F238662

General Info

Members Datasets Scaffolds Average Seq Length
162 126 162 99

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101476643|Ga0070714_1014766432
Length 103
Sequence MTQAATSVRVVLPGHLKRLAQVEHEVEVQVPDATIAAVLDAVEAAYPVLRGTIRDQQTGKRRNFIRFFACNEDLSHEPPDARLPADVVDGREPLLVVGAMAGG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 3.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 4.94
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10169948 3300003320 Bacteria 1232
2 Ga0058862_12130336 3300004803 Bacteria 550
3 Ga0070658_10809510 3300005327 Bacteria 814
4 Ga0070666_11100209 3300005335 Bacteria 591
5 Ga0070680_100002142 3300005336 Bacteria 14595
6 Ga0070680_100699360 3300005336 Bacteria 872
7 Ga0070680_101197733 3300005336 Unclassified 657
8 Ga0070680_101296865 3300005336 Bacteria 630
9 Ga0070680_101993285 3300005336 Bacteria 503
10 Ga0070660_100868405 3300005339 Bacteria 760
11 Ga0070660_101179206 3300005339 Bacteria 649
12 Ga0070668_100412792 3300005347 Bacteria 1155
13 Ga0070669_100280673 3300005353 Bacteria 1335
14 Ga0070671_101086712 3300005355 Bacteria 702
15 Ga0070714_100683138 3300005435 Bacteria 990
16 Ga0070714_101476643 3300005435 Bacteria 664
17 Ga0070681_10000546 3300005458 Bacteria 31019
18 Ga0070681_10372277 3300005458 Bacteria 1339
19 Ga0070681_10970722 3300005458 Bacteria 769
20 Ga0070706_100844457 3300005467 Bacteria 847
21 Ga0070679_100000514 3300005530 Bacteria 32919
22 Ga0070679_100011946 3300005530 Bacteria 8291
23 Ga0070679_101398194 3300005530 Bacteria 646
24 Ga0070684_100058920 3300005535 Bacteria 3357
25 Ga0070672_100250704 3300005543 Bacteria 1491
26 Ga0070704_100619329 3300005549 Bacteria 953
27 Ga0068855_101029238 3300005563 Bacteria 864
28 Ga0068859_102931251 3300005617 Bacteria 522
29 Ga0068861_100576049 3300005719 Bacteria 1029
30 Ga0068860_101578360 3300005843 Bacteria 678
31 Ga0068860_102501786 3300005843 Unclassified 536
32 Ga0068862_100051300 3300005844 Bacteria 3528
33 Ga0068862_101877327 3300005844 Bacteria 609
34 Ga0075366_10027222 3300006195 Bacteria 3353
35 Ga0068871_101308681 3300006358 Bacteria 682
36 Ga0075428_100361660 3300006844 Bacteria 1557
37 Ga0075431_101327555 3300006847 Bacteria 680
38 Ga0075433_11924667 3300006852 Bacteria 507
39 Ga0068865_100052187 3300006881 Bacteria 2833
40 Ga0068865_100166344 3300006881 Bacteria 1687
41 Ga0068865_100256624 3300006881 Bacteria 1382
42 Ga0097620_102933492 3300006931 Bacteria 522
43 Ga0099794_10003208 3300007265 Bacteria 6201
44 Ga0111539_10027635 3300009094 Bacteria 6930
45 Ga0114129_10795329 3300009147 Bacteria 1207
46 Ga0105243_10960166 3300009148 Bacteria 854
47 Ga0105243_11360719 3300009148 Unclassified 729
48 Ga0105242_10997945 3300009176 Bacteria 845
49 Ga0105248_10697117 3300009177 Bacteria 1146
50 Ga0105248_11159995 3300009177 Bacteria 873
51 Ga0105249_10554164 3300009553 Bacteria 1200
52 Ga0105246_10928075 3300011119 Bacteria 783
53 Ga0105246_12561351 3300011119 Bacteria 503
54 Ga0157373_10273594 3300013100 Bacteria 1196
55 Ga0157369_11185122 3300013105 Bacteria 780
56 Ga0157374_10571609 3300013296 Bacteria 1139
57 Ga0163162_10371402 3300013306 Bacteria 1563
