F091238

General Info

Members Datasets Scaffolds Average Seq Length
117 56 117 153

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101695067|Ga0070683_1016950671
Length 149
Sequence MRDDATGVALPLHRRVRHGLRHPANWFQLVRFALVGASGYVVNLAVFAAAVHLLGIDYKIAAVLAFLVSVANNFWWNRHWTFEDARAGHAGFQAARFLTVSVVAFLFSYGVLVLLVEDAGLAKVLAQAIAIVTATPLSFLGQKLWSFRA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
32 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
33 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
34 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
42 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
51 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
52 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
53 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
54 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
55 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
56 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 3.42
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 17.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100076167 3300005329 Bacteria 3136
2 Ga0070683_101695067 3300005329 Bacteria 608
3 Ga0070680_100196439 3300005336 Bacteria 1701
4 Ga0070660_100026882 3300005339 Bacteria 4288
5 Ga0070669_100444995 3300005353 Bacteria 1067
6 Ga0070659_100000002 3300005366 Bacteria 369239
7 Ga0070714_100003273 3300005435 Bacteria 12064
8 Ga0070714_100098300 3300005435 Bacteria 2575
9 Ga0070714_100221525 3300005435 Bacteria 1739
10 Ga0070710_10000007 3300005437 Bacteria 215320
11 Ga0070705_100001484 3300005440 Bacteria 12398
12 Ga0070681_10534223 3300005458 Bacteria 1086
13 Ga0070684_100206191 3300005535 Bacteria 1791
14 Ga0070684_100684251 3300005535 Bacteria 956
15 Ga0070717_10000005 3300006028 Bacteria 357819
16 Ga0070712_100000072 3300006175 Bacteria 51993
17 Ga0099795_10293719 3300007788 Bacteria 713
18 Ga0105240_10338861 3300009093 Bacteria 1709
19 Ga0105249_10910794 3300009553 Bacteria 946
20 Ga0105246_10051094 3300011119 Bacteria 2837
21 Ga0157375_11241924 3300013308 Bacteria 875
22 Ga0163163_13333921 3300014325 Unclassified 501
23 Ga0213873_10006497 3300021358 Bacteria 2302
24 Ga0213876_10096708 3300021384 Bacteria 1564
25 Ga0213876_10226240 3300021384 Bacteria 994
26 Ga0213876_10631418 3300021384 Bacteria 570
27 Ga0213875_10008797 3300021388 Bacteria 5154
28 Ga0213875_10348823 3300021388 Bacteria 703
29 Ga0207692_10000001 3300025898 Bacteria 558345
30 Ga0207707_10464510 3300025912 Bacteria 1082
31 Ga0207695_10285357 3300025913 Bacteria 1544
32 Ga0207693_10000001 3300025915 Bacteria 469535
33 Ga0207657_10303826 3300025919 Bacteria 1264
34 Ga0207681_10079290 3300025923 Bacteria 2313
35 Ga0207664_10002360 3300025929 Bacteria 12474
36 Ga0207664_10076275 3300025929 Bacteria 2713
37 Ga0207690_10000024 3300025932 Bacteria 194416
38 Ga0207661_10177697 3300025944 Bacteria 1857
39 Ga0207661_10670456 3300025944 Bacteria 953
40 Ga0436364_0167277 3300037853 Bacteria 3196
41 Ga0436364_0179785 3300037853 Bacteria 27846
42 Ga0436364_0295962 3300037853 Bacteria 3442
43 Ga0436364_0638002 3300037853 Bacteria 1002
44 Ga0436364_1050261 3300037853 Bacteria 2240
45 Ga0436365_0017613 3300039437 Bacteria 1660
46 Ga0436365_0523829 3300039437 Bacteria 1558
47 Ga0436365_0699385 3300039437 Bacteria 3981
48 Ga0436365_1222623 3300039437 Unclassified 1235
49 Ga0436365_1298455 3300039437 Bacteria 2489
50 Ga0436365_1822928 3300039437 Unclassified 1370
51 Ga0436363_0422714 3300039450 Bacteria 1392
