Protein Family IF14180

Metagenome Isolate
470 Members
267 Samples
144 Scaffolds
249.22 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8102193924|8102197602|
Length
272 aa
Sequence
MYRTWARFAGLSARQAKTNREMDLKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIAVSCGVTQCQETLRTALAIGADRAVLVETSEDLQPLAVAKLLKALVDQEKPDLIILGKQAIDDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLTTVKPADLGVDVTPRLKTLKVVEPPKRSAGITVPDVKTLVEKLKNEAKVI

πŸ“Š Sample Types

Isolate 69.4%
Metagenome 30.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 28.2%
Apidae 24.0%
Unclassified 8.8%
Termitidae 8.0%
Formicidae 6.9%
Elmidae 4.6%
Culicidae 3.4%
Kalotermitidae 3.4%
Armadillidiidae 3.1%
Curculionidae 1.5%
Drosophilidae 1.5%
Hydrophilidae 0.8%
Passalidae 0.8%
Rhinotermitidae 0.8%
Largidae 0.8%
Alydidae 0.8%
Berytidae 0.8%
Daphniidae 0.4%
Hodotermitidae 0.4%
Kiwaidae 0.4%
Termopsidae 0.4%
Pteromalidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 441
Eukaryota 0
Viruses 0
Unclassified 29

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8119099601 Snodgrassella alvi wkB2 Isolate Apidae
2 2556921669 Shinella sp. DD12 Isolate Daphniidae
3 2585428136 Snodgrassella alvi wkB2 Isolate Apidae
4 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
5 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
6 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
7 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
8 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
9 2854100132 Snodgrassella alvi A-2-12 Isolate Apidae
10 2857827427 Snodgrassella alvi App6-4 Isolate Apidae
11 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
12 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
13 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
14 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
15 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
16 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
17 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
18 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
19 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
24 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
25 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 8101270055 Snodgrassella sp. W8124 Isolate Apidae
34 8101278866 Snodgrassella sp. W6238H11 Isolate Apidae
35 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
36 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
37 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
38 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
39 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
40 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
41 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
42 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
43 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
44 2840743474 Snodgrassella alvi N-23 Isolate Apidae
45 2846366200 Snodgrassella alvi Gris3-4 Isolate Apidae
46 2846370940 Snodgrassella alvi Nev3CBA3 Isolate Apidae
47 2857842411 Snodgrassella alvi Ruf1-X Isolate Apidae
48 2864755708 Massilia timonae S00006 Isolate Elmidae
49 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
50 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
51 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
52 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
53 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
56 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
57 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
58 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
59 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
60 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
61 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
62 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
63 8100455565 Delftia sp. S67 Isolate Curculionidae
64 8101255641 Snodgrassella sp. M0110 Isolate Apidae
65 8101260589 Snodgrassella sp. M0118 Isolate Apidae
66 8101267702 Snodgrassella sp. W6238H14 Isolate Apidae
67 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
68 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
69 8102102351 Caballeronia sp. INML1 Isolate Coreidae
70 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
71 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
72 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
73 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
74 2585427851 Snodgrassella alvi wkB29 Isolate Apidae
75 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
76 2846373876 Snodgrassella alvi Gris1-3 Isolate Apidae
77 2848751009 Snodgrassella alvi App2-2 Isolate Apidae
78 2849411303 Snodgrassella alvi A3 Isolate Apidae
79 2854084220 Snodgrassella alvi Snod2-1-5 Isolate Apidae
80 2854093395 Snodgrassella alvi N-S5 Isolate Apidae
81 2854102457 Snodgrassella alvi Gris1-6 Isolate Apidae
82 2857835046 Snodgrassella alvi wkB9 Isolate Apidae
83 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
84 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
85 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
86 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
87 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
88 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
89 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
90 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
91 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
92 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
93 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
94 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
95 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
96 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
97 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
