F028495

General Info

Members Datasets Scaffolds Average Seq Length
104 86 80 138

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0141611|Ga0495626_0141611_15_473
Length 152
Sequence MIITFQKEFKKMYTKPLVYFLCTGNSCRSQIADGFLNAIGGDKFEVKSAGLEAHGLNPRAIQVMEEAGIDISGNSSDVINPEILNRATYVITLCGHADEHCPAIMNPNVIKWHWGFDDPAKATGTEEEIMEQFRTVRDSIKARIEQFVINGE

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
3 2671180694 Paenibacillus sp. A3 Isolate Unclassified
4 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
5 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
6 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
7 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
8 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
9 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
10 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
13 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
14 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
15 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
16 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
17 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
18 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
19 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
81 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
82 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
83 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
84 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
85 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
86 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0
Isolates 23.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.42
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 58.65
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1032712 3300002987 Bacteria 820
2 rootH2_10302202 3300003320 Bacteria 2079
3 rootH1_10030020 3300003323 Bacteria 1883
4 rootH1_10245346 3300003323 Bacteria 1558
5 rootH1_10385986 3300003323 Bacteria 2299
6 JGI25160J50197_1042054 3300003354 Bacteria 1043
7 Ga0055541_1001108 3300003841 Bacteria 6095
8 Ga0065712_10789498 3300005290 Unclassified 516
9 Ga0070677_10338246 3300005333 Bacteria 776
10 Ga0068868_102308670 3300005338 Unclassified 513
11 Ga0070675_100963816 3300005354 Unclassified 783
12 Ga0070678_101692156 3300005456 Bacteria 595
13 Ga0068855_100038887 3300005563 Bacteria 5650
14 Ga0068857_100021639 3300005577 Bacteria 5658
15 Ga0068856_100014383 3300005614 Bacteria 7648
16 Ga0068856_102008472 3300005614 Bacteria 588
17 Ga0068859_102224199 3300005617 Unclassified 605
18 Ga0068866_10010040 3300005718 Bacteria 4047
19 Ga0068861_100433493 3300005719 Bacteria 1174
20 Ga0075367_11028238 3300006178 Bacteria 526
21 Ga0075366_10528424 3300006195 Bacteria 730
22 Ga0075366_11060293 3300006195 Bacteria 506
23 Ga0097621_100823231 3300006237 Bacteria 861
24 Ga0097621_101613708 3300006237 Bacteria 617
25 Ga0097620_102225387 3300006931 Unclassified 605
26 Ga0105240_10566950 3300009093 Bacteria 1254
27 Ga0105241_10130054 3300009174 Bacteria 2037
28 Ga0105237_10055032 3300009545 Bacteria 3985
29 Ga0105237_10193851 3300009545 Bacteria 2031
30 Ga0105239_10025119 3300010375 Bacteria 6562
31 Ga0105239_10714181 3300010375 Bacteria 1146
32 Ga0157370_11228931 3300013104 Bacteria 676
33 Ga0157374_10060241 3300013296 Bacteria 3552
34 Ga0157372_10008804 3300013307 Bacteria 10717
35 Ga0157375_10358008 3300013308 Bacteria 1625
36 Ga0182008_10453624 3300014497 Bacteria 698
37 Ga0182007_10016802 3300015262 Bacteria 2690
38 Ga0163161_10000007 3300017792 Bacteria 301614
39 Ga0163161_10000710 3300017792 Bacteria 26388
40 Ga0163161_10017141 3300017792 Bacteria 5066
41 Ga0163161_10437508 3300017792 Bacteria 1055
42 Ga0209436_100843 3300025208 Bacteria 12365
43 Ga0209566_100137 3300025225 Bacteria 89967
44 Ga0209130_1001462 3300025284 Bacteria 15516
45 Ga0209675_1000755 3300025291 Bacteria 21747
46 Ga0209025_1006662 3300025294 Bacteria 8873
47 Ga0207426_1000288 3300025302 Bacteria 100477
48 Ga0207642_10029706 3300025899 Bacteria 2267
49 Ga0207654_10071040 3300025911 Bacteria 2068
50 Ga0207695_10478017 3300025913 Bacteria 1128
51 Ga0207671_10006318 3300025914 Bacteria 10576
52 Ga0207671_10030733 3300025914 Bacteria 4003
