F230445

General Info

Members Datasets Scaffolds Average Seq Length
158 115 158 262

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0000280|Ga0495630_0000280_12520_13395
Length 291
Sequence MNTPAAPRQAPLERRLIFAMGGGGFTMEPANPLLDDFVLSLAPPRASAATREPRILFLPTASGDTTAQIAAFHARFADRHCVAEHLSLFRLHELRRPLGEIVLSQDVLYVGGGSMRNLLAIWRTHDLDRLLICAWRRGIVLAGISAGAMCWFEGGITRSSGRPEPLSGLGLLPGSLTVHADGEPERLPVWLAAIREGVLPGGWSLDDGVGLLFAGTRLRRIVSSRPGASAQRVDQVAGELVRNRLAPELLGERGAPRLHSPLDDDVQELRRVQRLRRAVSGPRGGRLGGHW

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 18.99
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100168683 3300005329 Bacteria 2077
2 Ga0068868_100284348 3300005338 Bacteria 1401
3 Ga0070660_100021821 3300005339 Bacteria 4727
4 Ga0070692_10092022 3300005345 Bacteria 1650
5 Ga0070669_100023689 3300005353 Bacteria 4398
6 Ga0070673_100400174 3300005364 Bacteria 1228
7 Ga0070659_100000002 3300005366 Bacteria 369239
8 Ga0070667_100591409 3300005367 Bacteria 1022
9 Ga0070714_100000019 3300005435 Bacteria 169455
10 Ga0070714_100003420 3300005435 Bacteria 11825
11 Ga0070714_100030746 3300005435 Bacteria 4473
12 Ga0070714_100202582 3300005435 Bacteria 1816
13 Ga0070710_10000006 3300005437 Bacteria 217422
14 Ga0070711_100095850 3300005439 Bacteria 2148
15 Ga0070711_100251406 3300005439 Bacteria 1387
16 Ga0070705_100000619 3300005440 Bacteria 20518
17 Ga0070700_100011214 3300005441 Bacteria 4962
18 Ga0068867_100493695 3300005459 Bacteria 1051
19 Ga0070707_100298009 3300005468 Bacteria 1567
20 Ga0070684_100097147 3300005535 Bacteria 2626
21 Ga0070672_100203669 3300005543 Bacteria 1655
22 Ga0070665_100005506 3300005548 Bacteria 13035
23 Ga0070664_100052963 3300005564 Bacteria 3439
24 Ga0068856_100176970 3300005614 Bacteria 2146
25 Ga0068861_100786993 3300005719 Bacteria 891
26 Ga0081455_10034585 3300005937 Bacteria 4526
27 Ga0081539_10003961 3300005985 Bacteria 17144
28 Ga0081539_10009349 3300005985 Bacteria 8222
29 Ga0070717_10000005 3300006028 Bacteria 357819
30 Ga0070715_10073029 3300006163 Bacteria 1537
31 Ga0070712_100000007 3300006175 Bacteria 157653
32 Ga0105240_10003866 3300009093 Bacteria 23134
33 Ga0105245_10122805 3300009098 Bacteria 2427
34 Ga0105243_10261186 3300009148 Bacteria 1550
35 Ga0105239_10033106 3300010375 Bacteria 5677
36 Ga0157369_10607119 3300013105 Bacteria 1129
37 Ga0163162_10679173 3300013306 Bacteria 1152
38 Ga0157375_10473258 3300013308 Bacteria 1418
39 Ga0163163_10561298 3300014325 Bacteria 1204
40 Ga0157380_10011638 3300014326 Bacteria 6360
41 Ga0157379_10005485 3300014968 Bacteria 10887
42 Ga0157379_10257426 3300014968 Bacteria 1585
43 Ga0163161_10515257 3300017792 Bacteria 976
44 Ga0207692_10000001 3300025898 Bacteria 558345
45 Ga0207642_10284634 3300025899 Bacteria 952
46 Ga0207688_10093980 3300025901 Bacteria 1725
47 Ga0207693_10000001 3300025915 Bacteria 469535
48 Ga0207693_10162422 3300025915 Bacteria 1758
49 Ga0207663_10005122 3300025916 Bacteria 6589
50 Ga0207663_10171476 3300025916 Bacteria 1541
51 Ga0207657_10044648 3300025919 Bacteria 3894
52 Ga0207652_10409240 3300025921 Bacteria 1224
53 Ga0207646_10226708 3300025922 Bacteria 1688
54 Ga0207681_10018190 3300025923 Bacteria 4425
55 Ga0207664_10000008 3300025929 Bacteria 309301
