66 Ga0307411_10052540 3300032005 Bacteria 2665
67 Ga0307415_100099930 3300032126 Bacteria 2125
68 Ga0307415_100296506 3300032126 Bacteria 1337
69 Ga0373934_0112971 3300035086 Bacteria 1103
70 Ga0316574_0589725 3300035398 Bacteria 687
71 Ga0373925_0037539 3300037068 Bacteria 3577
72 Ga0436364_0740641 3300037853 Bacteria 4623
73 Ga0436365_0092631 3300039437 Bacteria 1233
74 Ga0451797_0215786 3300041453 Bacteria 527
75 Ga0451837_0265133 3300041494 Bacteria 816
76 Ga0466969_0003504 3300044656 Bacteria 8332
77 Ga0466969_0111448 3300044656 Bacteria 1280
78 Ga0466972_0085980 3300044658 Bacteria 1495
79 Ga0466965_0708460 3300044683 Bacteria 578
80 Ga0466966_0015682 3300044684 Bacteria 5010
81 Ga0466966_0037968 3300044684 Bacteria 3104
82 Ga0466966_0038192 3300044684 Bacteria 3094
83 Ga0466966_0136138 3300044684 Bacteria 1502
84 Ga0466961_0003773 3300044693 Bacteria 9473
85 Ga0466961_0032753 3300044693 Bacteria 3340
86 Ga0466961_0042030 3300044693 Bacteria 2930
87 Ga0466963_0041300 3300044694 Bacteria 3025
88 Ga0466971_0025618 3300044719 Bacteria 2634
89 Ga0466971_0085563 3300044719 Bacteria 1441
90 Ga0466971_0588038 3300044719 Bacteria 554
91 Ga0466968_0001838 3300044735 Bacteria 7660
92 Ga0466968_0030379 3300044735 Bacteria 2238
93 Ga0466970_0005134 3300044765 Bacteria 6471
94 Ga0466970_0051511 3300044765 Bacteria 2197
95 Ga0466970_0085319 3300044765 Bacteria 1710
96 Ga0466957_0283686 3300044842 Bacteria 1109
97 Ga0466957_1298677 3300044842 Bacteria 528
98 Ga0466959_0003406 3300045049 Bacteria 10400
99 Ga0466959_0051088 3300045049 Bacteria 3034
100 Ga0466959_0133005 3300045049 Bacteria 1762
101 Ga0466958_0024140 3300045836 Bacteria 3576
102 Ga0466958_0197519 3300045836 Bacteria 1280
103 Ga0466958_0344159 3300045836 Bacteria 959
104 Ga0466967_0912189 3300045976 Bacteria 874
105 Ga0466967_1896227 3300045976 Bacteria 593
106 Ga0495651_0000436 3300046462 Bacteria 32184
107 Ga0495662_0000085 3300046476 Bacteria 33567
108 Ga0495664_0008436 3300046477 Bacteria 5749
109 Ga0495608_0476453 3300046511 Bacteria 757
110 Ga0495628_0005990 3300046516 Bacteria 10636
111 Ga0495630_0000359 3300046517 Bacteria 36192
112 Ga0495666_0047032 3300046526 Bacteria 2078
113 Ga0495652_0001093 3300046529 Bacteria 30670
114 Ga0495665_0543589 3300046531 Bacteria 583
115 Ga0495640_0004806 3300046533 Bacteria 10756
116 Ga0495586_0653816 3300046535 Bacteria 607
117 Ga0495587_0002944 3300046536 Bacteria 11388
118 Ga0495645_0010449 3300046543 Bacteria 6507
119 Ga0495667_0000328 3300046559 Bacteria 29971
120 Ga0495634_0009701 3300046642 Bacteria 7085
121 Ga0495635_0000835 3300046663 Bacteria 20180
122 Ga0495657_0006039 3300046675 Bacteria 9510
123 Ga0495599_0011238 3300046678 Bacteria 5498
124 Ga0495623_0000301 3300046679 Bacteria 32221
125 Ga0495646_0000169 3300046680 Bacteria 32603
126 Ga0495613_0065311 3300046689 Bacteria 2659
127 Ga0495600_0000228 3300046809 Bacteria 31160
128 Ga0495604_0000585 3300047317 Bacteria 31780
129 Ga0495674_0034282 3300047319 Bacteria 4591
130 Ga0495675_0000448 3300047444 Bacteria 27380
131 Ga0495684_0000440 3300047471 Bacteria 34016
