F073219

General Info

Members Datasets Scaffolds Average Seq Length
113 95 104 335

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10160806|Ga0081455_101608062
Length 389
Sequence LPLEATPGIIEQGVRSNNGRETLAEQEFESRNRGLFEYRLSRSTPGPYNPRAMSVIEIENLSKTYRVYQKREGLGASIRGLFQREYKEVHAVKSIDLTVEAGEFVAFLGPNGAGKTTTLKLLSGVITPTSGAAHVMGHIPWKRENAYRRRFALVMGQKNQLWWDLPAQESFRLHQEIYRIEPQQFDRTRDELVDLLDVKKLLGQPVRELSLGERMKMELIAALLHSPEVLFLDEPTIGLDVVAQHNVQLFLRQYQQLRKITILLTSHYMKDIAALCRRVVVIAHGKIMYDGSLSGIVDRFSGHKIVSLQLADNNMNGDWQRYGELIEQQAPTVRLRIARDVVPEVLAAILANHQIEDVSVEDPPLEEVIAEMFSQANKESESEAMVTKS

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
3 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
4 2671180694 Paenibacillus sp. A3 Isolate Unclassified
5 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
6 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
7 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
8 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
9 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
73 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
74 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.27
Metatranscriptomes 1.77
Isolates 7.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 0
Rhizoplane 1.77
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10076455 3300005290 Bacteria 3657
2 Ga0065707_10084666 3300005295 Bacteria 6914
3 Ga0070658_10001631 3300005327 Bacteria 18975
4 Ga0070666_10000916 3300005335 Bacteria 17886
5 Ga0070680_100133960 3300005336 Bacteria 2074
6 Ga0070660_100101745 3300005339 Bacteria 2277
7 Ga0070667_100070279 3300005367 Bacteria 2980
8 Ga0070714_100264721 3300005435 Bacteria 1593
9 Ga0070681_10014395 3300005458 Bacteria 7872
10 Ga0070665_100000384 3300005548 Bacteria 65257
11 Ga0068855_100110076 3300005563 Bacteria 3162
12 Ga0068855_100368883 3300005563 Bacteria 1579
13 Ga0068852_100023850 3300005616 Bacteria 4933
14 Ga0068858_100010206 3300005842 Bacteria 8913
15 Ga0068858_100358698 3300005842 Bacteria 1397
16 Ga0081455_10160806 3300005937 Bacteria 1721
17 Ga0075368_10050925 3300006042 Bacteria 1646
18 Ga0075363_100039256 3300006048 Bacteria 2491
19 Ga0075364_10162436 3300006051 Bacteria 1508
20 Ga0075428_100005431 3300006844 Bacteria 14162
21 Ga0099795_10002336 3300007788 Bacteria 4435
22 Ga0105240_10036575 3300009093 Bacteria 6313
23 Ga0105240_10093080 3300009093 Bacteria 3679
24 Ga0114129_10837545 3300009147 Bacteria 1171
25 Ga0105241_10256430 3300009174 Bacteria 1485
26 Ga0105248_10145463 3300009177 Bacteria 2675
27 Ga0105238_10001370 3300009551 Bacteria 24428
28 Ga0099796_10003715 3300010159 Bacteria 3588
29 Ga0157370_10115938 3300013104 Bacteria 2502
30 Ga0157369_10131982 3300013105 Bacteria 2646
31 Ga0157372_10108814 3300013307 Bacteria 3173
32 Ga0163163_10334492 3300014325 Bacteria 1569
33 Ga0157379_10003311 3300014968 Bacteria 13644
34 Ga0213872_10005241 3300021361 Bacteria 6706
35 Ga0207705_10002931 3300025909 Bacteria 13043
36 Ga0207707_10019656 3300025912 Bacteria 5895
37 Ga0207695_10010460 3300025913 Bacteria 11347
38 Ga0207695_10030703 3300025913 Bacteria 5913
39 Ga0207693_10255505 3300025915 Bacteria 1375
40 Ga0207660_10083997 3300025917 Bacteria 2346
41 Ga0207657_10125515 3300025919 Bacteria 2108
42 Ga0207694_10116992 3300025924 Bacteria 2125
43 Ga0207711_10286908 3300025941 Bacteria 1517
44 Ga0207667_10049645 3300025949 Bacteria 4431
45 Ga0207667_10079253 3300025949 Bacteria 3404
46 Ga0207703_10391477 3300026035 Bacteria 1287
47 Ga0207639_10074865 3300026041 Bacteria 2660
48 Ga0207648_10062094 3300026089 Bacteria 3258