52 Ga0436363_1055535 3300039450 Bacteria 1131
53 Ga0436363_1256551 3300039450 Bacteria 1575
54 Ga0436363_1490224 3300039450 Bacteria 740
55 Ga0436362_0074409 3300039453 Bacteria 2489
56 Ga0436362_0150342 3300039453 Bacteria 3184
57 Ga0466969_0114788 3300044656 Bacteria 1258
58 Ga0466969_0570404 3300044656 Bacteria 518
59 Ga0466972_0037980 3300044658 Bacteria 2353
60 Ga0466965_0064884 3300044683 Bacteria 1829
61 Ga0466965_0084808 3300044683 Bacteria 1605
62 Ga0466965_0256461 3300044683 Bacteria 939
63 Ga0466965_0272524 3300044683 Bacteria 912
64 Ga0466966_0050388 3300044684 Bacteria 2649
65 Ga0466966_0072732 3300044684 Bacteria 2152
66 Ga0466966_0353457 3300044684 Bacteria 883
67 Ga0466961_0048563 3300044693 Bacteria 2712
68 Ga0466961_0816839 3300044693 Unclassified 556
69 Ga0466963_0000599 3300044694 Bacteria 17225
70 Ga0466963_0140858 3300044694 Unclassified 1671
71 Ga0466963_0575373 3300044694 Bacteria 795
72 Ga0466964_0119142 3300044706 Bacteria 1188
73 Ga0466964_0547623 3300044706 Bacteria 628
74 Ga0466971_0009470 3300044719 Bacteria 4254
75 Ga0466971_0027233 3300044719 Bacteria 2559
76 Ga0466971_0177503 3300044719 Unclassified 1000
77 Ga0466971_0262225 3300044719 Unclassified 825
78 Ga0466971_0409891 3300044719 Unclassified 661
79 Ga0466968_0032107 3300044735 Bacteria 2182
80 Ga0466968_0065409 3300044735 Bacteria 1574
81 Ga0466968_0074283 3300044735 Bacteria 1484
82 Ga0466968_0099035 3300044735 Bacteria 1300
83 Ga0466968_0352750 3300044735 Bacteria 715
84 Ga0466970_0648633 3300044765 Bacteria 614
85 Ga0466957_0011318 3300044842 Bacteria 5143
86 Ga0466957_0044730 3300044842 Bacteria 2684
87 Ga0466957_0318617 3300044842 Bacteria 1049
88 Ga0466960_0002350 3300044901 Bacteria 7112
89 Ga0466959_0052555 3300045049 Bacteria 2983
90 Ga0466959_0073151 3300045049 Bacteria 2480
91 Ga0466959_0081861 3300045049 Bacteria 2326
92 Ga0466959_0397062 3300045049 Unclassified 938
93 Ga0466959_0431297 3300045049 Unclassified 894
94 Ga0466959_0716921 3300045049 Unclassified 670
95 Ga0466958_0000697 3300045836 Bacteria 14623
96 Ga0466958_0002279 3300045836 Bacteria 9560
97 Ga0466958_0002937 3300045836 Bacteria 8717
98 Ga0466958_0008597 3300045836 Bacteria 5667
99 Ga0466958_0093491 3300045836 Bacteria 1862
100 Ga0466958_0218154 3300045836 Bacteria 1216
101 Ga0466958_0323825 3300045836 Bacteria 991
102 Ga0466958_0808013 3300045836 Bacteria 611
103 Ga0466958_1050377 3300045836 Unclassified 532
104 Ga0466967_0005023 3300045976 Bacteria 9067
105 Ga0466967_0668736 3300045976 Bacteria 1028
106 Ga0466967_1674538 3300045976 Bacteria 633
107 Ga0496101_0042159 3300048904 Bacteria 3258
108 Ga0496104_0742333 3300048907 Bacteria 889
109 Ga0496112_0005000 3300048915 Bacteria 11373
110 Ga0496114_0621160 3300048917 Unclassified 952
111 nmdc:mga0yw44_267763_c1 3300050492 Bacteria 1140
112 Ga0495619_0488543 3300053085 Bacteria 847
113 Ga0466962_0037961 3300061719 Bacteria 2307
114 Ga0466962_0135844 3300061719 Bacteria 1190
115 Ga0466962_0138541 3300061719 Bacteria 1178
116 Ga0466962_0299363 3300061719 Unclassified 795
117 Ga0466962_0419509 3300061719 Bacteria 671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0570404 Ga0466969_0570404_36_425 128
2 3300045976 Ga0466967_0668736 Ga0466967_0668736_517_1014 128
3 3300044658 Ga0466972_0037980 Ga0466972_0037980_1140_1586 135
4 3300044694 Ga0466963_0000599 Ga0466963_0000599_8130_8594 142
5 3300045049 Ga0466959_0052555 Ga0466959_0052555_794_1258 142