98 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
99 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
100 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
101 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
102 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
103 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
104 8100449422 Delftia sp. S66 Isolate Curculionidae
105 8101274435 Snodgrassella sp. W8134 Isolate Apidae
106 8101276651 Snodgrassella sp. W8135 Isolate Apidae
107 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
108 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
109 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
110 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
111 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
112 2603880165 Burkholderiales A1 Isolate Unclassified
113 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
114 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
115 2840748007 Snodgrassella alvi A-1-12 Isolate Apidae
116 2843301220 Snodgrassella alvi Nev4-2 Isolate Apidae
117 2846363972 Snodgrassella alvi N-W7 Isolate Apidae
118 2849406737 Snodgrassella alvi PEB0178 Isolate Apidae
119 2849415715 Snodgrassella alvi A2 Isolate Apidae
120 2857822956 Snodgrassella alvi N-W4 Isolate Apidae
121 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
122 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
123 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
124 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
125 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
126 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
127 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
128 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
129 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
130 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
131 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
132 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
133 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
134 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
135 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
136 8101263066 Snodgrassella sp. M0351 Isolate Apidae
137 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
138 8102124461 Caballeronia sp. INML3B Isolate Coreidae
139 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
140 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
141 2684622927 Snodgrassella alvi Sa_196 Isolate Unclassified
142 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
143 2837563510 Snodgrassella alvi N-S1 Isolate Apidae
144 2843299038 Snodgrassella alvi N-S2 Isolate Apidae
145 2846368606 Snodgrassella alvi A-11-12 Isolate Apidae
146 2849404451 Snodgrassella alvi E1 Isolate Apidae
147 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
148 2854088767 Snodgrassella alvi MS1-3 Isolate Apidae
149 2854104879 Snodgrassella alvi Fer2-2 Isolate Apidae
150 2857840086 Snodgrassella alvi Aw-20 Isolate Apidae
151 2868461634 Snodgrassella alvi Gris2-3-4 Isolate Apidae
152 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
153 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
154 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
155 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
156 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
157 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
158 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
159 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
160 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
161 8069748016 Caballeronia sp. LP003 Isolate Coreidae
162 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
163 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
164 8102109360 Caballeronia sp. INML2 Isolate Coreidae
165 8102145433 Caballeronia sp. LP006 Isolate Coreidae
166 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
167 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
168 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
169 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
170 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
171 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
172 2849399727 Snodgrassella alvi Fer1-2 Isolate Apidae
173 2849402121 Snodgrassella alvi A-10-12 Isolate Apidae
174 2849409164 Snodgrassella alvi wkB298 Isolate Apidae
175 2849413536 Snodgrassella alvi N-S4 Isolate Apidae
176 2854091108 Snodgrassella alvi wkB339 Isolate Apidae
177 2854095577 Snodgrassella alvi A12 Isolate Apidae
178 2857837414 Snodgrassella alvi App4-8 Isolate Apidae
179 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
180 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
181 2868169047 Comamonas aquatica S00077 Isolate Elmidae
182 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
183 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
184 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
185 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
186 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
187 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
188 8023757577 Caballeronia peredens LP006 Isolate Coreidae
189 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
190 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
191 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
192 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
193 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
194 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
195 8100461708 Delftia sp. S65 Isolate Curculionidae
196 8101272231 Snodgrassella sp. W8132 Isolate Apidae
197 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
