F155677

General Info

Members Datasets Scaffolds Average Seq Length
133 111 131 192

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100776582|Ga0068855_1007765821
Length 213
Sequence MTLKGYLADATAVLELVGSAVAQEVVDAAIDTITGALPGKPLLVCGNGGSAADAMHITGELVGRFLRDRLALRVICLSDNPVVLTAWSNDFSFDTVFSRQVEAYGEPGAVLLGISTSGNSKNVIAAFQQARKLGMKTIALTGGGGALGALADYSIAIPSNSTPLIQQAHLCVYHYLCQKIEERMIERLSCNTRSKQLQEQVPDGLAAPHITNA

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 0
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10455452 3300005328 Unclassified 900
2 Ga0070675_100309969 3300005354 Bacteria 1392
3 Ga0070673_100268249 3300005364 Unclassified 1493
4 Ga0070688_100070202 3300005365 Bacteria 2239
5 Ga0070700_100769216 3300005441 Bacteria 772
6 Ga0070708_100117191 3300005445 Bacteria 2453
7 Ga0068867_100127551 3300005459 Unclassified 1973
8 Ga0070679_100461864 3300005530 Bacteria 1214
9 Ga0070695_100637524 3300005545 Unclassified 840
10 Ga0068855_100776582 3300005563 Bacteria 1020
11 Ga0068857_100136930 3300005577 Unclassified 2211
12 Ga0068854_100034233 3300005578 Bacteria 3547
13 Ga0068856_100013257 3300005614 Bacteria 7983
14 Ga0068856_100545023 3300005614 Unclassified 1181
15 Ga0068859_100609217 3300005617 Unclassified 1185
16 Ga0068859_101157642 3300005617 Bacteria 851
17 Ga0068864_100376687 3300005618 Bacteria 1344
18 Ga0068860_100562622 3300005843 Bacteria 1143
19 Ga0081540_1012630 3300005983 Bacteria 5542
20 Ga0070717_10285037 3300006028 Bacteria 1466
21 Ga0070712_100050166 3300006175 Plasmid 2902
22 Ga0097621_100229392 3300006237 Bacteria 1621
23 Ga0068865_100334332 3300006881 Unclassified 1222
24 Ga0075436_100144388 3300006914 Bacteria 1673
25 Ga0097620_100609146 3300006931 Unclassified 1185
26 Ga0105240_10001084 3300009093 Bacteria 48040
27 Ga0105240_10056897 3300009093 Bacteria 4891
28 Ga0105245_10022221 3300009098 Bacteria 5568
29 Ga0105242_10487548 3300009176 Bacteria 1169
30 Ga0105237_10051896 3300009545 Bacteria 4119
31 Ga0105238_10868391 3300009551 Bacteria 920
32 Ga0105239_11201682 3300010375 Bacteria 874
33 Ga0157373_10136066 3300013100 Unclassified 1727
34 Ga0157370_10036389 3300013104 Bacteria 4776
35 Ga0157369_10001780 3300013105 Bacteria 26094
36 Ga0157378_11366968 3300013297 Unclassified 750
37 Ga0163162_10010827 3300013306 Bacteria 8875
38 Ga0163163_10403191 3300014325 Bacteria 1426
39 Ga0163163_11173581 3300014325 Unclassified 830
40 Ga0157379_10830757 3300014968 Unclassified 873
41 Ga0213875_10025920 3300021388 Bacteria 2790
42 Ga0209233_1004979 3300025261 Unclassified 4465
43 Ga0209675_1003042 3300025291 Bacteria 8228
44 Ga0207695_10003290 3300025913 Bacteria 22952
45 Ga0207695_10178851 3300025913 Bacteria 2043
46 Ga0207671_10086862 3300025914 Bacteria 2351
47 Ga0207693_10080711 3300025915 Unclassified 2546
48 Ga0207663_11047112 3300025916 Bacteria 655
49 Ga0207652_10304401 3300025921 Bacteria 1439
50 Ga0207694_10767683 3300025924 Bacteria 814
51 Ga0207659_10205937 3300025926 Bacteria 1574
52 Ga0207687_10082152 3300025927 Unclassified 2330
53 Ga0207651_10193877 3300025960 Bacteria 1623
54 Ga0207640_10278398 3300025981 Unclassified 1313
55 Ga0207658_10064691 3300025986 Bacteria 2744
56 Ga0207702_10026095 3300026078 Bacteria 4851
57 Ga0207702_10447780 3300026078 Unclassified 1252
58 Ga0207648_10160607 3300026089 Unclassified 1985
59 Ga0268264_10310221 3300028381 Bacteria 1488
60 Ga0265323_10000599 3300028653 Bacteria 19860
61 Ga0265324_10003153 3300029957 Bacteria 8001
62 Ga0265330_10075262 3300031235 Bacteria 1458
63 Ga0265325_10066427 3300031241 Bacteria 1818
64 Ga0265329_10041877 3300031242 Unclassified 1468
65 Ga0265340_10116403 3300031247 Bacteria 1232
66 Ga0265339_10046296 3300031249 Bacteria 2392
