F150720

General Info

Members Datasets Scaffolds Average Seq Length
131 114 114 249

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_51048_c1|nmdc:mga03683_51048_c1_718_1581
Length 287
Sequence LRAFRDPLVGLAAQLTDLPSENDVFLKSANPGENGGVMKDAQSNSKVAIVTGSSRGIGAAIAKRLAADGFTIIVNYAGRAADAEQVVQAIGEAGGKAAAIQADVSAPAEVAALFDRTETLFGGVDVLVNNAGIIQPGLVPLSETDDALFDRLLAVNLKGVFNALRVASKRLRPGGRIVNFSTSVVGLALPGYSIYAATKAAVETLTNIFAKELRGRNITVNAVAPGPTATDLFFTGKTEEQIAHLTKMAPLERLGKPEDIAGVVSFLAGPDGGWVNGQTLRANGGIV

Samples

Sample ID Description Type Environment
1 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541357 Duganella sp. GV053 Isolate Unclassified
6 2738543003 Duganella sp. GV066 Isolate Unclassified
7 2738543026 Duganella sp. GV089 Isolate Unclassified
8 2738543029 Duganella sp. GV039 Isolate Unclassified
9 2791355262 Rhizobium sp. M1 Isolate Nodule
10 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
11 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
12 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
13 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
14 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
15 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
16 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
17 2941471342 Luteibacter sp. 621 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
109 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
112 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.02
Metatranscriptomes 0
Isolates 12.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.56
Nodule 0.76
Rhizoplane 1.53
Rhizosphere 46.56
Stem 0
Stem Tuber 0
Unclassified 33.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1020412 3300001904 Bacteria 1041
2 JGI25155J39150_1000007 3300002704 Bacteria 238857
3 JGI25156J39149_1000050 3300002705 Bacteria 89634
4 JGI25162J39368_1000908 3300002737 Bacteria 19122
5 JGI25154J39366_1000035 3300002738 Bacteria 172224
6 JGI25157J39369_1000036 3300002741 Bacteria 133671
7 rootH1_10021276 3300003316 Bacteria 2697
8 rootL2_10052043 3300003322 Bacteria 3812
9 Ga0055524_1023305 3300003775 Bacteria 1997
10 Ga0055528_1000525 3300003790 Bacteria 29704
11 Ga0070658_10026243 3300005327 Bacteria 4673
12 Ga0070709_10188879 3300005434 Bacteria 1452
13 Ga0070710_10107260 3300005437 Bacteria 1672
14 Ga0070710_10311413 3300005437 Bacteria 1031
15 Ga0070711_100166153 3300005439 Bacteria 1677
16 Ga0070663_100377837 3300005455 Bacteria 1153
17 Ga0068853_100000034 3300005539 Bacteria 113508
18 Ga0070665_100173510 3300005548 Bacteria 2157
19 Ga0068855_100715753 3300005563 Bacteria 1070
20 Ga0068858_100407857 3300005842 Bacteria 1306
21 Ga0081540_1000785 3300005983 Bacteria 29131
22 Ga0081539_10008815 3300005985 Bacteria 8634
23 Ga0075369_10034292 3300006186 Bacteria 2154
24 Ga0105243_10151146 3300009148 Bacteria 1992
25 Ga0105238_10023208 3300009551 Bacteria 6324
26 Ga0157370_10040195 3300013104 Bacteria 4516
27 Ga0157369_10008814 3300013105 Bacteria 11557
28 Ga0163163_10443893 3300014325 Bacteria 1357
29 Ga0163161_10040505 3300017792 Bacteria 3346
30 Ga0163161_10042330 3300017792 Bacteria 3275
31 Ga0213876_10027499 3300021384 Bacteria 3000
32 Ga0209435_100005 3300025206 Bacteria 573745
33 Ga0209760_104870 3300025207 Bacteria 1132
34 Ga0209437_100058 3300025233 Bacteria 357279
