F091066

General Info

Members Datasets Scaffolds Average Seq Length
117 68 117 243

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10012282|Ga0070658_100122828
Length 275
Sequence MCKTADRFRAGGGTSCQSDSTARSAGQWYHKHMNSYAPFTPKVALMVGAHADDIDFGASGTAAKWAKEGAEVHYLIVTDGSKGSSDPAMTSEKLVQIREQEQRAAAATLGAKEVHFLRYEDAMLEVTLPLKKDIVRVIRQVRPDTVVMMDPTAVYAVWNDMGFINHPDHRAAAQATLDAVFPLARDRLTFPDLFTQEHLEPHKVEHVLLINMRSDQTYYVDITDVFETKVHALLKHASQIPDPDSVRAILEQWASSAGTKTGTRYAEGFVRLDLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
63 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
64 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
65 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
66 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
67 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
68 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10119700 3300003320 Bacteria 1549
2 Ga0065707_10084221 3300005295 Bacteria 7503
3 Ga0070658_10000023 3300005327 Bacteria 185522
4 Ga0070658_10012282 3300005327 Bacteria 6877
5 Ga0070658_10380803 3300005327 Bacteria 1210
6 Ga0070660_100133726 3300005339 Bacteria 1986
7 Ga0070673_100000034 3300005364 Bacteria 59468
8 Ga0070688_100264142 3300005365 Bacteria 1230
9 Ga0070714_100266016 3300005435 Bacteria 1589
10 Ga0070705_100079613 3300005440 Bacteria 2007
11 Ga0070663_100088253 3300005455 Bacteria 2293
12 Ga0070678_100000287 3300005456 Bacteria 23360
13 Ga0068867_100019080 3300005459 Bacteria 4883
14 Ga0070685_10000773 3300005466 Bacteria 17396
15 Ga0070706_100078339 3300005467 Bacteria 3060
16 Ga0070707_100684081 3300005468 Unclassified 989
17 Ga0068853_100008226 3300005539 Bacteria 8373
18 Ga0070672_100068343 3300005543 Unclassified 2818
19 Ga0070704_100101873 3300005549 Bacteria 2165
20 Ga0068856_100041634 3300005614 Bacteria 4515
21 Ga0070702_100361133 3300005615 Bacteria 1026
22 Ga0068865_100009383 3300006881 Bacteria 6066
23 Ga0105240_10000003 3300009093 Bacteria 1183681
24 Ga0111539_10074083 3300009094 Unclassified 4012
25 Ga0105245_10000618 3300009098 Bacteria 32225
26 Ga0105245_10143914 3300009098 Bacteria 2248
27 Ga0114129_10555735 3300009147 Bacteria 1492
28 Ga0105243_10000001 3300009148 Bacteria 1156578
29 Ga0105242_10000001 3300009176 Bacteria 574039
30 Ga0105242_10051283 3300009176 Unclassified 3362
31 Ga0105237_10020750 3300009545 Bacteria 6767
32 Ga0105239_10013631 3300010375 Bacteria 9025
33 Ga0105239_10079801 3300010375 Bacteria 3601
34 Ga0105239_10257636 3300010375 Bacteria 1960
35 Ga0105246_10160214 3300011119 Bacteria 1713
36 Ga0157374_10000056 3300013296 Bacteria 117163
37 Ga0157374_10162860 3300013296 Bacteria 2173
38 Ga0157374_10269422 3300013296 Bacteria 1679
39 Ga0157374_10288926 3300013296 Bacteria 1620
40 Ga0157378_10140637 3300013297 Bacteria 2241
41 Ga0157378_10344498 3300013297 Unclassified 1454
42 Ga0163162_10073810 3300013306 Bacteria 3468
43 Ga0157372_10000194 3300013307 Bacteria 66925
44 Ga0157376_10000001 3300014969 Bacteria 842910