67 Ga0265327_10001956 3300031251 Bacteria 23626
68 Ga0265327_10194336 3300031251 Bacteria 922
69 Ga0265316_10006460 3300031344 Bacteria 11195
70 Ga0265316_10010268 3300031344 Bacteria 8543
71 Ga0265316_10017638 3300031344 Bacteria 6159
72 Ga0265316_10163118 3300031344 Bacteria 1665
73 Ga0307408_100460690 3300031548 Bacteria 1105
74 Ga0265314_10015737 3300031711 Bacteria 5992
75 Ga0265342_10150180 3300031712 Bacteria 1294
76 Ga0307405_10037855 3300031731 Bacteria 2903
77 Ga0307412_10105115 3300031911 Bacteria 2005
78 Ga0307414_11242575 3300032004 Bacteria 690
79 Ga0307415_100672512 3300032126 Bacteria 931
80 Ga0373935_0081773 3300035692 Bacteria 2101
81 Ga0373927_0096077 3300035695 Bacteria 1926
82 Ga0373927_0304687 3300035695 Unclassified 1049
83 Ga0373947_0441909 3300035725 Unclassified 880
84 Ga0373925_0118355 3300037068 Bacteria 2054
85 Ga0395900_0002926 3300037418 Bacteria 18600
86 Ga0436364_0270440 3300037853 Bacteria 6117
87 Ga0436364_0304215 3300037853 Bacteria 4299
88 Ga0436364_0571307 3300037853 Unclassified 804
89 Ga0400483_034557 3300039062 Bacteria 12228
90 Ga0400483_139418 3300039062 Bacteria 3243
91 Ga0400483_157394 3300039062 Bacteria 10871
92 Ga0436365_0574663 3300039437 Unclassified 1836
93 Ga0453684_0663667 3300044712 Bacteria 1137
94 Ga0451576_0152121 3300045051 Unclassified 2413
95 Ga0495592_0207183 3300046454 Bacteria 1319
96 Ga0495580_0343901 3300046472 Bacteria 1011
97 Ga0495665_0426152 3300046531 Bacteria 672
98 Ga0495667_0402381 3300046559 Unclassified 862
99 Ga0495661_0248953 3300046665 Unclassified 908
100 Ga0496122_0001566 3300048925 Bacteria 36102
101 Ga0501031_0004025 3300049568 Bacteria 9486
102 Ga0501032_0000119 3300049569 Bacteria 65020
103 Ga0501033_0000532 3300049570 Bacteria 35604
104 Ga0501034_0001333 3300049571 Bacteria 33330
105 Ga0501034_0587093 3300049571 Bacteria 1021
106 Ga0501036_0000614 3300049572 Bacteria 25905
107 Ga0501037_0000288 3300049573 Bacteria 42724
108 Ga0501038_0000046 3300049574 Bacteria 106465
109 Ga0501039_0000003 3300049575 Bacteria 357424
110 Ga0501042_0394722 3300049578 Bacteria 1002
111 Ga0501043_0000051 3300049579 Bacteria 106957
112 Ga0501046_0094945 3300049580 Bacteria 2291
113 Ga0501047_0180393 3300049581 Bacteria 1978
114 Ga0501071_0889110 3300049587 Bacteria 687
115 Ga0501074_0342595 3300049590 Bacteria 1061
116 Ga0501076_0219866 3300049592 Bacteria 1553
117 Ga0501076_1091746 3300049592 Bacteria 657
118 Ga0501077_0214618 3300049593 Bacteria 1223
119 Ga0501079_0150044 3300049741 Bacteria 1817
120 Ga0501081_0042001 3300049743 Bacteria 3134
121 Ga0501035_0000102 3300049822 Bacteria 106915
122 Ga0501035_0853714 3300049822 Unclassified 724
123 Ga0501044_0001230 3300049823 Bacteria 30435
124 Ga0501044_0052650 3300049823 Bacteria 4193
125 Ga0501044_0881174 3300049823 Bacteria 771
126 Ga0501045_0027507 3300049824 Bacteria 4099
127 Ga0501045_0203282 3300049824 Bacteria 1476
128 nmdc:mga08x19_171794_c1 3300050514 Bacteria 1476
129 Ga0500645_073607 3300053730 Bacteria 979
130 Ga0501084_0340630 3300054114 Bacteria 1267
131 Ga0501084_0377143 3300054114 Bacteria 1199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10000599 Ga0265323_100005994 174
2 3300031235 Ga0265330_10075262 Ga0265330_100752622 174
3 3300025291 Ga0209675_1003042 Ga0209675_10030426 178
4 3300009098 Ga0105245_10022221 Ga0105245_100222213 179
5 3300025927 Ga0207687_10082152 Ga0207687_100821521 179
6 3300049592 Ga0501076_0219866 Ga0501076_0219866_901_1470 181
7 3300046454 Ga0495592_0207183 Ga0495592_0207183_370_921 183
8 3300046559 Ga0495667_0402381 Ga0495667_0402381_160_711 183
9 iso_pu_bacteria 2848858292 2848865080 183
10 3300049587 Ga0501071_0889110 Ga0501071_0889110_22_579 185
11 iso_pu_bacteria 2522572158 2523105088 185