198 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
199 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
200 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
201 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
202 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
203 2585427850 Snodgrassella alvi wkB12 Isolate Apidae
204 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
205 2811994808 Snodgrassella alvi Sa_196 v2 Isolate Unclassified
206 2846361553 Snodgrassella alvi PEB0171 Isolate Apidae
207 2849417936 Snodgrassella alvi N9 Isolate Apidae
208 2852205774 Snodgrassella alvi ESL0196 Isolate Apidae
209 2854086477 Snodgrassella alvi N-S3 Isolate Apidae
210 2854097802 Snodgrassella alvi Aw-18 Isolate Apidae
211 2864937364 Acidovorax soli S00198 Isolate Elmidae
212 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
213 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
214 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
215 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
216 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
217 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
218 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
219 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
220 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
221 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
222 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
223 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
224 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
225 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
226 8101265296 Snodgrassella sp. W8158 Isolate Apidae
227 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
228 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
229 8102117041 Caballeronia sp. INML3 Isolate Coreidae
230 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
231 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
232 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
233 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
234 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
235 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
236 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
237 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
238 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
239 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
240 2834412944 Snodgrassella alvi A-5-24 Isolate Apidae
241 2834415282 Snodgrassella alvi Occ4-2 Isolate Apidae
242 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
243 2857825141 Snodgrassella alvi wkB332 Isolate Apidae
244 2857830159 Snodgrassella alvi A-9-24 Isolate Apidae
245 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
246 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
247 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
248 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
249 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
250 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
251 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
252 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
253 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
254 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
255 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
256 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
257 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
258 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
259 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
260 8101258116 Snodgrassella sp. M0112 Isolate Apidae
261 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
262 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
263 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
264 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
265 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
266 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
267 8102264549 Caballeronia sp. NCF2 Isolate Coreidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160472_100294 3300012839 Bacteria 51787
2 Ga0160472_102130 3300012839 Bacteria 4757
3 Ga0160444_101810 3300012841 Bacteria 3587
4 Ga0466723_124709 3300042618 Bacteria 3442
5 Ga0466734_054417 3300042623 Bacteria 4618
6 Ga0466724_61642 3300042649 Unclassified 1007
7 Ga0466708_363179 3300042652 Bacteria 8395
8 Ga0466725_129448 3300042654 Bacteria 92830
9 IMNBL1DRAFT_c0002881 3300000062 Bacteria 11533
10 HBC_ctgsDRAFT_1013731 3300000333 Bacteria 1953
11 Ga0160456_100003 3300012820 Bacteria 724826
12 Ga0160458_102670 3300012832 Unclassified 2365
13 Ga0160472_101651 3300012839 Bacteria 6046
14 Ga0160433_100006 3300012846 Bacteria 359584
15 Ga0160436_1001862 3300012861 Bacteria 5579
16 Ga0466724_06065 3300042649 Bacteria 94573
17 Ga0123353_10038792 3300010167 Unclassified 7490
18 Ga0123353_10098698 3300010167 Bacteria 4707
19 Ga0063521_1000019 3300003973 Bacteria 139495
20 Ga0103260_1003369 3300007139 Bacteria 3931
21 Ga0103267_1000052 3300007190 Bacteria 68999
22 Ga0103268_1000369 3300007192 Bacteria 14276
23 Ga0466733_193213 3300042659 Bacteria 1473
24 Ga0160459_102471 3300012831 Unclassified 3011
25 Ga0160460_100091 3300012845 Bacteria 129853
26 Ga0160445_105719 3300012847 Unclassified 2098
27 Ga0466691_073049 3300042593 Bacteria 25350
28 Ga0466712_099212 3300042614 Bacteria 16988
29 Ga0466728_271238 3300042620 Bacteria 35337
30 Ga0466730_092359 3300042625 Bacteria 1312
31 Ga0466724_10067 3300042649 Unclassified 1007
32 Ga0466724_26146 3300042649 Bacteria 9583
33 Ga0466725_081936 3300042654 Bacteria 5209
34 Ga0123355_10386580 3300009826 Bacteria 1818
35 Ga0160471_101531 3300012812 Bacteria 4477
36 Ga0466701_073229 3300042598 Bacteria 2058