6 3300045836 Ga0466958_0000697 Ga0466958_0000697_10368_10832 142
7 3300045976 Ga0466967_0005023 Ga0466967_0005023_7046_7510 142
8 3300045976 Ga0466967_1674538 Ga0466967_1674538_44_508 142
9 3300061719 Ga0466962_0037961 Ga0466962_0037961_743_1207 142
10 3300048904 Ga0496101_0042159 Ga0496101_0042159_2597_3040 143
11 3300005336 Ga0070680_100196439 Ga0070680_1001964392 147
12 3300005353 Ga0070669_100444995 Ga0070669_1004449951 147
13 3300005435 Ga0070714_100003273 Ga0070714_1000032734 147
14 3300005435 Ga0070714_100098300 Ga0070714_1000983002 147
15 3300005435 Ga0070714_100221525 Ga0070714_1002215251 147
16 3300005437 Ga0070710_10000007 Ga0070710_1000000764 147
17 3300005458 Ga0070681_10534223 Ga0070681_105342232 147
18 3300005535 Ga0070684_100684251 Ga0070684_1006842511 147
19 3300006028 Ga0070717_10000005 Ga0070717_100000054 147
20 3300006175 Ga0070712_100000072 Ga0070712_10000007248 147
21 3300007788 Ga0099795_10293719 Ga0099795_102937191 147
22 3300009093 Ga0105240_10338861 Ga0105240_103388612 147
23 3300009553 Ga0105249_10910794 Ga0105249_109107941 147
24 3300011119 Ga0105246_10051094 Ga0105246_100510943 147
25 3300013308 Ga0157375_11241924 Ga0157375_112419242 147
26 3300014325 Ga0163163_13333921 Ga0163163_133339211 147
27 3300021358 Ga0213873_10006497 Ga0213873_100064972 147
28 3300021384 Ga0213876_10096708 Ga0213876_100967082 147
29 3300021384 Ga0213876_10226240 Ga0213876_102262402 147
30 3300021384 Ga0213876_10631418 Ga0213876_106314181 147
31 3300021388 Ga0213875_10008797 Ga0213875_100087975 147
32 3300021388 Ga0213875_10348823 Ga0213875_103488231 147
33 3300025898 Ga0207692_10000001 Ga0207692_10000001294 147
34 3300025912 Ga0207707_10464510 Ga0207707_104645102 147
35 3300025913 Ga0207695_10285357 Ga0207695_102853572 147
36 3300025915 Ga0207693_10000001 Ga0207693_10000001126 147
37 3300025923 Ga0207681_10079290 Ga0207681_100792902 147
38 3300025929 Ga0207664_10002360 Ga0207664_100023606 147
39 3300025929 Ga0207664_10076275 Ga0207664_100762752 147
40 3300037853 Ga0436364_0167277 Ga0436364_0167277_69_551 147
41 3300037853 Ga0436364_0179785 Ga0436364_0179785_12568_13038 147
42 3300037853 Ga0436364_0295962 Ga0436364_0295962_625_1074 147
43 3300037853 Ga0436364_0638002 Ga0436364_0638002_409_858 147
44 3300037853 Ga0436364_1050261 Ga0436364_1050261_978_1460 147
45 3300039437 Ga0436365_0017613 Ga0436365_0017613_892_1362 147
46 3300039437 Ga0436365_0523829 Ga0436365_0523829_695_1177 147
47 3300039437 Ga0436365_0699385 Ga0436365_0699385_1004_1453 147
48 3300039437 Ga0436365_1222623 Ga0436365_1222623_384_833 147
49 3300039437 Ga0436365_1298455 Ga0436365_1298455_653_1135 147
50 3300039437 Ga0436365_1822928 Ga0436365_1822928_242_694 147
51 3300039450 Ga0436363_0422714 Ga0436363_0422714_134_586 147
52 3300039450 Ga0436363_1055535 Ga0436363_1055535_71_589 147
53 3300039450 Ga0436363_1256551 Ga0436363_1256551_816_1325 147
54 3300039450 Ga0436363_1490224 Ga0436363_1490224_175_624 147
55 3300039453 Ga0436362_0074409 Ga0436362_0074409_1297_1767 147
56 3300039453 Ga0436362_0150342 Ga0436362_0150342_1009_1491 147
57 3300044656 Ga0466969_0114788 Ga0466969_0114788_728_1180 147
58 3300044683 Ga0466965_0064884 Ga0466965_0064884_605_1087 147
59 3300044683 Ga0466965_0084808 Ga0466965_0084808_800_1282 147
60 3300044683 Ga0466965_0256461 Ga0466965_0256461_50_499 147
61 3300044683 Ga0466965_0272524 Ga0466965_0272524_419_868 147
62 3300044684 Ga0466966_0050388 Ga0466966_0050388_1550_1999 147
