F119960

General Info

Members Datasets Scaffolds Average Seq Length
123 106 68 407

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0001799|Ga0496117_0001799_25525_26883
Length 452
Sequence MEGSRQARGRTTVYLPAVDFSADSGGTRLRVFGRARAMTQTHTSAEPTLFRIAGFPYFVIAFIARLPFAMMVVGVLTVVVSARGSLSLGGLTSAAVGLGTACFGPLLGAAADRFGQRVVLLIVALANGTMLLLFTAVVYGESPDALVLIAAIGIGATAPQVSPLSRSRLVTLIRERVEDTRQPRTVSGTMAYESAADETVFVFGPFIVGILASAIAPWAPLVGAAILTVVFVGAFALHPSARHVSRDRGEDGKALSPVSELFRPQLLVVILGILGVGIFFGTMLTSLTSFMADRDAAEQAGLLYGVMGVGSAVLALGVAWLPPAFSLRARWLVFSGILLAGSLLLGLVDSPEMMMLALAIMGIGIGPTLVTQYSFGAALSPRGRSATVMTMLGSGIVVGQSIGAAVAGEIAENVGTSAALVLPMFAAAVAFGAGLLNWVLSSARRRRRTVAA

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221649 Leifsonia sp. Root4 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
11 2738541305 Nocardioides sp. CF167 Isolate Unclassified
12 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
13 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
14 2773857759 Microbacterium sp. 1294 Isolate Unclassified
15 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
16 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
17 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
18 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
19 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
20 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
21 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
22 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
23 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
24 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
25 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
26 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
27 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
28 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
29 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
30 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
31 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
32 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
33 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
34 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
35 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
36 2919069694 Microbacterium sp. 1154 Isolate Unclassified
37 2919395869 Microbacterium resistens 2980 Isolate Unclassified
38 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
39 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
40 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
41 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
42 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
43 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
44 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
45 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
46 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
47 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
48 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
101 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
102 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
103 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
104 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
105 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
106 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 52.03
Metatranscriptomes 3.25
Isolates 44.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 7.32
Rhizosphere 38.21
Stem 0
Stem Tuber 0
Unclassified 47.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006025 3300001979 Bacteria 5069
2 Ga0006562J51391_1127726 3300003578 Bacteria 1900
3 Ga0006562J51391_1144348 3300003578 Bacteria 22011
4 Ga0006562J51391_1144350 3300003578 Bacteria 18470
5 Ga0055527_1000004 3300003760 Bacteria 570634