35 Ga0209646_1000011 3300025246 Bacteria 573745
36 Ga0209026_1000008 3300025250 Bacteria 573745
37 Ga0209026_1003228 3300025250 Bacteria 5492
38 Ga0209759_1000004 3300025256 Bacteria 573745
39 Ga0209233_1000240 3300025261 Bacteria 90758
40 Ga0209673_1000478 3300025273 Bacteria 66832
41 Ga0209564_1000215 3300025295 Bacteria 132838
42 Ga0209256_1000155 3300025299 Bacteria 144379
43 Ga0209051_1008707 3300025303 Bacteria 5337
44 Ga0207647_10000014 3300025904 Bacteria 143525
45 Ga0207707_10356685 3300025912 Bacteria 1259
46 Ga0207693_10092398 3300025915 Bacteria 2372
47 Ga0207709_10107264 3300025935 Bacteria 1859
48 Ga0207665_10010767 3300025939 Bacteria 6004
49 Ga0207639_10000052 3300026041 Bacteria 113608
50 Ga0209371_1003295 3300027312 Bacteria 7996
51 Ga0268266_10000750 3300028379 Bacteria 43429
52 Ga0268266_10158698 3300028379 Bacteria 2045
53 Ga0307515_10115213 3300028794 Bacteria 3099
54 Ga0268256_1002990 3300030500 Bacteria 7996
55 Ga0307511_10003392 3300030521 Bacteria 16378
56 Ga0307513_10022431 3300031456 Bacteria 7423
57 Ga0307514_10002130 3300031649 Bacteria 21362
58 Ga0265314_10019679 3300031711 Bacteria 5224
59 Ga0307410_10484800 3300031852 Bacteria 1015
60 Ga0316582_0059335 3300036647 Bacteria 2450
61 Ga0373925_0319398 3300037068 Bacteria 1256
62 Ga0395901_0237271 3300038443 Bacteria 1903
63 Ga0436365_0737124 3300039437 Bacteria 3072
64 Ga0436361_0299846 3300039447 Bacteria 2122
65 Ga0453683_0000500 3300044673 Bacteria 44816
66 Ga0495606_0000129 3300046507 Bacteria 127929
67 Ga0495606_0000419 3300046507 Bacteria 71128
68 Ga0495606_0006520 3300046507 Bacteria 10740
69 Ga0495606_0029194 3300046507 Bacteria 3877
70 Ga0495606_0245473 3300046507 Bacteria 996
71 Ga0495610_0000086 3300046512 Bacteria 109119
72 Ga0495610_0019739 3300046512 Bacteria 3759
73 Ga0495643_0000118 3300046522 Bacteria 127939
74 Ga0495597_0007732 3300046542 Bacteria 5434
75 Ga0495633_0002024 3300046558 Bacteria 14637
76 Ga0495611_0030057 3300046648 Bacteria 2387
77 Ga0495625_0001716 3300046660 Bacteria 25479
78 Ga0495671_0028717 3300046692 Bacteria 2862
79 Ga0495649_0069137 3300046694 Bacteria 1894
80 Ga0495672_0000253 3300047320 Bacteria 74560
81 Ga0495677_0026646 3300047445 Bacteria 2096
82 Ga0495686_0014472 3300047472 Bacteria 5426
83 Ga0496106_0108491 3300048909 Bacteria 2159
84 Ga0496117_0007624 3300048920 Bacteria 10508
85 Ga0496117_0010079 3300048920 Bacteria 8676
86 Ga0496118_0000268 3300048921 Bacteria 91201
87 Ga0496120_0067515 3300048923 Bacteria 1975
88 Ga0496121_0000116 3300048924 Bacteria 177260
89 Ga0496121_0000729 3300048924 Bacteria 60664
90 Ga0496121_0464462 3300048924 Bacteria 812
91 Ga0496122_0117019 3300048925 Bacteria 1731
92 Ga0496122_0167255 3300048925 Bacteria 1331
93 Ga0496123_0038520 3300048926 Bacteria 3358
94 Ga0496123_0050992 3300048926 Bacteria 2760
95 Ga0496124_0325439 3300048927 Bacteria 1099
96 Ga0496125_0003171 3300048928 Bacteria 20382
97 Ga0496126_0001112 3300048929 Bacteria 45021
98 Ga0496126_0117410 3300048929 Bacteria 2311
99 Ga0495678_000425 3300049459 Bacteria 42463
100 Ga0501048_0182665 3300049582 Bacteria 1487
101 Ga0501080_0026066 3300049742 Bacteria 5430
102 Ga0501080_0026929 3300049742 Bacteria 5346
103 nmdc:mga03683_51048_c1 3300050489 Bacteria 1725
104 nmdc:mga0sz30_64333_c1 3300050516 Bacteria 1571