58 Ga0157372_10993158 3300013307 Bacteria 972
59 Ga0157372_11507692 3300013307 Bacteria 774
60 Ga0157372_12916826 3300013307 Bacteria 547
61 Ga0157372_13099948 3300013307 Bacteria 531
62 Ga0157375_11227712 3300013308 Bacteria 880
63 Ga0163163_10337318 3300014325 Bacteria 1562
64 Ga0163163_10364893 3300014325 Bacteria 1501
65 Ga0157380_11261402 3300014326 Bacteria 785
66 Ga0157380_12534258 3300014326 Bacteria 579
67 Ga0157376_10594912 3300014969 Bacteria 1100
68 Ga0206356_11216888 3300020070 Bacteria 818
69 Ga0206354_10476624 3300020081 Bacteria 1831
70 Ga0206353_10927394 3300020082 Bacteria 1802
71 Ga0224712_10039947 3300022467 Bacteria 1762
72 Ga0224712_10359049 3300022467 Bacteria 689
73 Ga0207680_10445839 3300025903 Bacteria 918
74 Ga0207643_10486646 3300025908 Bacteria 788
75 Ga0207705_10255755 3300025909 Bacteria 1336
76 Ga0207684_10526790 3300025910 Bacteria 1012
77 Ga0207707_10000774 3300025912 Bacteria 31479
78 Ga0207707_10929908 3300025912 Bacteria 717
79 Ga0207660_10001846 3300025917 Bacteria 14129
80 Ga0207660_10518276 3300025917 Bacteria 968
81 Ga0207660_11304021 3300025917 Bacteria 590
82 Ga0207657_10307058 3300025919 Bacteria 1256
83 Ga0207652_10000566 3300025921 Bacteria 37275
84 Ga0207652_10013926 3300025921 Bacteria 6510
85 Ga0207652_11736389 3300025921 Bacteria 529
86 Ga0207681_10000016 3300025923 Bacteria 345352
87 Ga0207681_10615399 3300025923 Bacteria 898
88 Ga0207650_10033351 3300025925 Bacteria 3729
89 Ga0207664_10778039 3300025929 Bacteria 861
90 Ga0207664_11530643 3300025929 Bacteria 589
91 Ga0207686_10156994 3300025934 Bacteria 1590
92 Ga0207709_11449877 3300025935 Unclassified 569
93 Ga0207709_11768421 3300025935 Bacteria 514
94 Ga0207669_11423834 3300025937 Bacteria 590
95 Ga0207669_11830042 3300025937 Bacteria 519
96 Ga0207704_10204679 3300025938 Bacteria 1447
97 Ga0207704_10755871 3300025938 Bacteria 809
98 Ga0207691_11558736 3300025940 Bacteria 538
99 Ga0207711_10612025 3300025941 Bacteria 1016
100 Ga0207689_10657772 3300025942 Bacteria 883
101 Ga0207689_11442941 3300025942 Bacteria 576
102 Ga0207661_10768325 3300025944 Bacteria 887
103 Ga0207667_11864243 3300025949 Bacteria 564
104 Ga0207651_10802024 3300025960 Bacteria 835
105 Ga0207668_10148975 3300025972 Bacteria 1809
106 Ga0207639_12176106 3300026041 Bacteria 516
107 Ga0207648_10095093 3300026089 Bacteria 2606
108 Ga0207675_100514615 3300026118 Bacteria 1192
109 Ga0209588_1091821 3300027671 Bacteria 978
110 Ga0268265_10175067 3300028380 Bacteria 1838
111 Ga0268265_11343039 3300028380 Bacteria 716
112 Ga0265338_10317997 3300028800 Bacteria 1127
113 Ga0265331_10010160 3300031250 Bacteria 5223
114 Ga0307413_11916506 3300031824 Bacteria 533
115 Ga0373937_0760604 3300036401 Bacteria 916
116 Ga0373925_0138832 3300037068 Bacteria 1901
117 Ga0395898_0344737 3300037466 Bacteria 1421
118 Ga0395905_0004746 3300037471 Bacteria 14044
119 Ga0436364_0182333 3300037853 Unclassified 900
120 Ga0395901_1117032 3300038443 Bacteria 758
121 Ga0436365_1130467 3300039437 Bacteria 1496
122 Ga0436363_1610647 3300039450 Unclassified 1173
123 Ga0466966_0155429 3300044684 Bacteria 1394