12 3300046665 Ga0495661_0248953 Ga0495661_0248953_270_830 186
13 3300049822 Ga0501035_0853714 Ga0501035_0853714_142_702 186
14 3300031344 Ga0265316_10010268 Ga0265316_100102687 187
15 3300048925 Ga0496122_0001566 Ga0496122_0001566_6166_6753 187
16 3300005578 Ga0068854_100034233 Ga0068854_1000342332 188
17 3300005614 Ga0068856_100013257 Ga0068856_1000132573 188
18 3300005614 Ga0068856_100545023 Ga0068856_1005450232 188
19 3300005618 Ga0068864_100376687 Ga0068864_1003766872 188
20 3300005843 Ga0068860_100562622 Ga0068860_1005626222 188
21 3300006175 Ga0070712_100050166 Ga0070712_1000501662 188
22 3300006237 Ga0097621_100229392 Ga0097621_1002293922 188
23 3300009093 Ga0105240_10056897 Ga0105240_100568973 188
24 3300009545 Ga0105237_10051896 Ga0105237_100518963 188
25 3300009551 Ga0105238_10868391 Ga0105238_108683911 188
26 3300010375 Ga0105239_11201682 Ga0105239_112016822 188
27 3300013104 Ga0157370_10036389 Ga0157370_100363893 188
28 3300013105 Ga0157369_10001780 Ga0157369_1000178017 188
29 3300013306 Ga0163162_10010827 Ga0163162_100108279 188
30 3300014325 Ga0163163_10403191 Ga0163163_104031912 188
31 3300014325 Ga0163163_11173581 Ga0163163_111735811 188
32 3300025913 Ga0207695_10178851 Ga0207695_101788512 188
33 3300025914 Ga0207671_10086862 Ga0207671_100868622 188
34 3300025915 Ga0207693_10080711 Ga0207693_100807112 188
35 3300025916 Ga0207663_11047112 Ga0207663_110471121 188
36 3300025924 Ga0207694_10767683 Ga0207694_107676831 188
37 3300025981 Ga0207640_10278398 Ga0207640_102783982 188
38 3300025986 Ga0207658_10064691 Ga0207658_100646912 188
39 3300026078 Ga0207702_10026095 Ga0207702_100260954 188
40 3300026078 Ga0207702_10447780 Ga0207702_104477802 188
41 3300028381 Ga0268264_10310221 Ga0268264_103102212 188
42 3300031548 Ga0307408_100460690 Ga0307408_1004606902 188
43 3300031731 Ga0307405_10037855 Ga0307405_100378552 188
44 3300031911 Ga0307412_10105115 Ga0307412_101051153 188
45 3300032004 Ga0307414_11242575 Ga0307414_112425751 188
46 3300032126 Ga0307415_100672512 Ga0307415_1006725121 188
47 3300037418 Ga0395900_0002926 Ga0395900_0002926_15171_15737 188
48 3300039062 Ga0400483_034557 Ga0400483_034557_11391_11993 188
49 3300039062 Ga0400483_139418 Ga0400483_139418_1730_2332 188
50 3300039062 Ga0400483_157394 Ga0400483_157394_411_1013 188
51 3300045051 Ga0451576_0152121 Ga0451576_0152121_933_1523 188
52 3300049571 Ga0501034_0587093 Ga0501034_0587093_43_609 188
53 3300049823 Ga0501044_0052650 Ga0501044_0052650_2403_2969 188
54 3300049823 Ga0501044_0881174 Ga0501044_0881174_119_685 188
55 3300005983 Ga0081540_1012630 Ga0081540_10126302 189
56 3300031249 Ga0265339_10046296 Ga0265339_100462963 189
57 3300031344 Ga0265316_10017638 Ga0265316_100176383 189
58 3300031711 Ga0265314_10015737 Ga0265314_100157375 189
59 3300031712 Ga0265342_10150180 Ga0265342_101501802 189
60 3300049568 Ga0501031_0004025 Ga0501031_0004025_4203_4784 189
61 3300049569 Ga0501032_0000119 Ga0501032_0000119_64047_64628 189
62 3300049570 Ga0501033_0000532 Ga0501033_0000532_12483_13064 189
63 3300049571 Ga0501034_0001333 Ga0501034_0001333_32357_32938 189
64 3300049572 Ga0501036_0000614 Ga0501036_0000614_18132_18713 189
65 3300049573 Ga0501037_0000288 Ga0501037_0000288_18119_18700 189
66 3300049574 Ga0501038_0000046 Ga0501038_0000046_36244_36825 189
67 3300049575 Ga0501039_0000003 Ga0501039_0000003_26754_27335 189
68 3300049578 Ga0501042_0394722 Ga0501042_0394722_80_661 189
69 3300049579 Ga0501043_0000051 Ga0501043_0000051_88225_88806 189
70 3300049580 Ga0501046_0094945 Ga0501046_0094945_897_1478 189
71 3300049581 Ga0501047_0180393 Ga0501047_0180393_783_1364 189
72 3300049590 Ga0501074_0342595 Ga0501074_0342595_64_642 189
73 3300049592 Ga0501076_1091746 Ga0501076_1091746_25_603 189