105 Ga0500646_0001818 3300053090 Bacteria 5607
106 Ga0500583_0002816 3300053092 Bacteria 5330
107 Ga0500583_0134203 3300053092 Bacteria 1228
108 Ga0500593_000110 3300053117 Bacteria 31668
109 Ga0500594_0046328 3300053118 Bacteria 1209
110 Ga0500614_058866 3300053123 Bacteria 1028
111 Ga0500559_0006705 3300053136 Bacteria 5171
112 Ga0500586_000055 3300053145 Bacteria 20071
113 Ga0500604_0000094 3300053151 Bacteria 28414
114 Ga0500637_0053567 3300053178 Bacteria 2303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0245473 Ga0495606_0245473_200_961 208
2 3300031711 Ga0265314_10019679 Ga0265314_100196794 234
3 iso_pu_bacteria 2929138655 2929143692 237
4 3300027312 Ga0209371_1003295 Ga0209371_10032956 238
5 3300030500 Ga0268256_1002990 Ga0268256_10029904 238
6 3300031852 Ga0307410_10484800 Ga0307410_104848002 238
7 3300048926 Ga0496123_0050992 Ga0496123_0050992_152_976 238
8 iso_pu_bacteria 2738541297 2738825821 238
9 iso_pu_bacteria 2738541357 2739149618 238
10 iso_pu_bacteria 2738543003 2739191537 238
11 iso_pu_bacteria 2738543026 2739318014 238
12 iso_pu_bacteria 2738543029 2739336255 238
13 3300002737 JGI25162J39368_1000908 JGI25162J39368_100090811 239
14 3300025207 Ga0209760_104870 Ga0209760_1048702 239
15 3300025233 Ga0209437_100058 Ga0209437_100058230 239
16 3300025261 Ga0209233_1000240 Ga0209233_100024050 239
17 3300053123 Ga0500614_058866 Ga0500614_058866_117_908 240
18 3300003316 rootH1_10021276 rootH1_100212763 241
19 3300003322 rootL2_10052043 rootL2_100520433 241
20 3300005455 Ga0070663_100377837 Ga0070663_1003778371 242
21 3300046507 Ga0495606_0006520 Ga0495606_0006520_4542_5276 242
22 3300046692 Ga0495671_0028717 Ga0495671_0028717_98_832 242
23 3300046694 Ga0495649_0069137 Ga0495649_0069137_179_913 242
24 3300048920 Ga0496117_0007624 Ga0496117_0007624_1936_2769 242
25 3300005327 Ga0070658_10026243 Ga0070658_100262435 243
26 iso_pu_bacteria 2791355262 2793335033 243
27 iso_pu_bacteria 2941471342 2941471973 243
28 3300006186 Ga0075369_10034292 Ga0075369_100342922 244
29 3300028379 Ga0268266_10000750 Ga0268266_100007504 244
30 3300030521 Ga0307511_10003392 Ga0307511_1000339210 244
31 3300050516 nmdc:mga0sz30_64333_c1 nmdc:mga0sz30_64333_c1_138_878 244
32 3300053090 Ga0500646_0001818 Ga0500646_0001818_2914_3654 244
33 3300053092 Ga0500583_0002816 Ga0500583_0002816_2122_2862 244
34 3300053092 Ga0500583_0134203 Ga0500583_0134203_189_929 244
35 3300053118 Ga0500594_0046328 Ga0500594_0046328_60_800 244
36 3300053151 Ga0500604_0000094 Ga0500604_0000094_15522_16262 244
37 3300053178 Ga0500637_0053567 Ga0500637_0053567_1188_1928 244
38 iso_pu_bacteria 2515154189 2516019671 244
39 iso_pu_bacteria 2600255292 2601670150 244
40 iso_pu_bacteria 2857547612 2857553121 244
41 iso_pu_bacteria 2883087390 2883092116 244
42 iso_pu_bacteria 2932410948 2932413662 244
43 iso_pu_bacteria 2932416698 2932417722 244
44 3300014325 Ga0163163_10443893 Ga0163163_104438932 245
45 3300046507 Ga0495606_0000419 Ga0495606_0000419_11056_11802 245
46 3300046512 Ga0495610_0019739 Ga0495610_0019739_1707_2453 245
47 3300046522 Ga0495643_0000118 Ga0495643_0000118_116358_117104 245
48 3300046558 Ga0495633_0002024 Ga0495633_0002024_12408_13154 245
49 3300047320 Ga0495672_0000253 Ga0495672_0000253_9990_10736 245
50 3300047445 Ga0495677_0026646 Ga0495677_0026646_749_1495 245