6 Ga0055542_1000055 3300003762 Bacteria 171477
7 Ga0055529_1000066 3300003763 Bacteria 170902
8 Ga0068855_100215978 3300005563 Bacteria 2153
9 Ga0075364_10081383 3300006051 Bacteria 2141
10 Ga0157369_10000926 3300013105 Bacteria 37311
11 Ga0171462_1002 3300013250 Bacteria 1052134
12 Ga0163162_10167049 3300013306 Bacteria 2324
13 Ga0206353_10190723 3300020082 Bacteria 1962
14 Ga0209672_100011 3300025228 Bacteria 856297
15 Ga0209147_101261 3300025229 Bacteria 9944
16 Ga0209646_1000098 3300025246 Bacteria 180711
17 Ga0209148_1000132 3300025254 Bacteria 171529
18 Ga0209455_1000122 3300025272 Bacteria 170954
19 Ga0207647_10036593 3300025904 Bacteria 3118
20 Ga0307410_10223207 3300031852 Bacteria 1451
21 Ga0307406_10001314 3300031901 Bacteria 13949
22 Ga0307406_10171163 3300031901 Bacteria 1572
23 Ga0307414_10023942 3300032004 Bacteria 3884
24 Ga0395899_0028865 3300037312 Bacteria 4175
25 Ga0395900_0003130 3300037418 Bacteria 17947
26 Ga0395898_0000158 3300037466 Bacteria 172981
27 Ga0395901_0014643 3300038443 Bacteria 7970
28 Ga0395901_0128638 3300038443 Bacteria 2662
29 Ga0466972_0041269 3300044658 Bacteria 2247
30 Ga0466965_0005490 3300044683 Bacteria 5719
31 Ga0466970_0000150 3300044765 Bacteria 32514
32 Ga0466957_0136933 3300044842 Bacteria 1574
33 Ga0466960_0059432 3300044901 Bacteria 1870
34 Ga0495627_002378 3300046453 Bacteria 9154
35 Ga0496101_0027304 3300048904 Bacteria 3975
36 Ga0496103_0032716 3300048906 Bacteria 3175
37 Ga0496104_0104388 3300048907 Bacteria 2715
38 Ga0496105_0021383 3300048908 Bacteria 5236
39 Ga0496107_0033917 3300048910 Bacteria 3654
40 Ga0496111_0017362 3300048914 Bacteria 4976
41 Ga0496112_0199072 3300048915 Bacteria 1963
42 Ga0496114_0102298 3300048917 Bacteria 2447
43 Ga0496115_0013519 3300048918 Bacteria 6175
44 Ga0496117_0000232 3300048920 Bacteria 105479
45 Ga0496117_0001799 3300048920 Bacteria 29138
46 Ga0496118_0011246 3300048921 Bacteria 8761
47 Ga0496119_0002020 3300048922 Bacteria 22984
48 Ga0496119_0002443 3300048922 Bacteria 20410
49 Ga0496119_0077206 3300048922 Bacteria 1930
50 Ga0496120_0002501 3300048923 Bacteria 18438
51 Ga0496120_0014505 3300048923 Bacteria 5249
52 Ga0496122_0012542 3300048925 Bacteria 8419
53 Ga0496122_0053141 3300048925 Bacteria 3057
54 Ga0496122_0144208 3300048925 Bacteria 1483
55 Ga0496123_0002368 3300048926 Bacteria 23643
56 Ga0496124_0009338 3300048927 Bacteria 10104
57 Ga0496125_0004593 3300048928 Bacteria 15782
58 Ga0496125_0008744 3300048928 Bacteria 10534
59 Ga0496125_0013818 3300048928 Bacteria 7907
60 Ga0496125_0051984 3300048928 Bacteria 3373
61 Ga0496126_0001194 3300048929 Bacteria 42334
62 Ga0496126_0004215 3300048929 Bacteria 17327
63 Ga0501034_0000485 3300049571 Bacteria 64899
64 Ga0501034_0064582 3300049571 Bacteria 3674
65 Ga0501038_0030195 3300049574 Bacteria 4798
66 Ga0501038_0063607 3300049574 Bacteria 3149
67 Ga0501070_0000788 3300049586 Bacteria 28810
68 Ga0501070_0005150 3300049586 Bacteria 11141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003578 Ga0006562J51391_1127726 Ga0006562J51391_11277261 302
2 3300038443 Ga0395901_0014643 Ga0395901_0014643_3134_4393 313
3 3300044683 Ga0466965_0005490 Ga0466965_0005490_2919_4190 313
4 3300048910 Ga0496107_0033917 Ga0496107_0033917_167_1405 320
5 3300013306 Ga0163162_10167049 Ga0163162_101670492 321
6 3300048904 Ga0496101_0027304 Ga0496101_0027304_2434_3672 321
7 3300048907 Ga0496104_0104388 Ga0496104_0104388_1049_2287 321
8 3300048914 Ga0496111_0017362 Ga0496111_0017362_2522_3760 321
9 3300048915 Ga0496112_0199072 Ga0496112_0199072_320_1558 321
10 3300048917 Ga0496114_0102298 Ga0496114_0102298_289_1527 321
11 3300048918 Ga0496115_0013519 Ga0496115_0013519_2289_3527 321
12 3300048922 Ga0496119_0077206 Ga0496119_0077206_406_1644 321