56 Ga0207664_10000529 3300025929 Bacteria 27133
57 Ga0207664_10012473 3300025929 Bacteria 6078
58 Ga0207664_10266376 3300025929 Bacteria 1500
59 Ga0207664_10440624 3300025929 Unclassified 1162
60 Ga0207664_10507076 3300025929 Bacteria 1081
61 Ga0207690_10000088 3300025932 Bacteria 76762
62 Ga0207669_10271177 3300025937 Bacteria 1275
63 Ga0207665_10107391 3300025939 Bacteria 1957
64 Ga0207691_10060989 3300025940 Bacteria 3426
65 Ga0207679_10036076 3300025945 Bacteria 3504
66 Ga0207708_10104488 3300026075 Bacteria 2195
67 Ga0207702_10137163 3300026078 Bacteria 2209
68 Ga0207648_10097874 3300026089 Bacteria 2568
69 Ga0207675_100065752 3300026118 Bacteria 3389
70 Ga0268266_10124812 3300028379 Bacteria 2295
71 Ga0268266_10197221 3300028379 Bacteria 1841
72 Ga0265326_10000003 3300028558 Bacteria 479811
73 Ga0265334_10000217 3300028573 Bacteria 33112
74 Ga0265336_10006018 3300028666 Bacteria 4415
75 Ga0265338_10000844 3300028800 Bacteria 51666
76 Ga0265338_10012459 3300028800 Bacteria 9693
77 Ga0265324_10001900 3300029957 Bacteria 11228
78 Ga0265327_10003020 3300031251 Bacteria 16677
79 Ga0265327_10040653 3300031251 Bacteria 2513
80 Ga0265327_10170068 3300031251 Bacteria 1002
81 Ga0307410_10420311 3300031852 Bacteria 1084
82 Ga0307409_100131851 3300031995 Bacteria 2137
83 Ga0307409_100147309 3300031995 Bacteria 2038
84 Ga0373935_0143470 3300035692 Bacteria 1615
85 Ga0373947_0054495 3300035725 Bacteria 2413
86 Ga0373947_0315387 3300035725 Bacteria 1045
87 Ga0395899_0117375 3300037312 Bacteria 1909
88 Ga0395900_0073801 3300037418 Bacteria 3508
89 Ga0395900_0510717 3300037418 Bacteria 1151
90 Ga0395898_0094140 3300037466 Bacteria 2879
91 Ga0395898_0285116 3300037466 Bacteria 1575
92 Ga0395905_0058819 3300037471 Bacteria 3594
93 Ga0395901_0022413 3300038443 Bacteria 6472
94 Ga0395901_0065216 3300038443 Bacteria 3791
95 Ga0395901_0100443 3300038443 Bacteria 3035
96 Ga0395901_0193665 3300038443 Bacteria 2132
97 Ga0439463_032210 3300042016 Bacteria 1324
98 Ga0450902_028760 3300042137 Bacteria 933
99 Ga0466960_0000064 3300044901 Bacteria 35453
100 Ga0466958_0231365 3300045836 Bacteria 1180
101 Ga0466967_0240250 3300045976 Bacteria 1728
102 Ga0495592_0432261 3300046454 Unclassified 828
103 Ga0495653_0000582 3300046463 Bacteria 28064
104 Ga0495653_0302970 3300046463 Bacteria 1042
105 Ga0495650_0000053 3300046471 Bacteria 316684
106 Ga0495582_0119872 3300046473 Bacteria 1482
107 Ga0495664_0000032 3300046477 Bacteria 85909
108 Ga0495618_0000137 3300046514 Bacteria 52421
109 Ga0495630_0000280 3300046517 Bacteria 41276
110 Ga0495652_0118726 3300046529 Bacteria 2113
111 Ga0495645_0000022 3300046543 Bacteria 137019
112 Ga0495645_0000561 3300046543 Bacteria 25512
113 Ga0495657_0000041 3300046675 Bacteria 115251
114 Ga0495604_0000158 3300047317 Bacteria 59386
115 Ga0495672_0028736 3300047320 Bacteria 3512
116 Ga0495672_0030883 3300047320 Bacteria 3352
117 Ga0495676_0028581 3300047321 Bacteria 4759
118 Ga0496100_0010425 3300048903 Bacteria 5259
119 Ga0496100_0011865 3300048903 Bacteria 4974
120 Ga0496101_0031065 3300048904 Bacteria 3752
121 Ga0496101_0111120 3300048904 Bacteria 2063
122 Ga0496102_0000002 3300048905 Bacteria 814588
123 Ga0496102_0326633 3300048905 Bacteria 1445