45 Ga0207705_10000414 3300025909 Bacteria 37511
46 Ga0207695_10000005 3300025913 Bacteria 1196715
47 Ga0207671_10010176 3300025914 Bacteria 7787
48 Ga0207657_10132657 3300025919 Bacteria 2040
49 Ga0207646_10530167 3300025922 Unclassified 1060
50 Ga0207687_10002895 3300025927 Bacteria 11654
51 Ga0207686_10000001 3300025934 Bacteria 1169580
52 Ga0207709_10000002 3300025935 Bacteria 1171536
53 Ga0207709_10221121 3300025935 Bacteria 1366
54 Ga0207704_10014025 3300025938 Bacteria 4035
55 Ga0207691_10044010 3300025940 Bacteria 4111
56 Ga0207651_10000360 3300025960 Bacteria 19280
57 Ga0207639_10002495 3300026041 Bacteria 12331
58 Ga0207648_10068662 3300026089 Bacteria 3088
59 Ga0207683_10070487 3300026121 Bacteria 3088
60 Ga0265334_10000032 3300028573 Bacteria 107258
61 Ga0265322_10067926 3300028654 Unclassified 1011
62 Ga0265338_10000192 3300028800 Bacteria 115195
63 Ga0265338_10251882 3300028800 Bacteria 1302
64 Ga0265340_10000126 3300031247 Bacteria 37983
65 Ga0265340_10001211 3300031247 Bacteria 14774
66 Ga0265327_10007112 3300031251 Bacteria 8739
67 Ga0265316_10322480 3300031344 Unclassified 1122
68 Ga0316584_0267926 3300036712 Unclassified 1244
69 Ga0451577_0006702 3300042876 Bacteria 11430
70 Ga0451577_0011960 3300042876 Bacteria 8177
71 Ga0451577_0020038 3300042876 Bacteria 6142
72 Ga0451577_0037250 3300042876 Bacteria 4379
73 Ga0451577_0044027 3300042876 Bacteria 3996
74 Ga0451577_0172654 3300042876 Unclassified 1948
75 Ga0451577_0302235 3300042876 Unclassified 1450
76 Ga0451577_0467105 3300042876 Bacteria 1146
77 Ga0453683_0070669 3300044673 Bacteria 2183
78 Ga0453683_0285604 3300044673 Unclassified 1054
79 Ga0453684_0000012 3300044712 Bacteria 1062512
80 Ga0453684_0000023 3300044712 Bacteria 857153
81 Ga0453684_0000894 3300044712 Bacteria 99515
82 Ga0453684_0001638 3300044712 Bacteria 60803
83 Ga0453684_0004809 3300044712 Bacteria 27793
84 Ga0453684_0006719 3300044712 Bacteria 21689
85 Ga0453684_0008693 3300044712 Bacteria 18063
86 Ga0453684_0014678 3300044712 Bacteria 12491
87 Ga0453684_0019807 3300044712 Bacteria 10208
88 Ga0453684_0020891 3300044712 Bacteria 9826
89 Ga0453684_0022215 3300044712 Bacteria 9428
90 Ga0453684_0030058 3300044712 Bacteria 7688
91 Ga0453684_0094865 3300044712 Unclassified 3669
92 Ga0453684_0122572 3300044712 Bacteria 3136
93 Ga0453684_0128544 3300044712 Unclassified 3044
94 Ga0453684_0142105 3300044712 Bacteria 2864
95 Ga0453684_0148842 3300044712 Bacteria 2785
96 Ga0453684_0216532 3300044712 Unclassified 2221
97 Ga0453684_0241257 3300044712 Unclassified 2080
98 Ga0453684_0250402 3300044712 Unclassified 2034
99 Ga0453684_0266925 3300044712 Bacteria 1958
100 Ga0453684_0299484 3300044712 Bacteria 1828
101 Ga0453684_0481627 3300044712 Bacteria 1376
102 Ga0453684_0662238 3300044712 Bacteria 1138
103 Ga0451576_0000263 3300045051 Bacteria 128339
104 Ga0451576_0034298 3300045051 Bacteria 5391
105 Ga0451576_0294152 3300045051 Bacteria 1698
106 Ga0451576_0346290 3300045051 Unclassified 1556