124 Ga0466964_0181172 3300044706 Bacteria 999
125 Ga0466960_0690371 3300044901 Bacteria 612
126 Ga0495582_0003889 3300046473 Bacteria 8403
127 Ga0495608_0107619 3300046511 Bacteria 1794
128 Ga0495665_0143074 3300046531 Bacteria 1249
129 Ga0495586_0069058 3300046535 Bacteria 1928
130 Ga0495634_0101078 3300046642 Bacteria 1863
131 Ga0495635_0598436 3300046663 Unclassified 720
132 Ga0495647_0109022 3300046681 Bacteria 1154
133 Ga0495658_0060516 3300046683 Bacteria 2172
134 Ga0495669_0139093 3300046684 Bacteria 1146
135 Ga0495613_0673256 3300046689 Unclassified 683
136 Ga0495604_0904981 3300047317 Bacteria 551
137 Ga0495680_0459748 3300047322 Bacteria 870
138 Ga0495593_0722288 3300047673 Bacteria 500
139 Ga0496100_1307402 3300048903 Unclassified 572
140 Ga0496102_0383619 3300048905 Bacteria 1322
141 Ga0496104_0048848 3300048907 Bacteria 3990
142 Ga0496108_0496674 3300048911 Bacteria 1066
143 Ga0496109_1433193 3300048912 Unclassified 626
144 Ga0496110_0747249 3300048913 Bacteria 881
145 Ga0496114_0506642 3300048917 Unclassified 1068
146 Ga0496115_0974468 3300048918 Bacteria 650
147 Ga0501038_0527072 3300049574 Bacteria 901
148 Ga0501047_0197579 3300049581 Bacteria 1873
149 Ga0501072_0368855 3300049588 Bacteria 1140
150 Ga0501075_0071943 3300049591 Bacteria 2614
151 Ga0501075_1215095 3300049591 Bacteria 572
152 Ga0501080_0453888 3300049742 Bacteria 1149
153 nmdc:mga0yw44_818693_c1 3300050492 Bacteria 632
154 nmdc:mga0k408_61545_c1 3300050493 Bacteria 2182
155 nmdc:mga06z11_211985_c1 3300050494 Bacteria 1129
156 nmdc:mga07m45_445301_c1 3300050496 Bacteria 751
157 nmdc:mga08y16_1081814_c1 3300050511 Bacteria 778
158 Ga0495595_0421872 3300053084 Bacteria 677
159 Ga0495619_1099923 3300053085 Bacteria 529
160 Ga0501084_1781281 3300054114 Bacteria 514
161 Ga0501082_0541717 3300060353 Bacteria 1018
162 Ga0530510_0090779 3300061734 Bacteria 2228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004803 Ga0058862_12130336 Ga0058862_121303361 85
2 3300005458 Ga0070681_10000546 Ga0070681_1000054624 94
3 3300005530 Ga0070679_100000514 Ga0070679_1000005145 94
4 3300025912 Ga0207707_10000774 Ga0207707_1000077425 94
5 3300025917 Ga0207660_10001846 Ga0207660_100018465 94
6 3300025921 Ga0207652_10000566 Ga0207652_1000056611 94
7 3300049574 Ga0501038_0527072 Ga0501038_0527072_64_351 95
8 3300049581 Ga0501047_0197579 Ga0501047_0197579_684_971 95
9 3300005336 Ga0070680_100002142 Ga0070680_10000214211 97
10 3300005336 Ga0070680_101296865 Ga0070680_1012968652 97
11 3300005339 Ga0070660_100868405 Ga0070660_1008684052 97
12 3300005339 Ga0070660_101179206 Ga0070660_1011792062 97
13 3300005435 Ga0070714_101476643 Ga0070714_1014766432 97
14 3300005458 Ga0070681_10970722 Ga0070681_109707222 97
15 3300005535 Ga0070684_100058920 Ga0070684_1000589203 97
16 3300005563 Ga0068855_101029238 Ga0068855_1010292382 97
17 3300011119 Ga0105246_12561351 Ga0105246_125613512 97
18 3300013100 Ga0157373_10273594 Ga0157373_102735942 97
19 3300013105 Ga0157369_11185122 Ga0157369_111851223 97
20 3300013307 Ga0157372_10993158 Ga0157372_109931582 97
21 3300013307 Ga0157372_12916826 Ga0157372_129168261 97