132 Ga0495602_0010456 3300048088 Bacteria 9632
133 Ga0496113_1404724 3300048916 Bacteria 541
134 Ga0501048_0420451 3300049582 Bacteria 956
135 Ga0501044_0125022 3300049823 Bacteria 2570
136 nmdc:mga03n38_770362_c1 3300050490 Bacteria 558
137 nmdc:mga0k408_235013_c1 3300050493 Bacteria 1094
138 nmdc:mga06z11_493969_c1 3300050494 Bacteria 741
139 nmdc:mga05p37_29490_c1 3300050507 Bacteria 6695
140 nmdc:mga05p37_529666_c1 3300050507 Bacteria 1346
141 nmdc:mga09592_228493_c1 3300050508 Bacteria 1612
142 nmdc:mga06r32_554676_c1 3300050510 Bacteria 1123
143 nmdc:mga08y16_2153369_c1 3300050511 Bacteria 505
144 nmdc:mga0n895_292010_c1 3300050512 Bacteria 1653
145 nmdc:mga0rr50_1019918_c1 3300050513 Bacteria 705
146 nmdc:mga0a205_77230_c1 3300050515 Bacteria 3218
147 Ga0500660_230097 3300053100 Bacteria 597
148 Ga0500557_210736 3300053105 Bacteria 622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2775506925 2776373556 58
2 iso_pu_bacteria 2863067949 2863068646 58
3 iso_pu_bacteria 2866552031 2866556199 58
4 iso_pu_bacteria 8056207758 8056215599 58
5 iso_pu_bacteria 2506783011 2506864580 64
6 iso_pu_bacteria 2643221593 2643976765 64
7 iso_pu_bacteria 2773857933 2774905092 64
8 iso_pu_bacteria 2791355406 2793975476 64
9 iso_pu_bacteria 3006425503 3006428533 64
10 iso_pu_bacteria 8047893842 8047900261 64
11 iso_pu_bacteria 8048356638 8048358671 64
12 iso_pu_bacteria 8048369669 8048377202 64
13 iso_pu_bacteria 8048379754 8048386262 64
14 3300005366 Ga0070659_101020241 Ga0070659_1010202412 65
15 3300005455 Ga0070663_101746617 Ga0070663_1017466172 65
16 3300005564 Ga0070664_100558503 Ga0070664_1005585032 65
17 3300014745 Ga0157377_11257406 Ga0157377_112574062 65
18 3300026067 Ga0207678_11178248 Ga0207678_111782482 65
19 iso_pu_bacteria 8025413630 8025417879 65
20 3300031456 Ga0307513_10386670 Ga0307513_103866702 66
21 3300035086 Ga0373934_0112971 Ga0373934_0112971_599_799 66
22 3300005458 Ga0070681_10568742 Ga0070681_105687422 67
23 3300005937 Ga0081455_10573451 Ga0081455_105734511 67
24 3300006195 Ga0075366_10238792 Ga0075366_102387922 67
25 3300032126 Ga0307415_100296506 Ga0307415_1002965062 67
26 3300049582 Ga0501048_0420451 Ga0501048_0420451_538_744 67
27 3300049823 Ga0501044_0125022 Ga0501044_0125022_1236_1442 67
28 3300050490 nmdc:mga03n38_770362_c1 nmdc:mga03n38_770362_c1_323_526 67
29 3300050493 nmdc:mga0k408_235013_c1 nmdc:mga0k408_235013_c1_99_329 67
30 3300050494 nmdc:mga06z11_493969_c1 nmdc:mga06z11_493969_c1_88_291 67
31 3300005347 Ga0070668_100005889 Ga0070668_1000058898 68
32 3300005435 Ga0070714_100213386 Ga0070714_1002133862 68
33 3300005435 Ga0070714_100954644 Ga0070714_1009546441 68
34 3300005437 Ga0070710_10655539 Ga0070710_106555392 68
35 3300005467 Ga0070706_100569113 Ga0070706_1005691132 68
36 3300005548 Ga0070665_101913924 Ga0070665_1019139242 68
37 3300006028 Ga0070717_10954043 Ga0070717_109540432 68
38 3300006178 Ga0075367_11129620 Ga0075367_111296202 68
39 3300006844 Ga0075428_100309674 Ga0075428_1003096742 68
40 3300006844 Ga0075428_102685319 Ga0075428_1026853191 68
41 3300006846 Ga0075430_100772120 Ga0075430_1007721201 68