124 Ga0496102_0422782 3300048905 Bacteria 1252
125 Ga0496103_0000218 3300048906 Bacteria 56596
126 Ga0496103_0235432 3300048906 Bacteria 1178
127 Ga0496104_0000006 3300048907 Bacteria 536446
128 Ga0496105_0005573 3300048908 Bacteria 9561
129 Ga0496106_0001792 3300048909 Bacteria 16049
130 Ga0496108_0009387 3300048911 Bacteria 7921
131 Ga0496108_0066125 3300048911 Bacteria 3048
132 Ga0496108_0527930 3300048911 Bacteria 1030
133 Ga0496109_0047081 3300048912 Bacteria 3919
134 Ga0496109_0305302 3300048912 Bacteria 1501
135 Ga0496110_0000156 3300048913 Bacteria 41321
136 Ga0496110_0016965 3300048913 Bacteria 6087
137 Ga0496111_0000196 3300048914 Bacteria 28066
138 Ga0496111_0046676 3300048914 Bacteria 3119
139 Ga0496111_0073969 3300048914 Bacteria 2481
140 Ga0496112_0000223 3300048915 Bacteria 36875
141 Ga0496112_0009702 3300048915 Bacteria 8691
142 Ga0496112_0031653 3300048915 Bacteria 5132
143 Ga0496112_0040461 3300048915 Bacteria 4557
144 Ga0496112_0468301 3300048915 Bacteria 1197
145 Ga0496113_0021542 3300048916 Bacteria 4548
146 Ga0496115_0000053 3300048918 Bacteria 106425
147 Ga0496115_0003897 3300048918 Bacteria 10750
148 Ga0496124_0071589 3300048927 Bacteria 2873
149 Ga0501034_0009909 3300049571 Bacteria 9956
150 Ga0501068_0302898 3300049584 Bacteria 1023
151 Ga0501080_0105752 3300049742 Bacteria 2609
152 nmdc:mga09592_477530_c1 3300050508 Bacteria 1074
153 nmdc:mga08y16_142089_c1 3300050511 Bacteria 2495
154 nmdc:mga0a205_304390_c1 3300050515 Bacteria 1466
155 Ga0495601_0023757 3300053077 Bacteria 3769
156 Ga0495612_0000117 3300053078 Bacteria 33431
157 Ga0495619_0158195 3300053085 Bacteria 1564
158 Ga0500572_070045 3300053111 Bacteria 1082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0040461 Ga0496112_0040461_1156_1929 228
2 3300028558 Ga0265326_10000003 Ga0265326_1000000359 231
3 3300028573 Ga0265334_10000217 Ga0265334_1000021729 231
4 3300028666 Ga0265336_10006018 Ga0265336_100060185 231
5 3300028800 Ga0265338_10000844 Ga0265338_1000084414 231
6 3300029957 Ga0265324_10001900 Ga0265324_100019009 231
7 3300009098 Ga0105245_10122805 Ga0105245_101228053 233
8 3300005468 Ga0070707_100298009 Ga0070707_1002980092 236
9 3300009148 Ga0105243_10261186 Ga0105243_102611862 238
10 3300026075 Ga0207708_10104488 Ga0207708_101044882 238
11 3300005364 Ga0070673_100400174 Ga0070673_1004001742 239
12 3300048904 Ga0496101_0031065 Ga0496101_0031065_2373_3161 241
13 3300048914 Ga0496111_0046676 Ga0496111_0046676_124_912 241
14 3300005937 Ga0081455_10034585 Ga0081455_100345854 242
15 3300038443 Ga0395901_0193665 Ga0395901_0193665_1018_1779 243
16 3300005614 Ga0068856_100176970 Ga0068856_1001769702 244
17 3300006163 Ga0070715_10073029 Ga0070715_100730292 244
18 3300025929 Ga0207664_10507076 Ga0207664_105070761 244
19 3300026078 Ga0207702_10137163 Ga0207702_101371632 244
20 3300046454 Ga0495592_0432261 Ga0495592_0432261_28_795 244
21 3300046477 Ga0495664_0000032 Ga0495664_0000032_47312_48079 244
22 3300046529 Ga0495652_0118726 Ga0495652_0118726_1258_2025 244
23 3300048905 Ga0496102_0000002 Ga0496102_0000002_199043_199813 244
24 3300048906 Ga0496103_0000218 Ga0496103_0000218_48982_49752 244
25 3300005535 Ga0070684_100097147 Ga0070684_1000971471 245