22 3300013307 Ga0157372_13099948 Ga0157372_130999481 97
23 3300020070 Ga0206356_11216888 Ga0206356_112168882 97
24 3300020081 Ga0206354_10476624 Ga0206354_104766242 97
25 3300022467 Ga0224712_10359049 Ga0224712_103590492 97
26 3300025917 Ga0207660_10518276 Ga0207660_105182762 97
27 3300025919 Ga0207657_10307058 Ga0207657_103070582 97
28 3300025921 Ga0207652_11736389 Ga0207652_117363892 97
29 3300025929 Ga0207664_11530643 Ga0207664_115306432 97
30 3300026041 Ga0207639_12176106 Ga0207639_121761062 97
31 3300005327 Ga0070658_10809510 Ga0070658_108095102 98
32 3300005335 Ga0070666_11100209 Ga0070666_111002092 98
33 3300005336 Ga0070680_100699360 Ga0070680_1006993602 98
34 3300005336 Ga0070680_101197733 Ga0070680_1011977332 98
35 3300005336 Ga0070680_101993285 Ga0070680_1019932852 98
36 3300005347 Ga0070668_100412792 Ga0070668_1004127922 98
37 3300005353 Ga0070669_100280673 Ga0070669_1002806732 98
38 3300005355 Ga0070671_101086712 Ga0070671_1010867122 98
39 3300005435 Ga0070714_100683138 Ga0070714_1006831382 98
40 3300005458 Ga0070681_10372277 Ga0070681_103722772 98
41 3300005467 Ga0070706_100844457 Ga0070706_1008444572 98
42 3300005530 Ga0070679_100011946 Ga0070679_1000119463 98
43 3300005530 Ga0070679_101398194 Ga0070679_1013981941 98
44 3300005543 Ga0070672_100250704 Ga0070672_1002507043 98
45 3300005549 Ga0070704_100619329 Ga0070704_1006193292 98
46 3300005617 Ga0068859_102931251 Ga0068859_1029312512 98
47 3300005719 Ga0068861_100576049 Ga0068861_1005760492 98
48 3300005843 Ga0068860_101578360 Ga0068860_1015783602 98
49 3300005843 Ga0068860_102501786 Ga0068860_1025017862 98
50 3300005844 Ga0068862_100051300 Ga0068862_1000513006 98
51 3300006195 Ga0075366_10027222 Ga0075366_100272223 98
52 3300006358 Ga0068871_101308681 Ga0068871_1013086812 98
53 3300006844 Ga0075428_100361660 Ga0075428_1003616602 98
54 3300006847 Ga0075431_101327555 Ga0075431_1013275552 98
55 3300006852 Ga0075433_11924667 Ga0075433_119246672 98
56 3300006881 Ga0068865_100052187 Ga0068865_1000521874 98
57 3300006881 Ga0068865_100166344 Ga0068865_1001663443 98
58 3300006881 Ga0068865_100256624 Ga0068865_1002566241 98
59 3300006931 Ga0097620_102933492 Ga0097620_1029334922 98
60 3300007265 Ga0099794_10003208 Ga0099794_100032083 98
61 3300009094 Ga0111539_10027635 Ga0111539_100276352 98
62 3300009147 Ga0114129_10795329 Ga0114129_107953292 98
63 3300009148 Ga0105243_11360719 Ga0105243_113607192 98
64 3300009176 Ga0105242_10997945 Ga0105242_109979452 98
65 3300009177 Ga0105248_11159995 Ga0105248_111599952 98
66 3300009553 Ga0105249_10554164 Ga0105249_105541642 98
67 3300011119 Ga0105246_10928075 Ga0105246_109280752 98
68 3300013296 Ga0157374_10571609 Ga0157374_105716092 98
69 3300013306 Ga0163162_10371402 Ga0163162_103714022 98
70 3300013307 Ga0157372_11507692 Ga0157372_115076922 98
71 3300014325 Ga0163163_10337318 Ga0163163_103373182 98
72 3300014325 Ga0163163_10364893 Ga0163163_103648932 98
73 3300014326 Ga0157380_11261402 Ga0157380_112614022 98
74 3300014326 Ga0157380_12534258 Ga0157380_125342582 98
75 3300014969 Ga0157376_10594912 Ga0157376_105949121 98
76 3300020082 Ga0206353_10927394 Ga0206353_109273942 98