49 Ga0207698_10273207 3300026142 Bacteria 1559
50 Ga0268266_10000449 3300028379 Bacteria 61064
51 Ga0265338_10038743 3300028800 Bacteria 4509
52 Ga0265338_10046239 3300028800 Bacteria 3990
53 Ga0265762_1003822 3300030760 Bacteria 2695
54 Ga0265760_10009120 3300031090 Bacteria 2835
55 Ga0265332_10008674 3300031238 Bacteria 4557
56 Ga0265325_10000417 3300031241 Bacteria 30411
57 Ga0265325_10072882 3300031241 Bacteria 1720
58 Ga0265339_10002731 3300031249 Bacteria 12534
59 Ga0265339_10015292 3300031249 Bacteria 4603
60 Ga0265331_10000528 3300031250 Bacteria 35195
61 Ga0265316_10028436 3300031344 Bacteria 4613
62 Ga0265313_10028010 3300031595 Bacteria 2937
63 Ga0265314_10002195 3300031711 Bacteria 20385
64 Ga0265314_10025227 3300031711 Bacteria 4490
65 Ga0265314_10032592 3300031711 Bacteria 3831
66 Ga0265342_10003827 3300031712 Bacteria 12118
67 Ga0373937_0131503 3300036401 Bacteria 2337
68 Ga0395899_0173228 3300037312 Bacteria 1518
69 Ga0436365_1737837 3300039437 Bacteria 7142
70 Ga0436361_1110998 3300039447 Bacteria 21889
71 Ga0439462_0001939 3300042015 Bacteria 4722
72 Ga0495630_0119378 3300046517 Bacteria 2000
73 Ga0495656_0015325 3300046615 Bacteria 2892
74 Ga0495589_0088810 3300046794 Bacteria 1501
75 Ga0495672_0110649 3300047320 Bacteria 1475
76 Ga0495684_0235611 3300047471 Bacteria 1337
77 Ga0496114_0414923 3300048917 Bacteria 1192
78 Ga0496115_0187685 3300048918 Bacteria 1708
79 Ga0496116_0054948 3300048919 Bacteria 2619
80 Ga0501034_0008834 3300049571 Bacteria 10596
81 Ga0501034_0009567 3300049571 Bacteria 10143
82 Ga0501034_0020519 3300049571 Bacteria 6747
83 Ga0501034_0068846 3300049571 Bacteria 3550
84 Ga0501034_0078545 3300049571 Bacteria 3304
85 Ga0501034_0094966 3300049571 Bacteria 2978
86 Ga0501039_0253916 3300049575 Bacteria 1382
87 Ga0501042_0216036 3300049578 Bacteria 1383
88 Ga0501043_0011370 3300049579 Bacteria 6967
89 Ga0501046_0009827 3300049580 Bacteria 8250
90 Ga0501046_0218310 3300049580 Bacteria 1413
91 Ga0501047_0154805 3300049581 Bacteria 2166
92 Ga0501068_0222907 3300049584 Bacteria 1199
93 Ga0501070_0000546 3300049586 Bacteria 34402
94 Ga0501083_0030513 3300049744 Bacteria 3704
95 Ga0501044_0014225 3300049823 Bacteria 8594
96 Ga0501044_0166927 3300049823 Bacteria 2175
97 nmdc:mga03n38_15633_c1 3300050490 Bacteria 2933
98 nmdc:mga00v17_120420_c1 3300050491 Bacteria 1670
99 nmdc:mga0k408_70537_c1 3300050493 Bacteria 2039
100 nmdc:mga06z11_58888_c1 3300050494 Bacteria 1994
101 Ga0495619_0041280 3300053085 Archaea 3018
102 Ga0495619_0249443 3300053085 Bacteria 1230
103 Ga0500643_000592 3300053087 Bacteria 24859
104 Ga0501084_0278243 3300054114 Bacteria 1413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_70537_c1 nmdc:mga0k408_70537_c1_75_1085 306
2 3300046794 Ga0495589_0088810 Ga0495589_0088810_74_1015 307
3 3300037312 Ga0395899_0173228 Ga0395899_0173228_356_1345 308
4 3300049571 Ga0501034_0020519 Ga0501034_0020519_178_1194 313
5 3300049823 Ga0501044_0014225 Ga0501044_0014225_475_1491 313
6 3300028800 Ga0265338_10038743 Ga0265338_100387432 318
7 3300049579 Ga0501043_0011370 Ga0501043_0011370_5148_6173 321
8 3300049580 Ga0501046_0009827 Ga0501046_0009827_1629_2654 321
9 3300005335 Ga0070666_10000916 Ga0070666_100009164 322
10 3300005336 Ga0070680_100133960 Ga0070680_1001339601 322
11 3300005367 Ga0070667_100070279 Ga0070667_1000702793 322
12 3300005458 Ga0070681_10014395 Ga0070681_100143956 322
13 3300005563 Ga0068855_100110076 Ga0068855_1001100762 322
14 3300005563 Ga0068855_100368883 Ga0068855_1003688832 322
15 3300005616 Ga0068852_100023850 Ga0068852_1000238506 322