42 3300006847 Ga0075431_100303604 Ga0075431_1003036044 68
43 3300006847 Ga0075431_101063295 Ga0075431_1010632952 68
44 3300006852 Ga0075433_10287661 Ga0075433_102876613 68
45 3300006871 Ga0075434_100312214 Ga0075434_1003122142 68
46 3300006880 Ga0075429_100056463 Ga0075429_1000564633 68
47 3300006880 Ga0075429_100573519 Ga0075429_1005735193 68
48 3300007076 Ga0075435_100926162 Ga0075435_1009261622 68
49 3300009093 Ga0105240_10615813 Ga0105240_106158132 68
50 3300009094 Ga0111539_11936575 Ga0111539_119365752 68
51 3300009147 Ga0114129_10232523 Ga0114129_102325232 68
52 3300009147 Ga0114129_10533583 Ga0114129_105335832 68
53 3300009545 Ga0105237_10387075 Ga0105237_103870752 68
54 3300010159 Ga0099796_10334814 Ga0099796_103348142 68
55 3300013105 Ga0157369_10099269 Ga0157369_100992692 68
56 3300014497 Ga0182008_10090262 Ga0182008_100902622 68
57 3300015265 Ga0182005_1172972 Ga0182005_11729722 68
58 3300020069 Ga0197907_10656801 Ga0197907_106568012 68
59 3300020070 Ga0206356_11541446 Ga0206356_115414462 68
60 3300021384 Ga0213876_10445904 Ga0213876_104459042 68
61 3300025245 Ga0207425_1001769 Ga0207425_10017692 68
62 3300025294 Ga0209025_1000005 Ga0209025_1000005705 68
63 3300025297 Ga0209758_1022113 Ga0209758_10221132 68
64 3300025898 Ga0207692_10453624 Ga0207692_104536242 68
65 3300025910 Ga0207684_10629450 Ga0207684_106294502 68
66 3300025916 Ga0207663_10690512 Ga0207663_106905122 68
67 3300025921 Ga0207652_11235163 Ga0207652_112351632 68
68 3300025928 Ga0207700_10091319 Ga0207700_100913193 68
69 3300025929 Ga0207664_10861521 Ga0207664_108615212 68
70 3300025929 Ga0207664_11404417 Ga0207664_114044172 68
71 3300025972 Ga0207668_10009322 Ga0207668_100093225 68
72 3300028379 Ga0268266_10928995 Ga0268266_109289952 68
73 3300028794 Ga0307515_10012651 Ga0307515_1001265110 68
74 3300028794 Ga0307515_10303967 Ga0307515_103039672 68
75 3300030521 Ga0307511_10000070 Ga0307511_100000703 68
76 3300030521 Ga0307511_10000075 Ga0307511_1000007567 68
77 3300030522 Ga0307512_10238831 Ga0307512_102388312 68
78 3300031730 Ga0307516_10601481 Ga0307516_106014811 68
79 3300031731 Ga0307405_10101044 Ga0307405_101010443 68
80 3300031824 Ga0307413_10529699 Ga0307413_105296991 68
81 3300031824 Ga0307413_11349506 Ga0307413_113495061 68
82 3300031852 Ga0307410_10406109 Ga0307410_104061092 68
83 3300031901 Ga0307406_10089007 Ga0307406_100890072 68
84 3300031903 Ga0307407_10220616 Ga0307407_102206162 68
85 3300031995 Ga0307409_100198606 Ga0307409_1001986062 68
86 3300032002 Ga0307416_101463174 Ga0307416_1014631742 68
87 3300032005 Ga0307411_10052540 Ga0307411_100525402 68
88 3300032126 Ga0307415_100099930 Ga0307415_1000999303 68
89 3300035398 Ga0316574_0589725 Ga0316574_0589725_396_617 68
90 3300037068 Ga0373925_0037539 Ga0373925_0037539_1787_1996 68
91 3300037853 Ga0436364_0740641 Ga0436364_0740641_3337_3579 68
92 3300039437 Ga0436365_0092631 Ga0436365_0092631_320_541 68
93 3300041453 Ga0451797_0215786 Ga0451797_0215786_217_426 68
94 3300041494 Ga0451837_0265133 Ga0451837_0265133_213_452 68
95 3300044656 Ga0466969_0003504 Ga0466969_0003504_1843_2052 68