37 Ga0466706_095642 3300042599 Bacteria 6417
38 Ga0466719_261783 3300042606 Bacteria 6535
39 HBC_ctgsDRAFT_1030683 3300000333 Unclassified 1321
40 JGI24705J35276_12222630 3300002504 Bacteria 2437
41 Ga0074278_105888 3300005721 Unclassified 24736
42 Ga0102735_1000436 3300007080 Bacteria 9029
43 Ga0103261_1022900 3300007083 Bacteria 883
44 Ga0102737_1000672 3300007142 Bacteria 10860
45 Ga0102737_1001960 3300007142 Bacteria 5357
46 Ga0103268_1001370 3300007192 Unclassified 6103
47 Ga0160446_108111 3300012835 Bacteria 1397
48 Ga0160443_112153 3300012848 Bacteria 965
49 Ga0157631_138103 3300013007 Bacteria 3769
50 Ga0466657_403482 3300042582 Bacteria 1855
51 Ga0466690_109842 3300042590 Bacteria 9167
52 Ga0466734_066457 3300042623 Bacteria 23783
53 Ga0123354_10016796 3300010882 Bacteria 11467
54 Ga0123354_10073975 3300010882 Bacteria 4886
55 Ga0160464_106734 3300012805 Unclassified 1217
56 Ga0466701_022768 3300042598 Bacteria 10429
57 Ga0466707_241127 3300042601 Bacteria 5997
58 CVPL005W_1000049 3300002934 Bacteria 77363
59 Ga0102736_1001038 3300007052 Bacteria 5077
60 Ga0103266_1001449 3300007067 Bacteria 7057
61 Ga0103264_1000069 3300007188 Bacteria 85289
62 Ga0105524_100305 3300007733 Bacteria 7166
63 Ga0466697_230868 3300042611 Bacteria 1650
64 Ga0160440_100274 3300012815 Bacteria 30327
65 Ga0160467_100056 3300012829 Bacteria 169022
66 Ga0160459_100572 3300012831 Bacteria 13508
67 Ga0160459_102003 3300012831 Unclassified 3632
68 Ga0160452_100363 3300012834 Unclassified 37474
69 Ga0160452_106677 3300012834 Bacteria 1576
70 Ga0160435_1004895 3300012857 Unclassified 3072
71 Ga0466657_056541 3300042582 Bacteria 144917
72 Ga0466692_167406 3300042591 Bacteria 107532
73 Ga0466695_304326 3300042595 Bacteria 3812
74 Ga0466710_427471 3300042613 Bacteria 2769
75 Ga0466734_023348 3300042623 Bacteria 1786
76 Ga0466724_40992 3300042649 Unclassified 1949
77 Ga0466724_68003 3300042649 Bacteria 28448
78 Ga0466708_029404 3300042652 Bacteria 2764
79 CVPL010W_10024505 3300002931 Bacteria 3568
80 CVPL010L_1000182 3300002932 Bacteria 39238
81 CVPL005W_1000661 3300002934 Bacteria 12373
82 Ga0103266_1000078 3300007067 Bacteria 50240
83 Ga0102734_1000136 3300007129 Bacteria 40551
84 Ga0102734_1001009 3300007129 Bacteria 7645
85 Ga0102737_1000454 3300007142 Bacteria 13571
86 Ga0160441_107022 3300012825 Unclassified 1540
87 Ga0160455_106113 3300012837 Bacteria 1245
88 Ga0160460_102469 3300012845 Unclassified 4125
89 Ga0160460_110486 3300012845 Unclassified 1134
90 Ga0160447_102187 3300012849 Unclassified 7041
91 Ga0466691_084648 3300042593 Bacteria 6845
92 Ga0466701_004048 3300042598 Bacteria 40613
93 Ga0466710_068154 3300042613 Bacteria 11462
94 Ga0123356_10886208 3300010049 Bacteria 1064
95 Ga0160471_100307 3300012812 Bacteria 15847
96 Ga0160471_104536 3300012812 Bacteria 1937
97 Ga0466701_018272 3300042598 Bacteria 1770
98 gam1t_NODE_457294_length=15312_GC=41_9_Contigs=1 2189573031 Bacteria 15312
99 Ga0102734_1028367 3300007129 Bacteria 1432
100 Ga0103267_1033243 3300007190 Unclassified 1721
101 Ga0103268_1000020 3300007192 Bacteria 52364
102 Ga0160440_103524 3300012815 Bacteria 1521
103 Ga0160445_105408 3300012847 Bacteria 2192
104 Ga0160443_101079 3300012848 Bacteria 11272
105 Ga0160447_100942 3300012849 Unclassified 12142
106 Ga0160436_1003115 3300012861 Unclassified 4103
107 Ga0309901_1000019 3300028918 Bacteria 429099
108 Ga0466657_360773 3300042582 Unclassified 1170
109 Ga0466711_159812 3300042615 Bacteria 12881
110 Ga0466734_127231 3300042623 Bacteria 2275
111 Ga0466725_272038 3300042654 Unclassified 6532
112 Ga0466727_258930 3300042655 Bacteria 44272
113 Ga0123357_10004311 3300009784 Bacteria 16665
114 Ga0123354_10174769 3300010882 Bacteria 2481
115 Ga0466698_150578 3300042610 Bacteria 1129
116 CVPL010W_10039337 3300002931 Unclassified 1460
117 Ga0103265_1002604 3300007068 Bacteria 2758
118 Ga0102739_1002017 3300007095 Unclassified 3213
119 Ga0102734_1033091 3300007129 Bacteria 1335
120 Ga0102740_1001872 3300007140 Unclassified 5097
121 Ga0102740_1006389 3300007140 Bacteria 2108
122 Ga0123357_10000956 3300009784 Bacteria 29387
123 Ga0160452_100010 3300012834 Bacteria 405793
124 Ga0160447_124561 3300012849 Unclassified 891
125 Ga0160457_1007118 3300012858 Unclassified 1643
126 Ga0255572_1000006 3300026175 Bacteria 236537
127 Ga0466656_223431 3300042550 Bacteria 2598
128 Ga0466696_370921 3300042596 Bacteria 6841
129 Ga0466703_144306 3300042636 Bacteria 3830
130 Ga0466725_156562 3300042654 Bacteria 1315
131 Ga0466725_459913 3300042654 Bacteria 4730
132 Ga0123355_10139835 3300009826 Bacteria 3708
133 Ga0123355_10460047 3300009826 Bacteria 1597
134 Ga0160464_100050 3300012805 Unclassified 141112
135 IMNBGM34_c000023 3300000036 Bacteria 40778
136 JGI24705J35276_12237734 3300002504 Bacteria 12798
137 JGI24699J35502_11021816 3300002509 Bacteria 1456
138 CVPL010W_10014691 3300002931 Bacteria 10031
139 Ga0103261_1005572 3300007083 Bacteria 1850
140 Ga0102739_1001769 3300007095 Bacteria 3476
141 Ga0102734_1001551 3300007129 Bacteria 8427
142 Ga0102734_1006302 3300007129 Bacteria 2655
143 Ga0102740_1002929 3300007140 Bacteria 3768
144 Ga0123357_10000003 3300009784 Bacteria 349727

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820059968 2820060568 203
2 3300042610 Ga0466698_150578 Ga0466698_150578_489_1118 209
3 iso_pr_bacteria 8102074813 8102076922 230
4 3300028918 Ga0309901_1000019 Ga0309901_100001954 231
5 3300042659 Ga0466733_193213 Ga0466733_193213_640_1389 237
6 3300042614 Ga0466712_099212 Ga0466712_099212_2704_3456 238
7 iso_pr_bacteria 2556921622 2558101848 239
8 iso_pr_bacteria 2864859030 2864859336 239
9 iso_pr_bacteria 2864914039 2864914346 239
10 iso_pr_bacteria 2864988360 2864988667 239
11 3300042649 Ga0466724_26146 Ga0466724_26146_8840_9562 240