16 3300009093 Ga0105240_10093080 Ga0105240_100930804 322
17 3300009177 Ga0105248_10145463 Ga0105248_101454632 322
18 3300013104 Ga0157370_10115938 Ga0157370_101159382 322
19 3300013105 Ga0157369_10131982 Ga0157369_101319822 322
20 3300013307 Ga0157372_10108814 Ga0157372_101088143 322
21 3300025912 Ga0207707_10019656 Ga0207707_100196564 322
22 3300025913 Ga0207695_10030703 Ga0207695_100307032 322
23 3300025917 Ga0207660_10083997 Ga0207660_100839971 322
24 3300025941 Ga0207711_10286908 Ga0207711_102869082 322
25 3300025949 Ga0207667_10079253 Ga0207667_100792533 322
26 3300026142 Ga0207698_10273207 Ga0207698_102732072 322
27 3300028800 Ga0265338_10046239 Ga0265338_100462391 322
28 3300031249 Ga0265339_10015292 Ga0265339_100152923 322
29 3300031344 Ga0265316_10028436 Ga0265316_100284363 322
30 3300031595 Ga0265313_10028010 Ga0265313_100280103 322
31 3300031711 Ga0265314_10025227 Ga0265314_100252272 322
32 3300031711 Ga0265314_10032592 Ga0265314_100325924 322
33 3300039437 Ga0436365_1737837 Ga0436365_1737837_3732_4706 322
34 3300047471 Ga0495684_0235611 Ga0495684_0235611_22_996 322
35 3300053087 Ga0500643_000592 Ga0500643_000592_18100_19077 322
36 iso_pu_bacteria 2671180694 2673819789 322
37 3300025915 Ga0207693_10255505 Ga0207693_102555052 323
38 3300036401 Ga0373937_0131503 Ga0373937_0131503_498_1478 323
39 3300053085 Ga0495619_0249443 Ga0495619_0249443_22_1002 323
40 3300005842 Ga0068858_100010206 Ga0068858_1000102068 325
41 3300009093 Ga0105240_10036575 Ga0105240_100365754 325
42 3300009174 Ga0105241_10256430 Ga0105241_102564302 325
43 3300009551 Ga0105238_10001370 Ga0105238_100013707 325
44 3300014968 Ga0157379_10003311 Ga0157379_100033117 325
45 3300021361 Ga0213872_10005241 Ga0213872_100052413 325
46 3300025913 Ga0207695_10010460 Ga0207695_1001046011 325
47 3300026035 Ga0207703_10391477 Ga0207703_103914772 325
48 3300039447 Ga0436361_1110998 Ga0436361_1110998_1386_2372 325
49 3300007788 Ga0099795_10002336 Ga0099795_100023364 326
50 3300010159 Ga0099796_10003715 Ga0099796_100037152 326
51 3300025924 Ga0207694_10116992 Ga0207694_101169922 326
52 3300049571 Ga0501034_0009567 Ga0501034_0009567_5067_6116 326
53 3300049571 Ga0501034_0068846 Ga0501034_0068846_2072_3052 326
54 3300050494 nmdc:mga06z11_58888_c1 nmdc:mga06z11_58888_c1_961_1950 326
55 3300053085 Ga0495619_0041280 Ga0495619_0041280_469_1521 326
56 iso_pu_bacteria 2512564039 2512735710 326
57 iso_pu_bacteria 2576861424 2578336113 326
58 iso_pu_bacteria 2593339198 2595320215 326
59 iso_pu_bacteria 2904755435 2904757039 326
60 iso_pu_bacteria 2971511577 2971515165 326
61 iso_pu_bacteria 2980176882 2980181260 326
62 3300005327 Ga0070658_10001631 Ga0070658_1000163115 327
63 3300005339 Ga0070660_100101745 Ga0070660_1001017452 327
64 3300025909 Ga0207705_10002931 Ga0207705_100029317 327
65 3300025919 Ga0207657_10125515 Ga0207657_101255151 327
66 iso_pu_bacteria 2925326138 2925332423 327
67 3300005295 Ga0065707_10084666 Ga0065707_100846662 328
68 3300014325 Ga0163163_10334492 Ga0163163_103344922 328
69 3300030760 Ga0265762_1003822 Ga0265762_10038222 329
70 3300026089 Ga0207648_10062094 Ga0207648_100620942 330
71 3300042015 Ga0439462_0001939 Ga0439462_0001939_3573_4643 330
72 3300046615 Ga0495656_0015325 Ga0495656_0015325_1739_2755 330
73 3300048919 Ga0496116_0054948 Ga0496116_0054948_716_1720 330
74 3300005290 Ga0065712_10076455 Ga0065712_100764552 331
75 3300005435 Ga0070714_100264721 Ga0070714_1002647211 331
76 3300005548 Ga0070665_100000384 Ga0070665_10000038438 331
77 3300005842 Ga0068858_100358698 Ga0068858_1003586982 331
78 3300005937 Ga0081455_10160806 Ga0081455_101608062 331