26 3300006028 Ga0070717_10000005 Ga0070717_10000005166 245
27 3300005338 Ga0068868_100284348 Ga0068868_1002843482 247
28 3300005367 Ga0070667_100591409 Ga0070667_1005914092 247
29 3300005548 Ga0070665_100005506 Ga0070665_10000550611 247
30 3300014968 Ga0157379_10257426 Ga0157379_102574262 247
31 3300025901 Ga0207688_10093980 Ga0207688_100939802 247
32 3300028379 Ga0268266_10124812 Ga0268266_101248122 247
33 3300037418 Ga0395900_0510717 Ga0395900_0510717_42_830 247
34 3300037466 Ga0395898_0285116 Ga0395898_0285116_667_1455 247
35 3300038443 Ga0395901_0065216 Ga0395901_0065216_1765_2553 247
36 3300048908 Ga0496105_0005573 Ga0496105_0005573_651_1439 247
37 3300048911 Ga0496108_0066125 Ga0496108_0066125_1100_1888 247
38 3300048912 Ga0496109_0305302 Ga0496109_0305302_410_1198 247
39 3300048913 Ga0496110_0016965 Ga0496110_0016965_3525_4313 247
40 3300048915 Ga0496112_0009702 Ga0496112_0009702_1648_2436 247
41 3300048915 Ga0496112_0031653 Ga0496112_0031653_1155_1943 247
42 3300048915 Ga0496112_0468301 Ga0496112_0468301_275_1063 247
43 3300005459 Ga0068867_100493695 Ga0068867_1004936951 248
44 3300005985 Ga0081539_10009349 Ga0081539_100093499 248
45 3300013105 Ga0157369_10607119 Ga0157369_106071191 248
46 3300013306 Ga0163162_10679173 Ga0163162_106791732 248
47 3300025921 Ga0207652_10409240 Ga0207652_104092402 248
48 3300031995 Ga0307409_100147309 Ga0307409_1001473092 248
49 3300035692 Ga0373935_0143470 Ga0373935_0143470_292_1059 248
50 3300035725 Ga0373947_0054495 Ga0373947_0054495_1013_1780 248
51 3300046473 Ga0495582_0119872 Ga0495582_0119872_409_1176 248
52 3300048903 Ga0496100_0010425 Ga0496100_0010425_3608_4375 248
53 3300048903 Ga0496100_0011865 Ga0496100_0011865_257_1006 248
54 3300048904 Ga0496101_0111120 Ga0496101_0111120_1217_1984 248
55 3300048905 Ga0496102_0326633 Ga0496102_0326633_363_1112 248
56 3300048905 Ga0496102_0422782 Ga0496102_0422782_256_1023 248
57 3300048906 Ga0496103_0235432 Ga0496103_0235432_177_926 248
58 3300048909 Ga0496106_0001792 Ga0496106_0001792_5731_6480 248
59 3300048911 Ga0496108_0527930 Ga0496108_0527930_119_886 248
60 3300048912 Ga0496109_0047081 Ga0496109_0047081_872_1639 248
61 3300048914 Ga0496111_0073969 Ga0496111_0073969_243_1010 248
62 3300048918 Ga0496115_0003897 Ga0496115_0003897_515_1264 248
63 3300050515 nmdc:mga0a205_304390_c1 nmdc:mga0a205_304390_c1_38_787 248
64 3300038443 Ga0395901_0100443 Ga0395901_0100443_1457_2230 249
65 3300053111 Ga0500572_070045 Ga0500572_070045_212_961 249
66 3300005339 Ga0070660_100021821 Ga0070660_1000218212 250
67 3300005345 Ga0070692_10092022 Ga0070692_100920222 250
68 3300005353 Ga0070669_100023689 Ga0070669_1000236894 250
69 3300005366 Ga0070659_100000002 Ga0070659_100000002336 250
70 3300005435 Ga0070714_100000019 Ga0070714_10000001961 250
71 3300005435 Ga0070714_100003420 Ga0070714_1000034207 250
72 3300005435 Ga0070714_100030746 Ga0070714_1000307461 250
73 3300005437 Ga0070710_10000006 Ga0070710_10000006102 250
74 3300005440 Ga0070705_100000619 Ga0070705_10000061915 250
75 3300006175 Ga0070712_100000007 Ga0070712_100000007153 250
76 3300010375 Ga0105239_10033106 Ga0105239_100331062 250
77 3300013308 Ga0157375_10473258 Ga0157375_104732582 250