107 Ga0451576_0612219 3300045051 Bacteria 1145
108 Ga0451576_0755260 3300045051 Unclassified 1021
109 Ga0495672_0052620 3300047320 Unclassified 2391
110 Ga0501034_0222561 3300049571 Bacteria 1839
111 Ga0501073_0047886 3300049589 Bacteria 3003
112 Ga0501074_0162847 3300049590 Bacteria 1593
113 Ga0501075_0055942 3300049591 Unclassified 2969
114 Ga0501076_0006211 3300049592 Bacteria 8647
115 Ga0501084_0019828 3300054114 Bacteria 5605
116 Ga0501082_0614587 3300060353 Bacteria 951
117 Ga0530510_0066537 3300061734 Bacteria 2613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0006702 Ga0451577_0006702_3404_4168 222
2 3300044712 Ga0453684_0006719 Ga0453684_0006719_3866_4630 222
3 3300044712 Ga0453684_0008693 Ga0453684_0008693_13762_14526 222
4 3300044712 Ga0453684_0022215 Ga0453684_0022215_7484_8215 222
5 3300044712 Ga0453684_0266925 Ga0453684_0266925_406_1131 222
6 3300042876 Ga0451577_0467105 Ga0451577_0467105_220_951 223
7 3300044712 Ga0453684_0250402 Ga0453684_0250402_1043_1783 223
8 3300044712 Ga0453684_0662238 Ga0453684_0662238_35_772 223
9 3300045051 Ga0451576_0755260 Ga0451576_0755260_155_886 223
10 3300042876 Ga0451577_0172654 Ga0451577_0172654_170_898 226
11 3300044712 Ga0453684_0000023 Ga0453684_0000023_547717_548445 226
12 3300013296 Ga0157374_10000056 Ga0157374_10000056102 231
13 3300005440 Ga0070705_100079613 Ga0070705_1000796132 234
14 3300005467 Ga0070706_100078339 Ga0070706_1000783393 234
15 3300005468 Ga0070707_100684081 Ga0070707_1006840811 234
16 3300005549 Ga0070704_100101873 Ga0070704_1001018733 234
17 3300005615 Ga0070702_100361133 Ga0070702_1003611332 234
18 3300009094 Ga0111539_10074083 Ga0111539_100740833 234
19 3300009147 Ga0114129_10555735 Ga0114129_105557352 234
20 3300011119 Ga0105246_10160214 Ga0105246_101602142 234
21 3300025922 Ga0207646_10530167 Ga0207646_105301672 234
22 3300025935 Ga0207709_10221121 Ga0207709_102211212 234
23 3300028654 Ga0265322_10067926 Ga0265322_100679261 234
24 3300028800 Ga0265338_10251882 Ga0265338_102518821 234
25 3300031247 Ga0265340_10001211 Ga0265340_100012112 234
26 3300031251 Ga0265327_10007112 Ga0265327_100071124 234
27 3300031344 Ga0265316_10322480 Ga0265316_103224801 234
28 3300036712 Ga0316584_0267926 Ga0316584_0267926_145_885 234
29 3300042876 Ga0451577_0020038 Ga0451577_0020038_3871_4605 234
30 3300044673 Ga0453683_0070669 Ga0453683_0070669_987_1721 234
31 3300044712 Ga0453684_0000012 Ga0453684_0000012_748176_748910 234
32 3300044712 Ga0453684_0128544 Ga0453684_0128544_1588_2322 234
33 3300045051 Ga0451576_0346290 Ga0451576_0346290_548_1282 234
34 3300049590 Ga0501074_0162847 Ga0501074_0162847_690_1424 234
35 3300049591 Ga0501075_0055942 Ga0501075_0055942_2030_2764 234
36 3300049592 Ga0501076_0006211 Ga0501076_0006211_4221_4955 234
37 3300054114 Ga0501084_0019828 Ga0501084_0019828_1627_2361 234
38 3300060353 Ga0501082_0614587 Ga0501082_0614587_148_882 234
39 3300061734 Ga0530510_0066537 Ga0530510_0066537_465_1199 234