79 3300006042 Ga0075368_10050925 Ga0075368_100509252 331
80 3300006048 Ga0075363_100039256 Ga0075363_1000392562 331
81 3300006051 Ga0075364_10162436 Ga0075364_101624362 331
82 3300006844 Ga0075428_100005431 Ga0075428_1000054313 331
83 3300009147 Ga0114129_10837545 Ga0114129_108375452 331
84 3300025949 Ga0207667_10049645 Ga0207667_100496452 331
85 3300026041 Ga0207639_10074865 Ga0207639_100748651 331
86 3300028379 Ga0268266_10000449 Ga0268266_1000044926 331
87 3300031090 Ga0265760_10009120 Ga0265760_100091202 331
88 3300031238 Ga0265332_10008674 Ga0265332_100086744 331
89 3300031241 Ga0265325_10000417 Ga0265325_1000041716 331
90 3300031241 Ga0265325_10072882 Ga0265325_100728822 331
91 3300031249 Ga0265339_10002731 Ga0265339_100027311 331
92 3300031250 Ga0265331_10000528 Ga0265331_1000052820 331
93 3300031711 Ga0265314_10002195 Ga0265314_1000219511 331
94 3300031712 Ga0265342_10003827 Ga0265342_100038274 331
95 3300046517 Ga0495630_0119378 Ga0495630_0119378_29_1048 331
96 3300047320 Ga0495672_0110649 Ga0495672_0110649_89_1162 331
97 3300048917 Ga0496114_0414923 Ga0496114_0414923_147_1145 331
98 3300048918 Ga0496115_0187685 Ga0496115_0187685_273_1307 331
99 3300049571 Ga0501034_0008834 Ga0501034_0008834_1395_2399 331
100 3300049571 Ga0501034_0078545 Ga0501034_0078545_873_1889 331
101 3300049571 Ga0501034_0094966 Ga0501034_0094966_815_1828 331
102 3300049575 Ga0501039_0253916 Ga0501039_0253916_277_1293 331
103 3300049578 Ga0501042_0216036 Ga0501042_0216036_118_1188 331
104 3300049580 Ga0501046_0218310 Ga0501046_0218310_209_1279 331
105 3300049581 Ga0501047_0154805 Ga0501047_0154805_426_1451 331
106 3300049584 Ga0501068_0222907 Ga0501068_0222907_78_1094 331
107 3300049586 Ga0501070_0000546 Ga0501070_0000546_14144_15169 331
108 3300049744 Ga0501083_0030513 Ga0501083_0030513_2357_3367 331
109 3300049823 Ga0501044_0166927 Ga0501044_0166927_723_1748 331
110 3300050490 nmdc:mga03n38_15633_c1 nmdc:mga03n38_15633_c1_679_1716 331
111 3300050491 nmdc:mga00v17_120420_c1 nmdc:mga00v17_120420_c1_274_1278 331
112 3300054114 Ga0501084_0278243 Ga0501084_0278243_100_1170 331
113 iso_pu_bacteria 2687453341 2688391203 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

92

237

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

164

268

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8664 3 248
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.8604 1 240
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8553 2 245
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.845 1 240
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.8428 1 247
ID Description Score Start End Superfamily
af_A4HRM7_1245_1429_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9006 66 247 3.40.50.300
af_Q9W252_1046_1302_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8987 156 223 3.40.50.300
af_E9PWJ7_506_745_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8957 1 248 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8902 1 247 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8898 2 248 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.91 4 244 GO:0005524
GO:0016887
AF-T1AXD9-F1-model_v4 ABC transporter, ATP-binding protein 0.9019 98 245 GO:0005524
GO:0016887
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.8992 1 247 GO:0005524
GO:0005886
GO:0016887
AF-A0A7I7SA04-F1-model_v4 deleted 0.8941 38 248
AF-A0A3M1J999-F1-model_v4 ABC transporter ATP-binding protein 0.8859 2 248 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
85.89 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map