78 3300014325 Ga0163163_10561298 Ga0163163_105612982 250
79 3300014968 Ga0157379_10005485 Ga0157379_100054858 250
80 3300025898 Ga0207692_10000001 Ga0207692_10000001129 250
81 3300025915 Ga0207693_10000001 Ga0207693_10000001283 250
82 3300025915 Ga0207693_10162422 Ga0207693_101624221 250
83 3300025919 Ga0207657_10044648 Ga0207657_100446485 250
84 3300025923 Ga0207681_10018190 Ga0207681_100181904 250
85 3300025929 Ga0207664_10000008 Ga0207664_10000008273 250
86 3300025929 Ga0207664_10000529 Ga0207664_100005297 250
87 3300025929 Ga0207664_10012473 Ga0207664_100124733 250
88 3300025932 Ga0207690_10000088 Ga0207690_1000008833 250
89 3300028379 Ga0268266_10197221 Ga0268266_101972212 250
90 3300031251 Ga0265327_10170068 Ga0265327_101700681 250
91 3300037312 Ga0395899_0117375 Ga0395899_0117375_440_1234 250
92 3300037418 Ga0395900_0073801 Ga0395900_0073801_535_1329 250
93 3300037466 Ga0395898_0094140 Ga0395898_0094140_320_1111 250
94 3300037471 Ga0395905_0058819 Ga0395905_0058819_1410_2204 250
95 3300038443 Ga0395901_0022413 Ga0395901_0022413_418_1212 250
96 3300044901 Ga0466960_0000064 Ga0466960_0000064_23999_24793 250
97 3300045976 Ga0466967_0240250 Ga0466967_0240250_892_1677 250
98 3300046471 Ga0495650_0000053 Ga0495650_0000053_281729_282523 250
99 3300047320 Ga0495672_0030883 Ga0495672_0030883_1720_2484 250
100 3300048911 Ga0496108_0009387 Ga0496108_0009387_3509_4294 250
101 3300048915 Ga0496112_0000223 Ga0496112_0000223_17871_18632 250
102 3300048916 Ga0496113_0021542 Ga0496113_0021542_3604_4407 250
103 3300048927 Ga0496124_0071589 Ga0496124_0071589_294_1088 250
104 3300049571 Ga0501034_0009909 Ga0501034_0009909_1613_2407 250
105 3300049584 Ga0501068_0302898 Ga0501068_0302898_119_871 250
106 3300005329 Ga0070683_100168683 Ga0070683_1001686832 251
107 3300005435 Ga0070714_100202582 Ga0070714_1002025822 251
108 3300005439 Ga0070711_100095850 Ga0070711_1000958502 251
109 3300005439 Ga0070711_100251406 Ga0070711_1002514062 251
110 3300005441 Ga0070700_100011214 Ga0070700_1000112142 251
111 3300005543 Ga0070672_100203669 Ga0070672_1002036692 251
112 3300005564 Ga0070664_100052963 Ga0070664_1000529632 251
113 3300005719 Ga0068861_100786993 Ga0068861_1007869932 251
114 3300005985 Ga0081539_10003961 Ga0081539_1000396110 251
115 3300009093 Ga0105240_10003866 Ga0105240_100038663 251
116 3300014326 Ga0157380_10011638 Ga0157380_100116383 251
117 3300017792 Ga0163161_10515257 Ga0163161_105152571 251
118 3300025899 Ga0207642_10284634 Ga0207642_102846341 251
119 3300025916 Ga0207663_10005122 Ga0207663_100051225 251
120 3300025916 Ga0207663_10171476 Ga0207663_101714762 251
121 3300025922 Ga0207646_10226708 Ga0207646_102267082 251
122 3300025929 Ga0207664_10266376 Ga0207664_102663761 251
123 3300025929 Ga0207664_10440624 Ga0207664_104406242 251
124 3300025937 Ga0207669_10271177 Ga0207669_102711772 251
125 3300025939 Ga0207665_10107391 Ga0207665_101073913 251
126 3300025940 Ga0207691_10060989 Ga0207691_100609893 251
127 3300025945 Ga0207679_10036076 Ga0207679_100360763 251
128 3300026089 Ga0207648_10097874 Ga0207648_100978741 251
129 3300026118 Ga0207675_100065752 Ga0207675_1000657525 251
130 3300028800 Ga0265338_10012459 Ga0265338_100124598 251
131 3300031251 Ga0265327_10003020 Ga0265327_100030209 251