63 3300044684 Ga0466966_0072732 Ga0466966_0072732_1003_1455 147
64 3300044684 Ga0466966_0353457 Ga0466966_0353457_77_559 147
65 3300044693 Ga0466961_0048563 Ga0466961_0048563_2057_2506 147
66 3300044693 Ga0466961_0816839 Ga0466961_0816839_31_480 147
67 3300044694 Ga0466963_0140858 Ga0466963_0140858_117_635 147
68 3300044694 Ga0466963_0575373 Ga0466963_0575373_323_772 147
69 3300044706 Ga0466964_0119142 Ga0466964_0119142_83_565 147
70 3300044706 Ga0466964_0547623 Ga0466964_0547623_167_616 147
71 3300044719 Ga0466971_0009470 Ga0466971_0009470_2488_2937 147
72 3300044719 Ga0466971_0027233 Ga0466971_0027233_1983_2432 147
73 3300044719 Ga0466971_0177503 Ga0466971_0177503_440_889 147
74 3300044719 Ga0466971_0262225 Ga0466971_0262225_351_803 147
75 3300044719 Ga0466971_0409891 Ga0466971_0409891_183_632 147
76 3300044735 Ga0466968_0032107 Ga0466968_0032107_1398_1850 147
77 3300044735 Ga0466968_0065409 Ga0466968_0065409_26_481 147
78 3300044735 Ga0466968_0074283 Ga0466968_0074283_59_541 147
79 3300044735 Ga0466968_0099035 Ga0466968_0099035_785_1267 147
80 3300044735 Ga0466968_0352750 Ga0466968_0352750_211_660 147
81 3300044765 Ga0466970_0648633 Ga0466970_0648633_155_604 147
82 3300044842 Ga0466957_0011318 Ga0466957_0011318_4617_5066 147
83 3300044842 Ga0466957_0044730 Ga0466957_0044730_2150_2599 147
84 3300044842 Ga0466957_0318617 Ga0466957_0318617_211_660 147
85 3300044901 Ga0466960_0002350 Ga0466960_0002350_5975_6427 147
86 3300045049 Ga0466959_0073151 Ga0466959_0073151_654_1163 147
87 3300045049 Ga0466959_0081861 Ga0466959_0081861_1711_2160 147
88 3300045049 Ga0466959_0397062 Ga0466959_0397062_70_522 147
89 3300045049 Ga0466959_0431297 Ga0466959_0431297_313_795 147
90 3300045049 Ga0466959_0716921 Ga0466959_0716921_117_626 147
91 3300045836 Ga0466958_0002279 Ga0466958_0002279_8975_9424 147
92 3300045836 Ga0466958_0002937 Ga0466958_0002937_125_643 147
93 3300045836 Ga0466958_0008597 Ga0466958_0008597_1594_2076 147
94 3300045836 Ga0466958_0093491 Ga0466958_0093491_1330_1779 147
95 3300045836 Ga0466958_0218154 Ga0466958_0218154_135_584 147
96 3300045836 Ga0466958_0323825 Ga0466958_0323825_234_683 147
97 3300045836 Ga0466958_0808013 Ga0466958_0808013_15_464 147
98 3300045836 Ga0466958_1050377 Ga0466958_1050377_47_496 147
99 3300048907 Ga0496104_0742333 Ga0496104_0742333_296_745 147
100 3300048915 Ga0496112_0005000 Ga0496112_0005000_6253_6711 147
101 3300048917 Ga0496114_0621160 Ga0496114_0621160_156_611 147
102 3300050492 nmdc:mga0yw44_267763_c1 nmdc:mga0yw44_267763_c1_441_965 147
103 3300053085 Ga0495619_0488543 Ga0495619_0488543_161_640 147
104 3300061719 Ga0466962_0135844 Ga0466962_0135844_75_611 147
105 3300061719 Ga0466962_0138541 Ga0466962_0138541_508_957 147
106 3300061719 Ga0466962_0299363 Ga0466962_0299363_200_649 147
107 3300061719 Ga0466962_0419509 Ga0466962_0419509_23_472 147
108 3300005329 Ga0070683_100076167 Ga0070683_1000761673 148
109 3300005329 Ga0070683_101695067 Ga0070683_1016950671 148
110 3300005339 Ga0070660_100026882 Ga0070660_1000268822 148
111 3300005366 Ga0070659_100000002 Ga0070659_100000002175 148
112 3300005440 Ga0070705_100001484 Ga0070705_1000014844 148
113 3300005535 Ga0070684_100206191 Ga0070684_1002061912 148
114 3300025919 Ga0207657_10303826 Ga0207657_103038262 148
115 3300025932 Ga0207690_10000024 Ga0207690_10000024112 148
116 3300025944 Ga0207661_10177697 Ga0207661_101776972 148
117 3300025944 Ga0207661_10670456 Ga0207661_106704562 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04138