74 3300049593 Ga0501077_0214618 Ga0501077_0214618_575_1153 189
75 3300049741 Ga0501079_0150044 Ga0501079_0150044_1220_1798 189
76 3300049743 Ga0501081_0042001 Ga0501081_0042001_1163_1741 189
77 3300049822 Ga0501035_0000102 Ga0501035_0000102_18150_18731 189
78 3300049823 Ga0501044_0001230 Ga0501044_0001230_9449_10030 189
79 3300049824 Ga0501045_0027507 Ga0501045_0027507_2434_3012 189
80 3300049824 Ga0501045_0203282 Ga0501045_0203282_21_602 189
81 3300054114 Ga0501084_0340630 Ga0501084_0340630_350_928 189
82 3300054114 Ga0501084_0377143 Ga0501084_0377143_98_676 189
83 3300005364 Ga0070673_100268249 Ga0070673_1002682491 190
84 3300005441 Ga0070700_100769216 Ga0070700_1007692161 190
85 3300005459 Ga0068867_100127551 Ga0068867_1001275512 190
86 3300005530 Ga0070679_100461864 Ga0070679_1004618642 190
87 3300005545 Ga0070695_100637524 Ga0070695_1006375241 190
88 3300005577 Ga0068857_100136930 Ga0068857_1001369302 190
89 3300005617 Ga0068859_100609217 Ga0068859_1006092171 190
90 3300006881 Ga0068865_100334332 Ga0068865_1003343322 190
91 3300006931 Ga0097620_100609146 Ga0097620_1006091461 190
92 3300013100 Ga0157373_10136066 Ga0157373_101360662 190
93 3300013297 Ga0157378_11366968 Ga0157378_113669681 190
94 3300025261 Ga0209233_1004979 Ga0209233_10049793 190
95 3300025921 Ga0207652_10304401 Ga0207652_103044012 190
96 3300025960 Ga0207651_10193877 Ga0207651_101938772 190
97 3300026089 Ga0207648_10160607 Ga0207648_101606072 190
98 3300031251 Ga0265327_10001956 Ga0265327_1000195620 190
99 3300035692 Ga0373935_0081773 Ga0373935_0081773_800_1372 190
100 3300035695 Ga0373927_0304687 Ga0373927_0304687_146_718 190
101 3300035725 Ga0373947_0441909 Ga0373947_0441909_197_769 190
102 3300031251 Ga0265327_10194336 Ga0265327_101943362 191
103 3300044712 Ga0453684_0663667 Ga0453684_0663667_452_1084 191
104 3300014968 Ga0157379_10830757 Ga0157379_108307571 192
105 3300029957 Ga0265324_10003153 Ga0265324_100031536 192
106 3300031247 Ga0265340_10116403 Ga0265340_101164031 192
107 3300031344 Ga0265316_10006460 Ga0265316_1000646012 192
108 3300031344 Ga0265316_10163118 Ga0265316_101631183 192
109 3300009176 Ga0105242_10487548 Ga0105242_104875482 193
110 3300035695 Ga0373927_0096077 Ga0373927_0096077_555_1136 193
111 3300037068 Ga0373925_0118355 Ga0373925_0118355_221_802 193
112 3300046472 Ga0495580_0343901 Ga0495580_0343901_70_651 193
113 3300046531 Ga0495665_0426152 Ga0495665_0426152_60_641 193
114 3300005617 Ga0068859_101157642 Ga0068859_1011576421 194
115 3300031241 Ga0265325_10066427 Ga0265325_100664272 194
116 3300005354 Ga0070675_100309969 Ga0070675_1003099691 195
117 3300005365 Ga0070688_100070202 Ga0070688_1000702022 195
118 3300025926 Ga0207659_10205937 Ga0207659_102059372 195
119 3300053730 Ga0500645_073607 Ga0500645_073607_329_916 195
120 3300031242 Ga0265329_10041877 Ga0265329_100418772 197
121 3300037853 Ga0436364_0304215 Ga0436364_0304215_3434_4030 197
122 3300037853 Ga0436364_0571307 Ga0436364_0571307_151_753 197
123 3300005563 Ga0068855_100776582 Ga0068855_1007765821 198
124 3300021388 Ga0213875_10025920 Ga0213875_100259202 198
125 3300037853 Ga0436364_0270440 Ga0436364_0270440_2775_3383 198
126 3300039437 Ga0436365_0574663 Ga0436365_0574663_1124_1723 198
127 3300005328 Ga0070676_10455452 Ga0070676_104554521 200
128 3300005445 Ga0070708_100117191 Ga0070708_1001171912 200
129 3300006028 Ga0070717_10285037 Ga0070717_102850372 200
130 3300006914 Ga0075436_100144388 Ga0075436_1001443882 200
131 3300009093 Ga0105240_10001084 Ga0105240_1000108427 200
132 3300025913 Ga0207695_10003290 Ga0207695_100032909 200
133 3300050514 nmdc:mga08x19_171794_c1 nmdc:mga08x19_171794_c1_577_1179 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