132 3300031251 Ga0265327_10040653 Ga0265327_100406533 251
133 3300031852 Ga0307410_10420311 Ga0307410_104203111 251
134 3300031995 Ga0307409_100131851 Ga0307409_1001318513 251
135 3300035725 Ga0373947_0315387 Ga0373947_0315387_91_921 251
136 3300042016 Ga0439463_032210 Ga0439463_032210_504_1289 251
137 3300042137 Ga0450902_028760 Ga0450902_028760_126_911 251
138 3300045836 Ga0466958_0231365 Ga0466958_0231365_168_1007 251
139 3300046463 Ga0495653_0000582 Ga0495653_0000582_7269_8150 251
140 3300046463 Ga0495653_0302970 Ga0495653_0302970_226_1002 251
141 3300046514 Ga0495618_0000137 Ga0495618_0000137_32031_32903 251
142 3300046517 Ga0495630_0000280 Ga0495630_0000280_12520_13395 251
143 3300046543 Ga0495645_0000022 Ga0495645_0000022_125390_126250 251
144 3300046543 Ga0495645_0000561 Ga0495645_0000561_18758_19573 251
145 3300046675 Ga0495657_0000041 Ga0495657_0000041_61554_62429 251
146 3300047317 Ga0495604_0000158 Ga0495604_0000158_56359_57165 251
147 3300047320 Ga0495672_0028736 Ga0495672_0028736_1765_2574 251
148 3300047321 Ga0495676_0028581 Ga0495676_0028581_3260_4093 251
149 3300048907 Ga0496104_0000006 Ga0496104_0000006_286453_287289 251
150 3300048913 Ga0496110_0000156 Ga0496110_0000156_32149_32985 251
151 3300048914 Ga0496111_0000196 Ga0496111_0000196_6622_7458 251
152 3300048918 Ga0496115_0000053 Ga0496115_0000053_90100_90927 251
153 3300049742 Ga0501080_0105752 Ga0501080_0105752_1480_2256 251
154 3300050508 nmdc:mga09592_477530_c1 nmdc:mga09592_477530_c1_133_894 251
155 3300050511 nmdc:mga08y16_142089_c1 nmdc:mga08y16_142089_c1_890_1648 251
156 3300053077 Ga0495601_0023757 Ga0495601_0023757_2711_3535 251
157 3300053078 Ga0495612_0000117 Ga0495612_0000117_12160_12987 251
158 3300053085 Ga0495619_0158195 Ga0495619_0158195_415_1203 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

17

221

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqw-assembly1.cif.gz_A pcc6803 cyanophycinase s132dap covalently bound to cyanophycin dimer 0.8018 1 223
3en0-assembly1.cif.gz_B the structure of cyanophycinase 0.7864 1 223
7c9b-assembly1.cif.gz_A-2 crystal structure of dipeptidase-e from xenopus laevis 0.7855 3 226
3en0-assembly2.cif.gz_C-2 the structure of cyanophycinase 0.7853 1 223
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.769 1 223
ID Description Score Start End Superfamily
af_Q4DS63_13_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8585 18 218 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7775 15 222 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7715 1 223 3.40.50.880
1fyeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.749 15 225 3.40.50.880
af_I1M0Q0_10_171_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7228 28 118 3.40.50.10140
ID Description Score Start End GO Terms
AF-A0A7W1K9F6-F1-model_v4 Peptidase E 0.9862 1 205 GO:0006508
GO:0008236
AF-A0A7V8ZIA9-F1-model_v4 Peptidase E 0.9822 1 225 GO:0006508
GO:0008236
AF-A0A1G6UJI3-F1-model_v4 Peptidase family S51 0.9772 78 226 GO:0006508
GO:0008236
AF-A0A542GVW8-F1-model_v4 deleted 0.973 1 226
AF-A0A2W5MGH5-F1-model_v4 deleted 0.9709 92 225

Feature Viewer

pLDDT pTM Quality
88.71 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map