53 Ga0207686_10591854 3300025934 Unclassified 872
54 Ga0207667_10009022 3300025949 Bacteria 11794
55 Ga0207702_10021411 3300026078 Bacteria 5353
56 Ga0207702_10081741 3300026078 Bacteria 2806
57 Ga0207648_10844517 3300026089 Bacteria 854
58 Ga0207675_100159695 3300026118 Bacteria 2149
59 Ga0207683_10427487 3300026121 Bacteria 1220
60 Ga0265327_10003081 3300031251 Bacteria 16450
61 Ga0451577_0933972 3300042876 Bacteria 780
62 Ga0466969_0000030 3300044656 Bacteria 90368
63 Ga0466966_0000293 3300044684 Bacteria 32754
64 Ga0466961_0288106 3300044693 Bacteria 1004
65 Ga0466964_0148136 3300044706 Bacteria 1085
66 Ga0466970_0152929 3300044765 Bacteria 1274
67 Ga0466959_0000021 3300045049 Bacteria 132387
68 Ga0466959_0543429 3300045049 Bacteria 784
69 Ga0451576_0765158 3300045051 Unclassified 1014
70 Ga0495626_0141611 3300048091 Bacteria 1020
71 Ga0496110_0090369 3300048913 Bacteria 2738
72 Ga0496116_0038819 3300048919 Bacteria 3301
73 Ga0496116_0051341 3300048919 Bacteria 2740
74 Ga0496116_0077794 3300048919 Unclassified 2071
75 Ga0496122_0117270 3300048925 Bacteria 1728
76 Ga0496122_0121507 3300048925 Bacteria 1683
77 Ga0496124_0280800 3300048927 Bacteria 1214
78 nmdc:mga0k408_108942_c1 3300050493 Bacteria 1636
79 nmdc:mga0k408_914469_c1 3300050493 Bacteria 509
80 nmdc:mga06z11_945172_c1 3300050494 Bacteria 525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0051341 Ga0496116_0051341_883_1272 121
2 3300048919 Ga0496116_0077794 Ga0496116_0077794_15_383 121
3 3300048927 Ga0496124_0280800 Ga0496124_0280800_773_1162 121
4 iso_pu_bacteria 2739367857 2740001897 131
5 iso_pu_bacteria 2739367858 2740006713 131
6 iso_pu_bacteria 2738541279 2738732040 132
7 iso_pu_bacteria 2738541285 2738764605 132
8 iso_pu_bacteria 2738543007 2739213620 132
9 iso_pu_bacteria 2929297113 2929299142 132
10 iso_pu_bacteria 2884791551 2884793458 133
11 iso_pu_bacteria 2896085136 2896089759 133
12 iso_pu_bacteria 2643221600 2644011370 134
13 iso_pu_bacteria 2919191525 2919193963 134
14 3300017792 Ga0163161_10000007 Ga0163161_10000007263 135
15 3300025934 Ga0207686_10591854 Ga0207686_105918541 135
16 iso_pu_bacteria 2524023129 2524186679 135
17 iso_pu_bacteria 8054795415 8054800092 135
18 iso_pu_bacteria 8057733483 8057739140 135
19 iso_pu_bacteria 8057977335 8057981842 135
20 iso_pu_bacteria 2671180694 2673817131 136
21 iso_pu_bacteria 2671180694 2673822402 136
22 iso_pu_bacteria 2857465823 2857471444 136
23 iso_pu_bacteria 2865002811 2865004618 136
24 iso_pu_bacteria 2888578766 2888581896 136
25 iso_pu_bacteria 2898907183 2898911255 136
26 iso_pu_bacteria 2925326138 2925330809 136
27 iso_pu_bacteria 2980125574 2980128510 136
28 iso_pu_bacteria 8046991243 8046998207 136
29 3300002987 JGI25159J45721_1032712 JGI25159J45721_10327122 137
30 3300003320 rootH2_10302202 rootH2_103022024 137
31 3300003323 rootH1_10030020 rootH1_100300203 137
32 3300003323 rootH1_10245346 rootH1_102453462 137
33 3300003323 rootH1_10385986 rootH1_103859863 137
34 3300003354 JGI25160J50197_1042054 JGI25160J50197_10420542 137
35 3300003841 Ga0055541_1001108 Ga0055541_10011085 137
36 3300005290 Ga0065712_10789498 Ga0065712_107894981 137
37 3300005333 Ga0070677_10338246 Ga0070677_103382462 137
38 3300005338 Ga0068868_102308670 Ga0068868_1023086701 137
39 3300005354 Ga0070675_100963816 Ga0070675_1009638161 137
40 3300005456 Ga0070678_101692156 Ga0070678_1016921561 137
41 3300005563 Ga0068855_100038887 Ga0068855_1000388873 137
42 3300005577 Ga0068857_100021639 Ga0068857_1000216394 137
43 3300005614 Ga0068856_100014383 Ga0068856_1000143836 137
44 3300005614 Ga0068856_102008472 Ga0068856_1020084721 137
45 3300005617 Ga0068859_102224199 Ga0068859_1022241991 137
46 3300005718 Ga0068866_10010040 Ga0068866_100100402 137
47 3300005719 Ga0068861_100433493 Ga0068861_1004334932 137
48 3300006178 Ga0075367_11028238 Ga0075367_110282382 137
49 3300006195 Ga0075366_10528424 Ga0075366_105284242 137
50 3300006195 Ga0075366_11060293 Ga0075366_110602931 137
51 3300006237 Ga0097621_100823231 Ga0097621_1008232311 137
52 3300006237 Ga0097621_101613708 Ga0097621_1016137081 137
53 3300006931 Ga0097620_102225387 Ga0097620_1022253872 137
54 3300009093 Ga0105240_10566950 Ga0105240_105669502 137