12 3300000333 HBC_ctgsDRAFT_1030683 HBC_ctgsDRAFT_10306832 242
13 3300042620 Ga0466728_271238 Ga0466728_271238_8850_9584 244
14 3300042593 Ga0466691_084648 Ga0466691_084648_3673_4413 246
15 iso_pr_bacteria 8102279326 8102281407 248
16 iso_pr_bacteria 8102279326 8102284826 248
17 2189573031 gam1t_NODE_457294_length=15312_GC=41_9_Contigs=1 gam1t_00121100 249
18 3300007083 Ga0103261_1022900 Ga0103261_10229001 249
19 3300007129 Ga0102734_1033091 Ga0102734_10330912 249
20 3300012829 Ga0160467_100056 Ga0160467_10005657 249
21 3300012848 Ga0160443_101079 Ga0160443_1010798 249
22 3300012861 Ga0160436_1001862 Ga0160436_10018624 249
23 3300013007 Ga0157631_138103 Ga0157631_1381033 249
24 3300026175 Ga0255572_1000006 Ga0255572_1000006101 249
25 3300042550 Ga0466656_223431 Ga0466656_223431_629_1378 249
26 3300042582 Ga0466657_056541 Ga0466657_056541_102141_102890 249
27 3300042582 Ga0466657_360773 Ga0466657_360773_19_768 249
28 3300042582 Ga0466657_403482 Ga0466657_403482_271_1020 249
29 3300042596 Ga0466696_370921 Ga0466696_370921_2099_2848 249
30 3300042598 Ga0466701_004048 Ga0466701_004048_39042_39791 249
31 3300042598 Ga0466701_018272 Ga0466701_018272_268_1017 249
32 3300042598 Ga0466701_022768 Ga0466701_022768_5321_6070 249
33 3300042598 Ga0466701_073229 Ga0466701_073229_409_1158 249
34 3300042611 Ga0466697_230868 Ga0466697_230868_210_959 249
35 3300042613 Ga0466710_068154 Ga0466710_068154_7424_8173 249
36 3300042613 Ga0466710_427471 Ga0466710_427471_758_1507 249
37 3300042615 Ga0466711_159812 Ga0466711_159812_11090_11839 249
38 3300042623 Ga0466734_023348 Ga0466734_023348_547_1296 249
39 3300042623 Ga0466734_054417 Ga0466734_054417_1084_1833 249
40 3300042623 Ga0466734_066457 Ga0466734_066457_16294_17043 249
41 3300042623 Ga0466734_127231 Ga0466734_127231_269_1018 249
42 3300042625 Ga0466730_092359 Ga0466730_092359_72_821 249
43 3300042649 Ga0466724_06065 Ga0466724_06065_4061_4810 249
44 3300042649 Ga0466724_68003 Ga0466724_68003_16274_17023 249
45 3300042652 Ga0466708_363179 Ga0466708_363179_3200_3949 249
46 3300042654 Ga0466725_081936 Ga0466725_081936_1318_2067 249
47 3300042654 Ga0466725_129448 Ga0466725_129448_24438_25187 249
48 3300042654 Ga0466725_272038 Ga0466725_272038_5763_6512 249
49 3300042654 Ga0466725_459913 Ga0466725_459913_3375_4124 249
50 iso_pr_bacteria 2518285616 2518643864 249
51 iso_pr_bacteria 2556921669 2558280856 249
52 iso_pr_bacteria 2571042003 2571060740 249
53 iso_pr_bacteria 2585427850 2586974360 249
54 iso_pr_bacteria 2585427851 2586976281 249
55 iso_pr_bacteria 2585428136 2588037013 249
56 iso_pr_bacteria 2597489944 2598058117 249
57 iso_pr_bacteria 2603880165 2606014753 249
58 iso_pr_bacteria 2609459925 2610644531 249
59 iso_pr_bacteria 2609459958 2610827004 249
60 iso_pr_bacteria 2619619079 2620603897 249
61 iso_pr_bacteria 2627853677 2628493501 249
62 iso_pr_bacteria 2627854002 2629837716 249
63 iso_pr_bacteria 2630968716 2632958784 249
64 iso_pr_bacteria 2636415542 2636988777 249
65 iso_pr_bacteria 2648501820 2651395966 249
66 iso_pr_bacteria 2684622927 2686105902 249
67 iso_pr_bacteria 2724678956 2724790073 249
68 iso_pr_bacteria 2811994808 2812042313 249
69 iso_pr_bacteria 2820082748 2820083967 249
70 iso_pr_bacteria 2820089333 2820091364 249
71 iso_pr_bacteria 2820093073 2820093939 249
72 iso_pr_bacteria 2820103659 2820105171 249
73 iso_pr_bacteria 2820123897 2820124152 249
74 iso_pr_bacteria 2834412944 2834415110 249
75 iso_pr_bacteria 2834415282 2834417196 249
76 iso_pr_bacteria 2837563510 2837565134 249
77 iso_pr_bacteria 2840743474 2840745465 249
78 iso_pr_bacteria 2840748007 2840749513 249
79 iso_pr_bacteria 2843299038 2843300277 249
80 iso_pr_bacteria 2843301220 2843301866 249
81 iso_pr_bacteria 2846359427 2846359646 249
82 iso_pr_bacteria 2846361553 2846363529 249
83 iso_pr_bacteria 2846363972 2846365519 249
84 iso_pr_bacteria 2846366200 2846368482 249
85 iso_pr_bacteria 2846368606 2846370058 249
86 iso_pr_bacteria 2846370940 2846373075 249
87 iso_pr_bacteria 2846373876 2846373965 249
88 iso_pr_bacteria 2846379220 2846380746 249
89 iso_pr_bacteria 2848751009 2848753229 249
90 iso_pr_bacteria 2849399727 2849400099 249
91 iso_pr_bacteria 2849402121 2849403732 249
92 iso_pr_bacteria 2849404451 2849406259 249
93 iso_pr_bacteria 2849406737 2849409052 249
94 iso_pr_bacteria 2849409164 2849410014 249
95 iso_pr_bacteria 2849411303 2849413318 249
96 iso_pr_bacteria 2849413536 2849414710 249
97 iso_pr_bacteria 2849415715 2849415768 249
98 iso_pr_bacteria 2849417936 2849419486 249
99 iso_pr_bacteria 2852205774 2852205775 249
100 iso_pr_bacteria 2854084220 2854085239 249
101 iso_pr_bacteria 2854086477 2854088088 249
102 iso_pr_bacteria 2854088767 2854090626 249
103 iso_pr_bacteria 2854091108 2854091994 249
104 iso_pr_bacteria 2854093395 2854094844 249
105 iso_pr_bacteria 2854095577 2854096991 249
106 iso_pr_bacteria 2854097802 2854099653 249
107 iso_pr_bacteria 2854100132 2854101510 249
108 iso_pr_bacteria 2854102457 2854104797 249
109 iso_pr_bacteria 2854104879 2854106555 249
110 iso_pr_bacteria 2857822956 2857824652 249
111 iso_pr_bacteria 2857825141 2857826416 249
112 iso_pr_bacteria 2857827427 2857828278 249
113 iso_pr_bacteria 2857830159 2857831630 249
114 iso_pr_bacteria 2857835046 2857836759 249
115 iso_pr_bacteria 2857837414 2857839538 249
116 iso_pr_bacteria 2857840086 2857841616 249
117 iso_pr_bacteria 2857842411 2857845010 249
118 iso_pr_bacteria 2864755708 2864756028 249
119 iso_pr_bacteria 2864755708 2864759154 249
120 iso_pr_bacteria 2864826666 2864828711 249
121 iso_pr_bacteria 2864968865 2864969517 249
122 iso_pr_bacteria 2868169047 2868170265 249
123 iso_pr_bacteria 2868169047 2868171577 249
124 iso_pr_bacteria 2868461634 2868462408 249
125 iso_pr_bacteria 2873565274 2873566068 249