96 3300044656 Ga0466969_0111448 Ga0466969_0111448_112_327 68
97 3300044658 Ga0466972_0085980 Ga0466972_0085980_434_640 68
98 3300044683 Ga0466965_0708460 Ga0466965_0708460_181_396 68
99 3300044684 Ga0466966_0015682 Ga0466966_0015682_2728_2946 68
100 3300044684 Ga0466966_0037968 Ga0466966_0037968_1236_1445 68
101 3300044684 Ga0466966_0038192 Ga0466966_0038192_2673_2885 68
102 3300044684 Ga0466966_0136138 Ga0466966_0136138_1260_1475 68
103 3300044693 Ga0466961_0003773 Ga0466961_0003773_2006_2221 68
104 3300044693 Ga0466961_0032753 Ga0466961_0032753_3098_3316 68
105 3300044693 Ga0466961_0042030 Ga0466961_0042030_1076_1285 68
106 3300044694 Ga0466963_0041300 Ga0466963_0041300_792_1007 68
107 3300044719 Ga0466971_0025618 Ga0466971_0025618_1488_1706 68
108 3300044719 Ga0466971_0085563 Ga0466971_0085563_1113_1322 68
109 3300044719 Ga0466971_0588038 Ga0466971_0588038_50_265 68
110 3300044735 Ga0466968_0001838 Ga0466968_0001838_3538_3753 68
111 3300044735 Ga0466968_0030379 Ga0466968_0030379_152_367 68
112 3300044765 Ga0466970_0005134 Ga0466970_0005134_1065_1274 68
113 3300044765 Ga0466970_0051511 Ga0466970_0051511_103_315 68
114 3300044765 Ga0466970_0085319 Ga0466970_0085319_525_740 68
115 3300044842 Ga0466957_0283686 Ga0466957_0283686_858_1073 68
116 3300044842 Ga0466957_1298677 Ga0466957_1298677_144_350 68
117 3300045049 Ga0466959_0003406 Ga0466959_0003406_8349_8558 68
118 3300045049 Ga0466959_0051088 Ga0466959_0051088_1823_2035 68
119 3300045049 Ga0466959_0133005 Ga0466959_0133005_254_478 68
120 3300045836 Ga0466958_0024140 Ga0466958_0024140_1178_1393 68
121 3300045836 Ga0466958_0197519 Ga0466958_0197519_819_1037 68
122 3300045836 Ga0466958_0344159 Ga0466958_0344159_666_872 68
123 3300045976 Ga0466967_0912189 Ga0466967_0912189_499_714 68
124 3300045976 Ga0466967_1896227 Ga0466967_1896227_82_294 68
125 3300046462 Ga0495651_0000436 Ga0495651_0000436_27548_27760 68
126 3300046476 Ga0495662_0000085 Ga0495662_0000085_6357_6569 68
127 3300046477 Ga0495664_0008436 Ga0495664_0008436_3623_3835 68
128 3300046511 Ga0495608_0476453 Ga0495608_0476453_491_703 68
129 3300046516 Ga0495628_0005990 Ga0495628_0005990_5283_5495 68
130 3300046517 Ga0495630_0000359 Ga0495630_0000359_4978_5190 68
131 3300046526 Ga0495666_0047032 Ga0495666_0047032_1414_1626 68
132 3300046529 Ga0495652_0001093 Ga0495652_0001093_6310_6522 68
133 3300046531 Ga0495665_0543589 Ga0495665_0543589_285_497 68
134 3300046533 Ga0495640_0004806 Ga0495640_0004806_4671_4883 68
135 3300046535 Ga0495586_0653816 Ga0495586_0653816_362_574 68
136 3300046536 Ga0495587_0002944 Ga0495587_0002944_5894_6106 68
137 3300046543 Ga0495645_0010449 Ga0495645_0010449_1101_1313 68
138 3300046559 Ga0495667_0000328 Ga0495667_0000328_26009_26221 68
139 3300046642 Ga0495634_0009701 Ga0495634_0009701_3380_3592 68
140 3300046663 Ga0495635_0000835 Ga0495635_0000835_18558_18770 68
141 3300046675 Ga0495657_0006039 Ga0495657_0006039_6517_6729 68
142 3300046678 Ga0495599_0011238 Ga0495599_0011238_916_1128 68
143 3300046679 Ga0495623_0000301 Ga0495623_0000301_6182_6394 68
144 3300046680 Ga0495646_0000169 Ga0495646_0000169_5142_5354 68