55 3300009174 Ga0105241_10130054 Ga0105241_101300542 137
56 3300009545 Ga0105237_10055032 Ga0105237_100550324 137
57 3300009545 Ga0105237_10193851 Ga0105237_101938514 137
58 3300010375 Ga0105239_10025119 Ga0105239_100251196 137
59 3300010375 Ga0105239_10714181 Ga0105239_107141812 137
60 3300013104 Ga0157370_11228931 Ga0157370_112289311 137
61 3300013296 Ga0157374_10060241 Ga0157374_100602413 137
62 3300013307 Ga0157372_10008804 Ga0157372_100088044 137
63 3300013308 Ga0157375_10358008 Ga0157375_103580082 137
64 3300014497 Ga0182008_10453624 Ga0182008_104536241 137
65 3300015262 Ga0182007_10016802 Ga0182007_100168023 137
66 3300017792 Ga0163161_10000710 Ga0163161_1000071012 137
67 3300017792 Ga0163161_10017141 Ga0163161_100171412 137
68 3300017792 Ga0163161_10437508 Ga0163161_104375082 137
69 3300025208 Ga0209436_100843 Ga0209436_1008438 137
70 3300025225 Ga0209566_100137 Ga0209566_10013753 137
71 3300025284 Ga0209130_1001462 Ga0209130_10014628 137
72 3300025291 Ga0209675_1000755 Ga0209675_10007559 137
73 3300025294 Ga0209025_1006662 Ga0209025_10066624 137
74 3300025302 Ga0207426_1000288 Ga0207426_100028855 137
75 3300025899 Ga0207642_10029706 Ga0207642_100297062 137
76 3300025911 Ga0207654_10071040 Ga0207654_100710403 137
77 3300025913 Ga0207695_10478017 Ga0207695_104780171 137
78 3300025914 Ga0207671_10006318 Ga0207671_100063184 137
79 3300025914 Ga0207671_10030733 Ga0207671_100307333 137
80 3300025949 Ga0207667_10009022 Ga0207667_100090223 137
81 3300026078 Ga0207702_10021411 Ga0207702_100214118 137
82 3300026078 Ga0207702_10081741 Ga0207702_100817413 137
83 3300026089 Ga0207648_10844517 Ga0207648_108445172 137
84 3300026118 Ga0207675_100159695 Ga0207675_1001596952 137
85 3300026121 Ga0207683_10427487 Ga0207683_104274871 137
86 3300031251 Ga0265327_10003081 Ga0265327_100030815 137
87 3300042876 Ga0451577_0933972 Ga0451577_0933972_43_501 137
88 3300044656 Ga0466969_0000030 Ga0466969_0000030_51956_52369 137
89 3300044684 Ga0466966_0000293 Ga0466966_0000293_19355_19768 137
90 3300044693 Ga0466961_0288106 Ga0466961_0288106_475_888 137
91 3300044706 Ga0466964_0148136 Ga0466964_0148136_198_611 137
92 3300044765 Ga0466970_0152929 Ga0466970_0152929_386_799 137
93 3300045049 Ga0466959_0000021 Ga0466959_0000021_40187_40600 137
94 3300045049 Ga0466959_0543429 Ga0466959_0543429_256_732 137
95 3300045051 Ga0451576_0765158 Ga0451576_0765158_244_672 137
96 3300048091 Ga0495626_0141611 Ga0495626_0141611_15_473 137
97 3300048913 Ga0496110_0090369 Ga0496110_0090369_1615_2031 137
98 3300048919 Ga0496116_0038819 Ga0496116_0038819_389_814 137
99 3300048925 Ga0496122_0117270 Ga0496122_0117270_378_800 137
100 3300048925 Ga0496122_0121507 Ga0496122_0121507_690_1112 137
101 3300050493 nmdc:mga0k408_108942_c1 nmdc:mga0k408_108942_c1_1128_1541 137
102 3300050493 nmdc:mga0k408_914469_c1 nmdc:mga0k408_914469_c1_29_442 137
103 3300050494 nmdc:mga06z11_945172_c1 nmdc:mga06z11_945172_c1_38_451 137
104 iso_pu_bacteria 2971410472 2971412180 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

18

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9526 1 134
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9526 1 137
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9455 1 137
1jl3-assembly4.cif.gz_D crystal structure of b. subtilis arsc 0.9435 2 137
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9415 1 133
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9387 2 137 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9312 2 137 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8994 1 137 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8913 1 135 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8808 1 135 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1N6DYB7-F1-model_v4 Protein tyrosine phosphatase 0.9914 1 137 GO:0046685
AF-A0A7C5GVU1-F1-model_v4 Arsenate reductase ArsC 0.9798 2 135 GO:0046685
AF-A0A093XZ27-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9796 2 135 GO:0046685
AF-A0A5R8KCJ9-F1-model_v4 Arsenate reductase ArsC 0.9768 4 135 GO:0046685
AF-A0A069S6E5-F1-model_v4 deleted 0.9749 2 135

Feature Viewer

pLDDT pTM Quality
94.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map