51 3300049459 Ga0495678_000425 Ga0495678_000425_10052_10798 245
52 3300053145 Ga0500586_000055 Ga0500586_000055_14171_14917 245
53 3300002704 JGI25155J39150_1000007 JGI25155J39150_1000007201 246
54 3300002705 JGI25156J39149_1000050 JGI25156J39149_100005055 246
55 3300002738 JGI25154J39366_1000035 JGI25154J39366_1000035116 246
56 3300002741 JGI25157J39369_1000036 JGI25157J39369_1000036100 246
57 3300003775 Ga0055524_1023305 Ga0055524_10233052 246
58 3300003790 Ga0055528_1000525 Ga0055528_10005255 246
59 3300005563 Ga0068855_100715753 Ga0068855_1007157532 246
60 3300009148 Ga0105243_10151146 Ga0105243_101511462 246
61 3300009551 Ga0105238_10023208 Ga0105238_100232084 246
62 3300017792 Ga0163161_10042330 Ga0163161_100423303 246
63 3300025206 Ga0209435_100005 Ga0209435_100005352 246
64 3300025246 Ga0209646_1000011 Ga0209646_1000011352 246
65 3300025250 Ga0209026_1000008 Ga0209026_1000008352 246
66 3300025256 Ga0209759_1000004 Ga0209759_1000004352 246
67 3300025273 Ga0209673_1000478 Ga0209673_100047839 246
68 3300025295 Ga0209564_1000215 Ga0209564_10002152 246
69 3300025299 Ga0209256_1000155 Ga0209256_1000155115 246
70 3300025912 Ga0207707_10356685 Ga0207707_103566852 246
71 3300025935 Ga0207709_10107264 Ga0207709_101072642 246
72 3300037068 Ga0373925_0319398 Ga0373925_0319398_453_1199 246
73 3300038443 Ga0395901_0237271 Ga0395901_0237271_222_962 246
74 3300039447 Ga0436361_0299846 Ga0436361_0299846_986_1732 246
75 3300046648 Ga0495611_0030057 Ga0495611_0030057_888_1700 246
76 3300047472 Ga0495686_0014472 Ga0495686_0014472_2478_3299 246
77 3300048923 Ga0496120_0067515 Ga0496120_0067515_1029_1853 246
78 3300048924 Ga0496121_0464462 Ga0496121_0464462_47_787 246
79 3300048927 Ga0496124_0325439 Ga0496124_0325439_128_880 246
80 3300049582 Ga0501048_0182665 Ga0501048_0182665_734_1474 246
81 3300049742 Ga0501080_0026929 Ga0501080_0026929_455_1195 246
82 iso_pu_bacteria 2521172590 2521557202 246
83 iso_pu_bacteria 2818991449 2819617829 246
84 3300001904 JGI24736J21556_1020412 JGI24736J21556_10204122 247
85 3300005434 Ga0070709_10188879 Ga0070709_101888792 247
86 3300005437 Ga0070710_10107260 Ga0070710_101072602 247
87 3300005437 Ga0070710_10311413 Ga0070710_103114131 247
88 3300005439 Ga0070711_100166153 Ga0070711_1001661532 247
89 3300005539 Ga0068853_100000034 Ga0068853_10000003437 247
90 3300005548 Ga0070665_100173510 Ga0070665_1001735102 247
91 3300005842 Ga0068858_100407857 Ga0068858_1004078572 247
92 3300005983 Ga0081540_1000785 Ga0081540_100078526 247
93 3300005985 Ga0081539_10008815 Ga0081539_100088156 247
94 3300013104 Ga0157370_10040195 Ga0157370_100401954 247
95 3300013105 Ga0157369_10008814 Ga0157369_1000881410 247
96 3300017792 Ga0163161_10040505 Ga0163161_100405053 247
97 3300021384 Ga0213876_10027499 Ga0213876_100274992 247
98 3300025250 Ga0209026_1003228 Ga0209026_10032282 247
99 3300025303 Ga0209051_1008707 Ga0209051_10087075 247
100 3300025904 Ga0207647_10000014 Ga0207647_1000001419 247
101 3300025915 Ga0207693_10092398 Ga0207693_100923983 247
102 3300025939 Ga0207665_10010767 Ga0207665_100107676 247
103 3300026041 Ga0207639_10000052 Ga0207639_1000005252 247
104 3300028379 Ga0268266_10158698 Ga0268266_101586982 247
105 3300028794 Ga0307515_10115213 Ga0307515_101152133 247