145 3300046689 Ga0495613_0065311 Ga0495613_0065311_169_378 68
146 3300046809 Ga0495600_0000228 Ga0495600_0000228_4609_4821 68
147 3300047317 Ga0495604_0000585 Ga0495604_0000585_4371_4583 68
148 3300047319 Ga0495674_0034282 Ga0495674_0034282_3279_3491 68
149 3300047444 Ga0495675_0000448 Ga0495675_0000448_22799_23011 68
150 3300047471 Ga0495684_0000440 Ga0495684_0000440_6607_6819 68
151 3300048088 Ga0495602_0010456 Ga0495602_0010456_4739_4951 68
152 3300048916 Ga0496113_1404724 Ga0496113_1404724_73_294 68
153 3300050507 nmdc:mga05p37_29490_c1 nmdc:mga05p37_29490_c1_5321_5542 68
154 3300050507 nmdc:mga05p37_529666_c1 nmdc:mga05p37_529666_c1_383_592 68
155 3300050508 nmdc:mga09592_228493_c1 nmdc:mga09592_228493_c1_204_425 68
156 3300050510 nmdc:mga06r32_554676_c1 nmdc:mga06r32_554676_c1_766_975 68
157 3300050511 nmdc:mga08y16_2153369_c1 nmdc:mga08y16_2153369_c1_117_326 68
158 3300050512 nmdc:mga0n895_292010_c1 nmdc:mga0n895_292010_c1_529_738 68
159 3300050513 nmdc:mga0rr50_1019918_c1 nmdc:mga0rr50_1019918_c1_297_506 68
160 3300050515 nmdc:mga0a205_77230_c1 nmdc:mga0a205_77230_c1_395_604 68
161 3300053100 Ga0500660_230097 Ga0500660_230097_101_322 68
162 3300053105 Ga0500557_210736 Ga0500557_210736_293_499 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03621

MbtH

MbtH-like protein

1

51

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gj4-assembly2.cif.gz_C a1 tei: adenylation domain 1 core construct from teicoplanin biosynthesis 0.9832 2 64
5u89-assembly1.cif.gz_B crystal structure of a cross-module fragment from the dimodular nrps dhbf 0.9783 2 63
6eby-assembly2.cif.gz_C crystal structure of the mbth-like protein fsck bound to the interface forming region of fsch adenylation domain from thermobifida fusca 0.9691 3 56
8glc-assembly1.cif.gz_D a1 ancala: adenylation domain 1 core construct from ancestral reconstruction of glycopeptide antibiotic biosynthesis, alanine selection pocket 0.9647 2 63
6ea3-assembly1.cif.gz_A thermobifida fusca fsch adenylation domain complexed with mbth-like protein fsck and ser-amp 0.9534 2 67
ID Description Score Start End Superfamily
af_P9WIP5_1_71_3.90.820.10 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9689 2 67 3.90.820.10
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9523 10 68 3.90.820.10
af_P9WIP5_1_71_3.90.820.10 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9278 2 67 3.90.820.10
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9083 10 68 3.90.820.10
4gr5B01 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9069 1 61 3.90.820.10
ID Description Score Start End GO Terms
AF-A0A1I4Y594-F1-model_v4 MbtH protein 1.007 12 67 GO:0005829
GO:0019290
AF-A0A3R9WW05-F1-model_v4 MbtH family protein 0.9935 2 67 GO:0005829
GO:0019290
AF-A0A7K3AEK5-F1-model_v4 MbtH family NRPS accessory protein 0.9921 2 62 GO:0005829
GO:0019290
AF-A0A7R7DLP4-F1-model_v4 Protein mbtH 0.9874 1 67 GO:0005829
GO:0019290
AF-A0A5C4UXT4-F1-model_v4 MbtH family protein 0.9873 1 67 GO:0005829
GO:0019290

Feature Viewer

pLDDT pTM Quality
94.35 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map