13 3300031901 Ga0307406_10001314 Ga0307406_100013145 324
14 3300025904 Ga0207647_10036593 Ga0207647_100365932 328
15 3300048906 Ga0496103_0032716 Ga0496103_0032716_236_1507 328
16 3300048908 Ga0496105_0021383 Ga0496105_0021383_1958_3229 328
17 3300013105 Ga0157369_10000926 Ga0157369_100009266 329
18 3300048922 Ga0496119_0002443 Ga0496119_0002443_3464_4816 329
19 3300044658 Ga0466972_0041269 Ga0466972_0041269_734_1960 333
20 3300044765 Ga0466970_0000150 Ga0466970_0000150_22595_23821 333
21 3300044842 Ga0466957_0136933 Ga0466957_0136933_146_1372 333
22 3300013250 Ga0171462_1002 Ga0171462_1002712 336
23 3300049571 Ga0501034_0064582 Ga0501034_0064582_495_1718 336
24 3300049574 Ga0501038_0030195 Ga0501038_0030195_2078_3301 336
25 3300025246 Ga0209646_1000098 Ga0209646_100009825 340
26 3300049586 Ga0501070_0000788 Ga0501070_0000788_14824_16200 341
27 3300048925 Ga0496122_0144208 Ga0496122_0144208_140_1405 344
28 3300031901 Ga0307406_10171163 Ga0307406_101711631 345
29 3300038443 Ga0395901_0128638 Ga0395901_0128638_279_1502 346
30 3300003760 Ga0055527_1000004 Ga0055527_100000461 347
31 3300003762 Ga0055542_1000055 Ga0055542_100005561 347
32 3300003763 Ga0055529_1000066 Ga0055529_1000066100 347
33 3300025228 Ga0209672_100011 Ga0209672_10001161 347
34 3300025229 Ga0209147_101261 Ga0209147_1012615 347
35 3300025254 Ga0209148_1000132 Ga0209148_1000132101 347
36 3300025272 Ga0209455_1000122 Ga0209455_100012261 347
37 iso_pu_bacteria 8002811521 8002813655 349
38 iso_pu_bacteria 2643221617 2644100667 350
39 iso_pu_bacteria 2643221620 2644117075 350
40 iso_pu_bacteria 2773857762 2774395815 350
41 iso_pu_bacteria 2808606368 2808883529 350
42 iso_pu_bacteria 2808606439 2809199137 350
43 iso_pu_bacteria 2811994874 2812330844 350
44 iso_pu_bacteria 2891968417 2891968558 350
45 iso_pu_bacteria 2811994878 2812348070 351
46 iso_pu_bacteria 2995726249 2995727283 351
47 iso_pu_bacteria 2643221566 2643846749 352
48 iso_pu_bacteria 2773857758 2774381676 352
49 iso_pu_bacteria 2852632344 2852634143 352
50 iso_pu_bacteria 2904501621 2904502304 352
51 iso_pu_bacteria 2904509784 2904512668 352
52 iso_pu_bacteria 2908674828 2908677316 352
53 iso_pu_bacteria 2908678064 2908681334 352
54 iso_pu_bacteria 2909074476 2909076126 352
55 iso_pu_bacteria 2919039151 2919042202 352
56 iso_pu_bacteria 2919069694 2919071498 352
57 iso_pu_bacteria 2928500415 2928502620 352
58 iso_pu_bacteria 2946041624 2946043899 352
59 iso_pu_bacteria 2974294766 2974297686 352
60 iso_pu_bacteria 2974324384 2974326079 352
61 iso_pu_bacteria 8004212874 8004214252 352
62 iso_pu_bacteria 2946033335 2946034064 353
63 3300006051 Ga0075364_10081383 Ga0075364_100813832 354
64 3300048928 Ga0496125_0051984 Ga0496125_0051984_1070_2317 354
65 3300049574 Ga0501038_0063607 Ga0501038_0063607_1429_2649 354
66 iso_pu_bacteria 2757320536 2758227272 354
67 iso_pu_bacteria 2773857759 2774383438 354
68 iso_pu_bacteria 2808606447 2809228472 354
69 iso_pu_bacteria 8016254467 8016257857 354
70 3300031852 Ga0307410_10223207 Ga0307410_102232071 355
71 iso_pu_bacteria 2643221597 2643996822 355
72 iso_pu_bacteria 2738541305 2738869557 355
73 iso_pu_bacteria 2773857763 2774398186 355
74 iso_pu_bacteria 2857723135 2857723523 355
75 iso_pu_bacteria 2945968032 2945971520 355
76 iso_pu_bacteria 8045830549 8045833859 355
77 iso_pu_bacteria 2919395869 2919396315 356
78 iso_pu_bacteria 2977264416 2977266279 356
79 3300003578 Ga0006562J51391_1144348 Ga0006562J51391_114434813 357
80 3300003578 Ga0006562J51391_1144350 Ga0006562J51391_11443508 357
81 3300005563 Ga0068855_100215978 Ga0068855_1002159783 357
82 3300048920 Ga0496117_0000232 Ga0496117_0000232_72366_73610 357
83 3300048922 Ga0496119_0002020 Ga0496119_0002020_14699_15946 357
84 3300048923 Ga0496120_0002501 Ga0496120_0002501_10178_11425 357