106 3300031456 Ga0307513_10022431 Ga0307513_100224314 247
107 3300031649 Ga0307514_10002130 Ga0307514_1000213011 247
108 3300036647 Ga0316582_0059335 Ga0316582_0059335_1285_2034 247
109 3300039437 Ga0436365_0737124 Ga0436365_0737124_616_1368 247
110 3300044673 Ga0453683_0000500 Ga0453683_0000500_26598_27395 247
111 3300046507 Ga0495606_0000129 Ga0495606_0000129_68888_69727 247
112 3300046507 Ga0495606_0029194 Ga0495606_0029194_1843_2598 247
113 3300046512 Ga0495610_0000086 Ga0495610_0000086_16481_17299 247
114 3300046542 Ga0495597_0007732 Ga0495597_0007732_772_1527 247
115 3300046660 Ga0495625_0001716 Ga0495625_0001716_4156_4911 247
116 3300048909 Ga0496106_0108491 Ga0496106_0108491_425_1168 247
117 3300048920 Ga0496117_0010079 Ga0496117_0010079_3851_4594 247
118 3300048921 Ga0496118_0000268 Ga0496118_0000268_72928_73671 247
119 3300048924 Ga0496121_0000116 Ga0496121_0000116_175529_176272 247
120 3300048924 Ga0496121_0000729 Ga0496121_0000729_56597_57349 247
121 3300048925 Ga0496122_0117019 Ga0496122_0117019_967_1710 247
122 3300048925 Ga0496122_0167255 Ga0496122_0167255_403_1146 247
123 3300048926 Ga0496123_0038520 Ga0496123_0038520_215_958 247
124 3300048928 Ga0496125_0003171 Ga0496125_0003171_7903_8646 247
125 3300048929 Ga0496126_0001112 Ga0496126_0001112_3342_4094 247
126 3300048929 Ga0496126_0117410 Ga0496126_0117410_799_1542 247
127 3300049742 Ga0501080_0026066 Ga0501080_0026066_4205_4951 247
128 3300050489 nmdc:mga03683_51048_c1 nmdc:mga03683_51048_c1_718_1581 247
129 3300053117 Ga0500593_000110 Ga0500593_000110_29642_30385 247
130 3300053136 Ga0500559_0006705 Ga0500559_0006705_2752_3597 247
131 iso_pu_bacteria 2919046199 2919047685 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

241

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

287

0.94

PF08659

KR

KR domain

47

228

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

48

256

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5t-assembly3.cif.gz_B the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9892 8 247
3u5t-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9883 8 247
3u5t-assembly3.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9881 8 247
3u5t-assembly3.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9838 8 247
3u5t-assembly1.cif.gz_C the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9812 10 247
ID Description Score Start End Superfamily
af_A0A1P8BDP1_1_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9799 5 233 3.40.50.720
3u5tC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 10 247 3.40.50.720
3u5tC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 10 247 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 8 247 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.961 5 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0F9MQQ7-F1-model_v4 Uncharacterized protein 0.995 7 193 GO:0016614
AF-A0A401YET2-F1-model_v4 3-ketoacyl-ACP reductase 0.9921 8 247 GO:0016614
AF-A0A1H9FRT4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9919 8 247 GO:0016614
AF-A0A2S1LAK3-F1-model_v4 3-ketoacyl-ACP reductase 0.9919 7 247 GO:0016614
AF-A0A542SYY9-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9915 8 247 GO:0016614

Feature Viewer

pLDDT pTM Quality
93.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map