126 iso_pr_bacteria 2873565274 2873567106 249
127 iso_pr_bacteria 2873565274 2873567536 249
128 iso_pr_bacteria 2873571580 2873572245 249
129 iso_pr_bacteria 2873571580 2873576984 249
130 iso_pr_bacteria 2896925746 2896931007 249
131 iso_pr_bacteria 3003869270 3003870131 249
132 iso_pr_bacteria 3003869270 3003876417 249
133 iso_pr_bacteria 3003869270 3003877032 249
134 iso_pr_bacteria 3003878002 3003878961 249
135 iso_pr_bacteria 3003878002 3003884229 249
136 iso_pr_bacteria 3003878002 3003884630 249
137 iso_pr_bacteria 3003878002 3003884812 249
138 iso_pr_bacteria 3003878002 3003886686 249
139 iso_pr_bacteria 3003878002 3003887199 249
140 iso_pr_bacteria 3003878002 3003888843 249
141 iso_pr_bacteria 8023724303 8023724386 249
142 iso_pr_bacteria 8023724303 8023724571 249
143 iso_pr_bacteria 8023724303 8023725845 249
144 iso_pr_bacteria 8023724303 8023730105 249
145 iso_pr_bacteria 8023747282 8023750379 249
146 iso_pr_bacteria 8023752828 8023754268 249
147 iso_pr_bacteria 8023752828 8023754538 249
148 iso_pr_bacteria 8023757577 8023757660 249
149 iso_pr_bacteria 8023757577 8023757845 249
150 iso_pr_bacteria 8023757577 8023759119 249
151 iso_pr_bacteria 8023757577 8023763379 249
152 iso_pr_bacteria 8023764196 8023766049 249
153 iso_pr_bacteria 8023764196 8023770533 249
154 iso_pr_bacteria 8023764196 8023771150 249
155 iso_pr_bacteria 8023764196 8023772369 249
156 iso_pr_bacteria 8024001094 8024003104 249
157 iso_pr_bacteria 8024001094 8024005496 249
158 iso_pr_bacteria 8024001094 8024006445 249
159 iso_pr_bacteria 8024014383 8024016279 249
160 iso_pr_bacteria 8024019580 8024020489 249
161 iso_pr_bacteria 8024025509 8024026298 249
162 iso_pr_bacteria 8024025509 8024029530 249
163 iso_pr_bacteria 8024031916 8024032615 249
164 iso_pr_bacteria 8024037630 8024039682 249
165 iso_pr_bacteria 8024037630 8024042113 249
166 iso_pr_bacteria 8024044713 8024046704 249
167 iso_pr_bacteria 8025650824 8025651969 249
168 iso_pr_bacteria 8025650824 8025652950 249
169 iso_pr_bacteria 8025650824 8025653004 249
170 iso_pr_bacteria 8025650824 8025657545 249
171 iso_pr_bacteria 8025650824 8025658779 249
172 iso_pr_bacteria 8025658853 8025661186 249
173 iso_pr_bacteria 8025658853 8025666026 249
174 iso_pr_bacteria 8025666332 8025668251 249
175 iso_pr_bacteria 8025666332 8025668523 249
176 iso_pr_bacteria 8025671076 8025673114 249
177 iso_pr_bacteria 8025671076 8025677774 249
178 iso_pr_bacteria 8025671076 8025678122 249
179 iso_pr_bacteria 8025678175 8025680069 249
180 iso_pr_bacteria 8025678175 8025684848 249
181 iso_pr_bacteria 8025678175 8025685207 249
182 iso_pr_bacteria 8025678175 8025685455 249
183 iso_pr_bacteria 8025685901 8025688443 249
184 iso_pr_bacteria 8025685901 8025690392 249
185 iso_pr_bacteria 8025685901 8025693616 249
186 iso_pr_bacteria 8025685901 8025694226 249
187 iso_pr_bacteria 8025694439 8025696731 249
188 iso_pr_bacteria 8025694439 8025696784 249
189 iso_pr_bacteria 8025694439 8025700978 249
190 iso_pr_bacteria 8025694439 8025701499 249
191 iso_pr_bacteria 8025701579 8025706939 249
192 iso_pr_bacteria 8025701579 8025707577 249
193 iso_pr_bacteria 8025701579 8025707674 249
194 iso_pr_bacteria 8025708040 8025710234 249
195 iso_pr_bacteria 8025708040 8025711391 249
196 iso_pr_bacteria 8025708040 8025711545 249
197 iso_pr_bacteria 8025708040 8025712724 249
198 iso_pr_bacteria 8025708040 8025715531 249
199 iso_pr_bacteria 8025708040 8025715823 249
200 iso_pr_bacteria 8025708040 8025715927 249
201 iso_pr_bacteria 8025723035 8025724923 249
202 iso_pr_bacteria 8025723035 8025725796 249
203 iso_pr_bacteria 8025728939 8025732305 249
204 iso_pr_bacteria 8025728939 8025732401 249
205 iso_pr_bacteria 8025735396 8025736991 249
206 iso_pr_bacteria 8025740903 8025744060 249
207 iso_pr_bacteria 8025747911 8025751132 249
208 iso_pr_bacteria 8025747911 8025754646 249
209 iso_pr_bacteria 8025756023 8025759244 249
210 iso_pr_bacteria 8025756023 8025762767 249
211 iso_pr_bacteria 8069748016 8069748431 249
212 iso_pr_bacteria 8069748016 8069749908 249
213 iso_pr_bacteria 8069748016 8069751566 249
214 iso_pr_bacteria 8069755105 8069758326 249
215 iso_pr_bacteria 8069755105 8069761841 249
216 iso_pr_bacteria 8069763219 8069766376 249
217 iso_pr_bacteria 8069770227 8069773324 249
218 iso_pr_bacteria 8069775773 8069777213 249
219 iso_pr_bacteria 8069775773 8069777483 249
220 iso_pr_bacteria 8078130113 8078132147 249
221 iso_pr_bacteria 8078130113 8078133263 249
222 iso_pr_bacteria 8078130113 8078134984 249
223 iso_pr_bacteria 8100449422 8100451617 249
224 iso_pr_bacteria 8100449422 8100452540 249
225 iso_pr_bacteria 8100455565 8100457428 249
226 iso_pr_bacteria 8100455565 8100458606 249
227 iso_pr_bacteria 8100461708 8100463443 249
228 iso_pr_bacteria 8101255641 8101257712 249
229 iso_pr_bacteria 8101258116 8101260077 249
230 iso_pr_bacteria 8101260589 8101262973 249
231 iso_pr_bacteria 8101263066 8101265270 249
232 iso_pr_bacteria 8101265296 8101266353 249
233 iso_pr_bacteria 8101267702 8101269434 249
234 iso_pr_bacteria 8101270055 8101272199 249
235 iso_pr_bacteria 8101272231 8101274422 249
236 iso_pr_bacteria 8101274435 8101276641 249
237 iso_pr_bacteria 8101276651 8101278853 249
238 iso_pr_bacteria 8101278866 8101280587 249
239 iso_pr_bacteria 8101951471 8101953518 249
240 iso_pr_bacteria 8101951471 8101956964 249
241 iso_pr_bacteria 8101960468 8101962513 249
242 iso_pr_bacteria 8101960468 8101965955 249
243 iso_pr_bacteria 8101967387 8101969431 249
244 iso_pr_bacteria 8101967387 8101972872 249
245 iso_pr_bacteria 8101974301 8101976348 249
246 iso_pr_bacteria 8101974301 8101979796 249
247 iso_pr_bacteria 8101981714 8101983758 249
248 iso_pr_bacteria 8101981714 8101986993 249
249 iso_pr_bacteria 8101988189 8101990314 249