85 3300048923 Ga0496120_0014505 Ga0496120_0014505_195_1439 357
86 3300048925 Ga0496122_0012542 Ga0496122_0012542_105_1349 357
87 3300048926 Ga0496123_0002368 Ga0496123_0002368_15334_16578 357
88 3300048927 Ga0496124_0009338 Ga0496124_0009338_1164_2408 357
89 3300048928 Ga0496125_0004593 Ga0496125_0004593_8909_10153 357
90 3300048929 Ga0496126_0001194 Ga0496126_0001194_2197_3441 357
91 3300049586 Ga0501070_0005150 Ga0501070_0005150_153_1394 357
92 iso_pu_bacteria 2977251589 2977252066 357
93 iso_pu_bacteria 2643221542 2643733951 358
94 iso_pu_bacteria 2643221604 2644032850 358
95 iso_pu_bacteria 2643221630 2644170532 358
96 iso_pu_bacteria 2643221649 2644279146 358
97 iso_pu_bacteria 2852663356 2852664933 358
98 iso_pu_bacteria 2870628048 2870631483 358
99 iso_pu_bacteria 2906799679 2906801824 358
100 3300032004 Ga0307414_10023942 Ga0307414_100239423 359
101 3300044901 Ga0466960_0059432 Ga0466960_0059432_262_1503 359
102 3300046453 Ga0495627_002378 Ga0495627_002378_237_1493 359
103 3300048921 Ga0496118_0011246 Ga0496118_0011246_257_1504 359
104 3300048925 Ga0496122_0053141 Ga0496122_0053141_1283_2530 359
105 3300048928 Ga0496125_0008744 Ga0496125_0008744_2732_3979 359
106 iso_pu_bacteria 8004182704 8004185423 359
107 iso_pu_bacteria 8055034563 8055036740 359
108 iso_pu_bacteria 8055037949 8055040844 359
109 3300037312 Ga0395899_0028865 Ga0395899_0028865_2737_4008 360
110 3300037418 Ga0395900_0003130 Ga0395900_0003130_2652_3923 360
111 3300037466 Ga0395898_0000158 Ga0395898_0000158_98729_100000 360
112 iso_pu_bacteria 2643221724 2644679890 360
113 iso_pu_bacteria 2728369380 2730229356 360
114 iso_pu_bacteria 2977228692 2977231042 360
115 iso_pu_bacteria 2984542743 2984545891 360
116 iso_pu_bacteria 2842888712 2842888872 361
117 iso_pu_bacteria 2848551377 2848553783 361
118 3300001979 JGI24740J21852_10006025 JGI24740J21852_100060254 362
119 3300020082 Ga0206353_10190723 Ga0206353_101907232 362
120 3300048920 Ga0496117_0001799 Ga0496117_0001799_25525_26883 362
121 3300048928 Ga0496125_0013818 Ga0496125_0013818_304_1662 362
122 3300048929 Ga0496126_0004215 Ga0496126_0004215_2740_4098 362
123 3300049571 Ga0501034_0000485 Ga0501034_0000485_36808_38094 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

57

375

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.6697 94 334
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.6002 28 348
8jta-assembly1.cif.gz_A human vmat2 complex with tetrabenazine 0.5924 22 341
5aym-assembly1.cif.gz_A crystal structure of a bacterial homologue of iron transporter ferroportin in outward-facing state with soaked iron 0.5904 23 343
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.5888 103 326
ID Description Score Start End Superfamily
af_P21503_7_181_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8902 200 329 1.20.1250.20
af_Q2FW85_259_476_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8835 192 329 1.20.1250.20
af_A0A0R0GUC5_71_252_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8569 192 329 1.20.1250.20
af_A0A0R0HGC8_27_266_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8444 198 327 1.20.1250.20
af_P76269_265_456_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8436 198 329 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A531J5U7-F1-model_v4 MFS transporter 0.8848 198 332 GO:0005886
GO:0022857
AF-A0A5N5DWN1-F1-model_v4 ABC transporter permease 0.882 200 345 GO:0016020
GO:0022857
AF-E5X3J7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8814 189 329 GO:0016020
GO:0022857
AF-U1AWY8-F1-model_v4 deleted 0.8708 189 329
AF-A0A6B3FMK0-F1-model_v4 MFS transporter 0.87 131 347 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
75.98 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map