5

142

0.92

PF01380

SIS

SIS domain

94

174

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x92-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7-phosphate 0.9677 3 186
4u6n-assembly1.cif.gz_A crystal structure of escherichia coli diaa 0.9675 3 186
5by2-assembly1.cif.gz_A sedoheptulose 7-phosphate isomerase from colwellia psychrerythraea strain 34h 0.9659 3 186
5i01-assembly1.cif.gz_B structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.9568 3 184
5i01-assembly1.cif.gz_C structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.9553 3 182
ID Description Score Start End Superfamily
af_P9WGG1_3_194_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9644 1 188 3.40.50.10490
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9553 3 182 3.40.50.10490
3trjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9451 3 184 3.40.50.10490
2x3yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9445 3 188 3.40.50.10490
af_P9WGG1_3_194_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9399 1 188 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A2U1VX65-F1-model_v4 Phosphoheptose isomerase 0.9905 12 187 GO:0016853
GO:0097367
GO:1901135
AF-A0A2E4WSJ6-F1-model_v4 Phosphoheptose isomerase 0.9863 23 186 GO:0016853
GO:0097367
GO:1901135
AF-A0A0F8ZY50-F1-model_v4 SIS domain-containing protein 0.984 34 186 GO:0097367
GO:1901135
AF-A0A0J6CGT7-F1-model_v4 Phosphoheptose isomerase (EC 5.3.1.28) (Sedoheptulose 7-phosphate isomerase) 0.9827 25 186 GO:0005737
GO:0005975
GO:0008270
GO:0008968
GO:0097367
GO:2001061
AF-G5J1L0-F1-model_v4 D-sedoheptulose-7-phosphate isomerase (EC 5.3.1.28) 0.9824 27 186 GO:0005737
GO:0008968
GO:0046872
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
92.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map