250 iso_pr_bacteria 8101988189 8101993758 249
251 iso_pr_bacteria 8102001125 8102003023 249
252 iso_pr_bacteria 8102001125 8102006587 249
253 iso_pr_bacteria 8102007614 8102009610 249
254 iso_pr_bacteria 8102014801 8102016812 249
255 iso_pr_bacteria 8102020860 8102023216 249
256 iso_pr_bacteria 8102020860 8102023464 249
257 iso_pr_bacteria 8102026984 8102029122 249
258 iso_pr_bacteria 8102026984 8102032582 249
259 iso_pr_bacteria 8102033761 8102036205 249
260 iso_pr_bacteria 8102033761 8102039457 249
261 iso_pr_bacteria 8102033761 8102040391 249
262 iso_pr_bacteria 8102033761 8102040433 249
263 iso_pr_bacteria 8102033761 8102041055 249
264 iso_pr_bacteria 8102041249 8102045684 249
265 iso_pr_bacteria 8102041249 8102047106 249
266 iso_pr_bacteria 8102041249 8102047299 249
267 iso_pr_bacteria 8102054868 8102056830 249
268 iso_pr_bacteria 8102054868 8102057066 249
269 iso_pr_bacteria 8102060671 8102062850 249
270 iso_pr_bacteria 8102060671 8102067041 249
271 iso_pr_bacteria 8102067727 8102069778 249
272 iso_pr_bacteria 8102067727 8102073130 249
273 iso_pr_bacteria 8102074813 8102080468 249
274 iso_pr_bacteria 8102081745 8102083823 249
275 iso_pr_bacteria 8102087471 8102092760 249
276 iso_pr_bacteria 8102094248 8102096566 249
277 iso_pr_bacteria 8102094248 8102099034 249
278 iso_pr_bacteria 8102094248 8102101330 249
279 iso_pr_bacteria 8102094248 8102101492 249
280 iso_pr_bacteria 8102102351 8102104351 249
281 iso_pr_bacteria 8102102351 8102108984 249
282 iso_pr_bacteria 8102109360 8102111415 249
283 iso_pr_bacteria 8102109360 8102116154 249
284 iso_pr_bacteria 8102117041 8102119015 249
285 iso_pr_bacteria 8102117041 8102123512 249
286 iso_pr_bacteria 8102124461 8102126635 249
287 iso_pr_bacteria 8102124461 8102130928 249
288 iso_pr_bacteria 8102138357 8102140405 249
289 iso_pr_bacteria 8102138357 8102144850 249
290 iso_pr_bacteria 8102145433 8102145516 249
291 iso_pr_bacteria 8102145433 8102145701 249
292 iso_pr_bacteria 8102145433 8102146975 249
293 iso_pr_bacteria 8102145433 8102151235 249
294 iso_pr_bacteria 8102152052 8102153905 249
295 iso_pr_bacteria 8102152052 8102158389 249
296 iso_pr_bacteria 8102152052 8102159006 249
297 iso_pr_bacteria 8102152052 8102160225 249
298 iso_pr_bacteria 8102161003 8102161230 249
299 iso_pr_bacteria 8102161003 8102164750 249
300 iso_pr_bacteria 8102169119 8102170714 249
301 iso_pr_bacteria 8102174626 8102177992 249
302 iso_pr_bacteria 8102174626 8102178088 249
303 iso_pr_bacteria 8102181083 8102182971 249
304 iso_pr_bacteria 8102181083 8102183844 249
305 iso_pr_bacteria 8102193924 8102196117 249
306 iso_pr_bacteria 8102193924 8102197273 249
307 iso_pr_bacteria 8102193924 8102197427 249
308 iso_pr_bacteria 8102193924 8102198606 249
309 iso_pr_bacteria 8102193924 8102201413 249
310 iso_pr_bacteria 8102193924 8102201706 249
311 iso_pr_bacteria 8102193924 8102201810 249
312 iso_pr_bacteria 8102201977 8102207337 249
313 iso_pr_bacteria 8102201977 8102207975 249
314 iso_pr_bacteria 8102201977 8102208072 249
315 iso_pr_bacteria 8102208438 8102209583 249
316 iso_pr_bacteria 8102208438 8102210564 249
317 iso_pr_bacteria 8102208438 8102210618 249
318 iso_pr_bacteria 8102208438 8102215159 249
319 iso_pr_bacteria 8102208438 8102216393 249
320 iso_pr_bacteria 8102216467 8102218759 249
321 iso_pr_bacteria 8102216467 8102218812 249
322 iso_pr_bacteria 8102216467 8102223006 249
323 iso_pr_bacteria 8102216467 8102223527 249
324 iso_pr_bacteria 8102223607 8102225645 249
325 iso_pr_bacteria 8102223607 8102230305 249
326 iso_pr_bacteria 8102223607 8102230653 249
327 iso_pr_bacteria 8102230706 8102233248 249
328 iso_pr_bacteria 8102230706 8102235197 249
329 iso_pr_bacteria 8102230706 8102238421 249
330 iso_pr_bacteria 8102230706 8102239031 249
331 iso_pr_bacteria 8102239244 8102241137 249
332 iso_pr_bacteria 8102239244 8102245915 249
333 iso_pr_bacteria 8102239244 8102246273 249
334 iso_pr_bacteria 8102239244 8102246521 249
335 iso_pr_bacteria 8102246966 8102248885 249
336 iso_pr_bacteria 8102246966 8102249157 249
337 iso_pr_bacteria 8102251710 8102254043 249
338 iso_pr_bacteria 8102251710 8102258883 249
339 iso_pr_bacteria 8102264549 8102266673 249
340 iso_pr_bacteria 8102264549 8102269970 249
341 iso_pr_bacteria 8102271933 8102274137 249
342 iso_pr_bacteria 8102271933 8102277361 249
343 iso_pr_bacteria 8102312426 8102317821 249
344 iso_pr_bacteria 8102312426 8102318138 249
345 iso_pr_bacteria 8119099601 8119100467 249
346 3300000036 IMNBGM34_c000023 IMNBGM34_00002327 250
347 3300000333 HBC_ctgsDRAFT_1013731 HBC_ctgsDRAFT_10137311 250
348 3300002504 JGI24705J35276_12222630 JGI24705J35276_122226303 250
349 3300002504 JGI24705J35276_12237734 JGI24705J35276_1223773411 250
350 3300002509 JGI24699J35502_11021816 JGI24699J35502_110218162 250
351 3300002931 CVPL010W_10024505 CVPL010W_100245053 250
352 3300002931 CVPL010W_10039337 CVPL010W_100393372 250
353 3300002934 CVPL005W_1000661 CVPL005W_10006617 250
354 3300005721 Ga0074278_105888 Ga0074278_10588821 250
355 3300007052 Ga0102736_1001038 Ga0102736_10010382 250
356 3300007067 Ga0103266_1000078 Ga0103266_10000786 250
357 3300007067 Ga0103266_1001449 Ga0103266_10014496 250
358 3300007068 Ga0103265_1002604 Ga0103265_10026042 250
359 3300007080 Ga0102735_1000436 Ga0102735_10004367 250
360 3300007083 Ga0103261_1005572 Ga0103261_10055722 250
361 3300007095 Ga0102739_1001769 Ga0102739_10017693 250
362 3300007095 Ga0102739_1002017 Ga0102739_10020172 250
363 3300007129 Ga0102734_1000136 Ga0102734_100013618 250
364 3300007129 Ga0102734_1001009 Ga0102734_10010096 250
365 3300007129 Ga0102734_1001551 Ga0102734_10015512 250
366 3300007129 Ga0102734_1006302 Ga0102734_10063022 250
367 3300007129 Ga0102734_1028367 Ga0102734_10283672 250
368 3300007139 Ga0103260_1003369 Ga0103260_10033694 250