77 3300022467 Ga0224712_10039947 Ga0224712_100399472 98
78 3300025903 Ga0207680_10445839 Ga0207680_104458392 98
79 3300025909 Ga0207705_10255755 Ga0207705_102557552 98
80 3300025910 Ga0207684_10526790 Ga0207684_105267902 98
81 3300025912 Ga0207707_10929908 Ga0207707_109299081 98
82 3300025917 Ga0207660_11304021 Ga0207660_113040211 98
83 3300025921 Ga0207652_10013926 Ga0207652_100139264 98
84 3300025923 Ga0207681_10000016 Ga0207681_1000001669 98
85 3300025923 Ga0207681_10615399 Ga0207681_106153992 98
86 3300025929 Ga0207664_10778039 Ga0207664_107780392 98
87 3300025934 Ga0207686_10156994 Ga0207686_101569942 98
88 3300025935 Ga0207709_11449877 Ga0207709_114498772 98
89 3300025937 Ga0207669_11423834 Ga0207669_114238342 98
90 3300025937 Ga0207669_11830042 Ga0207669_118300422 98
91 3300025938 Ga0207704_10204679 Ga0207704_102046792 98
92 3300025938 Ga0207704_10755871 Ga0207704_107558712 98
93 3300025942 Ga0207689_10657772 Ga0207689_106577723 98
94 3300025942 Ga0207689_11442941 Ga0207689_114429411 98
95 3300025944 Ga0207661_10768325 Ga0207661_107683252 98
96 3300025949 Ga0207667_11864243 Ga0207667_118642431 98
97 3300025972 Ga0207668_10148975 Ga0207668_101489752 98
98 3300026089 Ga0207648_10095093 Ga0207648_100950932 98
99 3300026118 Ga0207675_100514615 Ga0207675_1005146153 98
100 3300027671 Ga0209588_1091821 Ga0209588_10918212 98
101 3300028380 Ga0268265_10175067 Ga0268265_101750673 98
102 3300028800 Ga0265338_10317997 Ga0265338_103179972 98
103 3300031250 Ga0265331_10010160 Ga0265331_100101606 98
104 3300031824 Ga0307413_11916506 Ga0307413_119165062 98
105 3300036401 Ga0373937_0760604 Ga0373937_0760604_205_501 98
106 3300037068 Ga0373925_0138832 Ga0373925_0138832_1353_1649 98
107 3300037466 Ga0395898_0344737 Ga0395898_0344737_678_983 98
108 3300037471 Ga0395905_0004746 Ga0395905_0004746_12059_12355 98
109 3300037853 Ga0436364_0182333 Ga0436364_0182333_217_513 98
110 3300038443 Ga0395901_1117032 Ga0395901_1117032_253_558 98
111 3300044684 Ga0466966_0155429 Ga0466966_0155429_805_1107 98
112 3300044706 Ga0466964_0181172 Ga0466964_0181172_91_387 98
113 3300044901 Ga0466960_0690371 Ga0466960_0690371_171_467 98
114 3300046473 Ga0495582_0003889 Ga0495582_0003889_6449_6745 98
115 3300046511 Ga0495608_0107619 Ga0495608_0107619_705_1001 98
116 3300046531 Ga0495665_0143074 Ga0495665_0143074_34_330 98
117 3300046535 Ga0495586_0069058 Ga0495586_0069058_17_313 98
118 3300046642 Ga0495634_0101078 Ga0495634_0101078_1210_1506 98
119 3300046663 Ga0495635_0598436 Ga0495635_0598436_198_494 98
120 3300046681 Ga0495647_0109022 Ga0495647_0109022_440_736 98
121 3300046683 Ga0495658_0060516 Ga0495658_0060516_847_1143 98
122 3300046684 Ga0495669_0139093 Ga0495669_0139093_355_651 98
123 3300046689 Ga0495613_0673256 Ga0495613_0673256_101_397 98
124 3300047317 Ga0495604_0904981 Ga0495604_0904981_188_484 98
125 3300047322 Ga0495680_0459748 Ga0495680_0459748_101_397 98
126 3300047673 Ga0495593_0722288 Ga0495593_0722288_97_393 98
127 3300048903 Ga0496100_1307402 Ga0496100_1307402_266_562 98
128 3300048905 Ga0496102_0383619 Ga0496102_0383619_72_383 98
129 3300048907 Ga0496104_0048848 Ga0496104_0048848_350_646 98