GtrA

GtrA-like protein

31

147

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.6633 28 148
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.5489 28 148
8jcy-assembly1.cif.gz_3 cryo-em structure of mglu2-mglu3 heterodimer in presence of ly341495, nam563, and ly2389575 (dimerization mode i) 0.504 58 141
7e6t-assembly1.cif.gz_B structural insights into the activation of human calcium-sensing receptor 0.4943 57 148
3qw1-assembly1.cif.gz_A crystal structure of the zn-ridc1 complex stabilized by bmh crosslinks 0.4893 36 142
ID Description Score Start End Superfamily
af_P9WMS9_2_118_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8018 32 146 1.10.287.70
af_P9WMS9_2_118_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7837 32 146 1.10.287.70
af_P77682_7_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7287 32 146 1.20.1280.290
af_P77682_7_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7179 32 146 1.20.1280.290
af_Q2FVI8_12_124_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6064 32 143 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A512DKJ7-F1-model_v4 GtrA/DPMS transmembrane domain-containing protein 0.9448 28 146 GO:0000271
GO:0005886
AF-A0A2N2UEB6-F1-model_v4 deleted 0.9395 26 143
AF-W9GUA8-F1-model_v4 GtrA/DPMS transmembrane domain-containing protein 0.9368 28 146 GO:0000271
GO:0005886
AF-A0A5E4NNR7-F1-model_v4 GtrA/DPMS transmembrane domain-containing protein 0.9341 39 146 GO:0000271
GO:0005886
AF-A0A1F5EET6-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9277 28 148 GO:0000271
GO:0004582
GO:0009247
GO:0016020

Feature Viewer

pLDDT pTM Quality
82.36 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map