40 3300044712 Ga0453684_0148842 Ga0453684_0148842_73_816 235
41 3300045051 Ga0451576_0000263 Ga0451576_0000263_70819_71556 235
42 3300005295 Ga0065707_10084221 Ga0065707_100842215 236
43 3300042876 Ga0451577_0011960 Ga0451577_0011960_3064_3804 236
44 3300042876 Ga0451577_0037250 Ga0451577_0037250_1344_2084 236
45 3300042876 Ga0451577_0044027 Ga0451577_0044027_1317_2057 236
46 3300042876 Ga0451577_0302235 Ga0451577_0302235_249_992 236
47 3300044673 Ga0453683_0285604 Ga0453683_0285604_235_966 236
48 3300044712 Ga0453684_0000894 Ga0453684_0000894_32386_33129 236
49 3300044712 Ga0453684_0001638 Ga0453684_0001638_53156_53896 236
50 3300044712 Ga0453684_0004809 Ga0453684_0004809_4062_4802 236
51 3300044712 Ga0453684_0019807 Ga0453684_0019807_5062_5808 236
52 3300044712 Ga0453684_0020891 Ga0453684_0020891_682_1425 236
53 3300044712 Ga0453684_0030058 Ga0453684_0030058_3079_3819 236
54 3300044712 Ga0453684_0094865 Ga0453684_0094865_166_909 236
55 3300044712 Ga0453684_0122572 Ga0453684_0122572_2049_2789 236
56 3300044712 Ga0453684_0142105 Ga0453684_0142105_843_1583 236
57 3300044712 Ga0453684_0216532 Ga0453684_0216532_285_1043 236
58 3300044712 Ga0453684_0241257 Ga0453684_0241257_889_1650 236
59 3300044712 Ga0453684_0299484 Ga0453684_0299484_229_972 236
60 3300044712 Ga0453684_0481627 Ga0453684_0481627_35_793 236
61 3300045051 Ga0451576_0034298 Ga0451576_0034298_3091_3831 236
62 3300045051 Ga0451576_0294152 Ga0451576_0294152_281_1021 236
63 3300044712 Ga0453684_0014678 Ga0453684_0014678_3167_3964 237
64 3300045051 Ga0451576_0612219 Ga0451576_0612219_334_1086 237
65 3300005435 Ga0070714_100266016 Ga0070714_1002660162 238
66 3300009098 Ga0105245_10143914 Ga0105245_101439142 238
67 3300010375 Ga0105239_10079801 Ga0105239_100798014 238
68 3300013296 Ga0157374_10269422 Ga0157374_102694223 238
69 3300013307 Ga0157372_10000194 Ga0157372_1000019444 238
70 3300049589 Ga0501073_0047886 Ga0501073_0047886_811_1563 238
71 3300005327 Ga0070658_10380803 Ga0070658_103808031 239
72 3300005539 Ga0068853_100008226 Ga0068853_1000082261 239
73 3300005614 Ga0068856_100041634 Ga0068856_1000416345 239
74 3300013296 Ga0157374_10288926 Ga0157374_102889263 239
75 3300026041 Ga0207639_10002495 Ga0207639_1000249512 239
76 3300028573 Ga0265334_10000032 Ga0265334_1000003266 239
77 3300028800 Ga0265338_10000192 Ga0265338_1000019234 239
78 3300031247 Ga0265340_10000126 Ga0265340_1000012615 239
79 3300049571 Ga0501034_0222561 Ga0501034_0222561_862_1593 239
80 3300005327 Ga0070658_10012282 Ga0070658_100122828 240
81 3300014969 Ga0157376_10000001 Ga0157376_10000001759 240
82 3300003320 rootH2_10119700 rootH2_101197002 241
83 3300005327 Ga0070658_10000023 Ga0070658_10000023117 241
84 3300005339 Ga0070660_100133726 Ga0070660_1001337261 241
85 3300005364 Ga0070673_100000034 Ga0070673_10000003428 241
86 3300005365 Ga0070688_100264142 Ga0070688_1002641421 241
87 3300005455 Ga0070663_100088253 Ga0070663_1000882531 241