130 3300048911 Ga0496108_0496674 Ga0496108_0496674_669_965 98
131 3300048912 Ga0496109_1433193 Ga0496109_1433193_88_384 98
132 3300048913 Ga0496110_0747249 Ga0496110_0747249_253_549 98
133 3300048917 Ga0496114_0506642 Ga0496114_0506642_349_645 98
134 3300048918 Ga0496115_0974468 Ga0496115_0974468_25_321 98
135 3300049588 Ga0501072_0368855 Ga0501072_0368855_820_1116 98
136 3300049591 Ga0501075_0071943 Ga0501075_0071943_1426_1722 98
137 3300049591 Ga0501075_1215095 Ga0501075_1215095_218_514 98
138 3300049742 Ga0501080_0453888 Ga0501080_0453888_604_900 98
139 3300050492 nmdc:mga0yw44_818693_c1 nmdc:mga0yw44_818693_c1_117_434 98
140 3300050493 nmdc:mga0k408_61545_c1 nmdc:mga0k408_61545_c1_436_741 98
141 3300050494 nmdc:mga06z11_211985_c1 nmdc:mga06z11_211985_c1_204_509 98
142 3300050496 nmdc:mga07m45_445301_c1 nmdc:mga07m45_445301_c1_432_737 98
143 3300050511 nmdc:mga08y16_1081814_c1 nmdc:mga08y16_1081814_c1_32_343 98
144 3300053084 Ga0495595_0421872 Ga0495595_0421872_32_328 98
145 3300053085 Ga0495619_1099923 Ga0495619_1099923_32_328 98
146 3300054114 Ga0501084_1781281 Ga0501084_1781281_153_449 98
147 3300060353 Ga0501082_0541717 Ga0501082_0541717_621_917 98
148 3300061734 Ga0530510_0090779 Ga0530510_0090779_181_477 98
149 3300003320 rootH2_10169948 rootH2_101699482 99
150 3300005844 Ga0068862_101877327 Ga0068862_1018773272 99
151 3300009148 Ga0105243_10960166 Ga0105243_109601662 99
152 3300009177 Ga0105248_10697117 Ga0105248_106971172 99
153 3300013308 Ga0157375_11227712 Ga0157375_112277122 99
154 3300025908 Ga0207643_10486646 Ga0207643_104866462 99
155 3300025925 Ga0207650_10033351 Ga0207650_100333515 99
156 3300025935 Ga0207709_11768421 Ga0207709_117684211 99
157 3300025940 Ga0207691_11558736 Ga0207691_115587361 99
158 3300025941 Ga0207711_10612025 Ga0207711_106120252 99
159 3300025960 Ga0207651_10802024 Ga0207651_108020242 99
160 3300028380 Ga0268265_11343039 Ga0268265_113430391 99
161 3300039437 Ga0436365_1130467 Ga0436365_1130467_197_508 99
162 3300039450 Ga0436363_1610647 Ga0436363_1610647_266_577 99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8684 3 98
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.8579 3 44
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8409 3 93
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8338 3 98
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8313 1 98
ID Description Score Start End Superfamily
1vjkA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8579 3 44 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8375 1 98 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8313 1 98 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8288 1 98 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8232 1 98 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9927 1 94
AF-A0A7V9SE48-F1-model_v4 MoaD/ThiS family protein 0.9915 2 98
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9915 1 46
AF-A0A7V9KHS6-F1-model_v4 MoaD/ThiS family protein 0.9911 28 98
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9901 1 85

Feature Viewer

pLDDT pTM Quality
92.59 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map