88 3300005456 Ga0070678_100000287 Ga0070678_10000028722 241
89 3300005459 Ga0068867_100019080 Ga0068867_1000190802 241
90 3300005466 Ga0070685_10000773 Ga0070685_1000077316 241
91 3300005543 Ga0070672_100068343 Ga0070672_1000683434 241
92 3300006881 Ga0068865_100009383 Ga0068865_1000093837 241
93 3300009093 Ga0105240_10000003 Ga0105240_10000003150 241
94 3300009098 Ga0105245_10000618 Ga0105245_100006183 241
95 3300009148 Ga0105243_10000001 Ga0105243_100000011100 241
96 3300009176 Ga0105242_10000001 Ga0105242_10000001158 241
97 3300009176 Ga0105242_10051283 Ga0105242_100512834 241
98 3300009545 Ga0105237_10020750 Ga0105237_100207509 241
99 3300010375 Ga0105239_10013631 Ga0105239_100136313 241
100 3300010375 Ga0105239_10257636 Ga0105239_102576362 241
101 3300013296 Ga0157374_10162860 Ga0157374_101628603 241
102 3300013297 Ga0157378_10140637 Ga0157378_101406372 241
103 3300013297 Ga0157378_10344498 Ga0157378_103444982 241
104 3300013306 Ga0163162_10073810 Ga0163162_100738104 241
105 3300025909 Ga0207705_10000414 Ga0207705_1000041413 241
106 3300025913 Ga0207695_10000005 Ga0207695_10000005157 241
107 3300025914 Ga0207671_10010176 Ga0207671_100101762 241
108 3300025919 Ga0207657_10132657 Ga0207657_101326573 241
109 3300025927 Ga0207687_10002895 Ga0207687_100028953 241
110 3300025934 Ga0207686_10000001 Ga0207686_1000000140 241
111 3300025935 Ga0207709_10000002 Ga0207709_10000002157 241
112 3300025938 Ga0207704_10014025 Ga0207704_100140253 241
113 3300025940 Ga0207691_10044010 Ga0207691_100440106 241
114 3300025960 Ga0207651_10000360 Ga0207651_1000036016 241
115 3300026089 Ga0207648_10068662 Ga0207648_100686621 241
116 3300026121 Ga0207683_10070487 Ga0207683_100704872 241
117 3300047320 Ga0495672_0052620 Ga0495672_0052620_465_1196 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

45

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.927 10 238
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9253 10 239
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9216 10 239
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8698 10 236
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.866 4 238
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9024 10 239 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8931 4 238 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8698 10 236 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8688 4 238 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8608 12 236 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A383B785-F1-model_v4 PIG-L family deacetylase 0.9798 11 111 GO:0016811
AF-A0A6L7YEN7-F1-model_v4 PIG-L family deacetylase 0.9717 11 155 GO:0016811
AF-A0A533SUN0-F1-model_v4 PIG-L family deacetylase 0.9706 15 154 GO:0016811
AF-A0A7C3M1J2-F1-model_v4 PIG-L family deacetylase 0.9704 7 120 GO:0016811
AF-A0A3N5VMX8-F1-model_v4 PIG-L family deacetylase 0.9699 11 241 GO:0016811

Feature Viewer

pLDDT pTM Quality
92.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map