369 3300007140 Ga0102740_1001872 Ga0102740_10018724 250
370 3300007140 Ga0102740_1002929 Ga0102740_10029292 250
371 3300007140 Ga0102740_1006389 Ga0102740_10063892 250
372 3300007142 Ga0102737_1000454 Ga0102737_100045413 250
373 3300007142 Ga0102737_1000672 Ga0102737_10006725 250
374 3300007142 Ga0102737_1001960 Ga0102737_10019609 250
375 3300007188 Ga0103264_1000069 Ga0103264_100006913 250
376 3300007190 Ga0103267_1000052 Ga0103267_100005212 250
377 3300007190 Ga0103267_1033243 Ga0103267_10332432 250
378 3300007192 Ga0103268_1000020 Ga0103268_100002050 250
379 3300007192 Ga0103268_1000369 Ga0103268_100036911 250
380 3300007192 Ga0103268_1001370 Ga0103268_10013705 250
381 3300007733 Ga0105524_100305 Ga0105524_1003053 250
382 3300009784 Ga0123357_10000003 Ga0123357_10000003251 250
383 3300009784 Ga0123357_10000956 Ga0123357_1000095614 250
384 3300009826 Ga0123355_10139835 Ga0123355_101398355 250
385 3300009826 Ga0123355_10386580 Ga0123355_103865801 250
386 3300010049 Ga0123356_10886208 Ga0123356_108862081 250
387 3300010167 Ga0123353_10038792 Ga0123353_100387923 250
388 3300010167 Ga0123353_10098698 Ga0123353_100986983 250
389 3300010882 Ga0123354_10016796 Ga0123354_100167967 250
390 3300010882 Ga0123354_10073975 Ga0123354_100739753 250
391 3300012805 Ga0160464_100050 Ga0160464_1000501 250
392 3300012812 Ga0160471_101531 Ga0160471_1015314 250
393 3300012812 Ga0160471_104536 Ga0160471_1045362 250
394 3300012815 Ga0160440_100274 Ga0160440_10027410 250
395 3300012815 Ga0160440_103524 Ga0160440_1035242 250
396 3300012825 Ga0160441_107022 Ga0160441_1070221 250
397 3300012831 Ga0160459_100572 Ga0160459_1005722 250
398 3300012831 Ga0160459_102003 Ga0160459_1020033 250
399 3300012831 Ga0160459_102471 Ga0160459_1024712 250
400 3300012832 Ga0160458_102670 Ga0160458_1026702 250
401 3300012834 Ga0160452_100010 Ga0160452_100010180 250
402 3300012835 Ga0160446_108111 Ga0160446_1081111 250
403 3300012839 Ga0160472_100294 Ga0160472_10029417 250
404 3300012839 Ga0160472_102130 Ga0160472_1021302 250
405 3300012845 Ga0160460_102469 Ga0160460_1024695 250
406 3300012845 Ga0160460_110486 Ga0160460_1104862 250
407 3300012847 Ga0160445_105408 Ga0160445_1054081 250
408 3300012848 Ga0160443_112153 Ga0160443_1121531 250
409 3300012849 Ga0160447_100942 Ga0160447_10094212 250
410 3300012849 Ga0160447_102187 Ga0160447_1021877 250
411 3300012849 Ga0160447_124561 Ga0160447_1245611 250
412 3300012857 Ga0160435_1004895 Ga0160435_10048953 250
413 3300012858 Ga0160457_1007118 Ga0160457_10071181 250
414 3300012861 Ga0160436_1003115 Ga0160436_10031152 250
415 3300042590 Ga0466690_109842 Ga0466690_109842_7327_8079 250
416 3300042593 Ga0466691_073049 Ga0466691_073049_17049_17801 250
417 3300042599 Ga0466706_095642 Ga0466706_095642_3863_4615 250
418 3300042606 Ga0466719_261783 Ga0466719_261783_1147_1899 250
419 3300042654 Ga0466725_156562 Ga0466725_156562_237_989 250
420 iso_pr_bacteria 2556921669 2558283113 250
421 iso_pr_bacteria 2820115951 2820119597 250
422 iso_pr_bacteria 2828301124 2828303826 250
423 iso_pr_bacteria 2864955722 2864956732 250
424 iso_pr_bacteria 8023764196 8023764981 250
425 iso_pr_bacteria 8024025509 8024031024 250
426 iso_pr_bacteria 8102087471 8102092074 250
427 iso_pr_bacteria 8102152052 8102152837 250
428 3300002931 CVPL010W_10014691 CVPL010W_100146912 251
429 3300002934 CVPL005W_1000049 CVPL005W_10000496 251
430 3300009784 Ga0123357_10004311 Ga0123357_1000431113 251
431 3300010882 Ga0123354_10174769 Ga0123354_101747692 251
432 3300012812 Ga0160471_100307 Ga0160471_1003076 251
433 3300012837 Ga0160455_106113 Ga0160455_1061132 251
434 3300042591 Ga0466692_167406 Ga0466692_167406_35673_36428 251
435 3300042601 Ga0466707_241127 Ga0466707_241127_3277_4032 251
436 3300042618 Ga0466723_124709 Ga0466723_124709_263_1018 251
437 3300042636 Ga0466703_144306 Ga0466703_144306_510_1265 251
438 3300042649 Ga0466724_10067 Ga0466724_10067_148_903 251
439 3300042649 Ga0466724_40992 Ga0466724_40992_259_1014 251
440 3300042649 Ga0466724_61642 Ga0466724_61642_148_903 251
441 3300042652 Ga0466708_029404 Ga0466708_029404_849_1604 251
442 iso_pr_bacteria 2841260384 2841263309 251
443 iso_pr_bacteria 2850131454 2850133862 251
444 iso_pr_bacteria 2864937364 2864937594 251
445 iso_pr_bacteria 2864937364 2864938615 251
446 iso_pr_bacteria 2864937364 2864942958 251
447 iso_pr_bacteria 8101676404 8101679085 251
448 iso_pr_bacteria 8101680043 8101682435 251
449 iso_pr_bacteria 8101683685 8101684089 251
450 iso_pr_bacteria 8102094248 8102100086 251
451 3300003973 Ga0063521_1000019 Ga0063521_100001978 252
452 3300012834 Ga0160452_100363 Ga0160452_10036337 252
453 3300012805 Ga0160464_106734 Ga0160464_1067342 254
454 3300012834 Ga0160452_106677 Ga0160452_1066771 254
455 iso_pr_bacteria 2864866972 2864867351 254
456 iso_pr_bacteria 2864934081 2864936930 254
457 iso_pr_bacteria 2864951976 2864952355 254
458 3300012820 Ga0160456_100003 Ga0160456_100003141 255
459 3300012841 Ga0160444_101810 Ga0160444_1018105 255
460 3300012845 Ga0160460_100091 Ga0160460_1000915 255
461 3300012846 Ga0160433_100006 Ga0160433_10000612 255
462 3300012847 Ga0160445_105719 Ga0160445_1057192 255
463 3300009826 Ga0123355_10460047 Ga0123355_104600472 258
464 3300042655 Ga0466727_258930 Ga0466727_258930_36646_37428 260
465 3300000062 IMNBL1DRAFT_c0002881 IMNBL1DRAFT_00028818 261
466 3300002932 CVPL010L_1000182 CVPL010L_100018234 265
467 3300042595 Ga0466695_304326 Ga0466695_304326_2892_3689 265
468 3300012839 Ga0160472_101651 Ga0160472_1016516 267
469 iso_pr_bacteria 8025708040 8025711720 272
470 iso_pr_bacteria 8102193924 8102197602 272

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01012 ETF Electron transfer flavoprotein domain 53 229 0.95

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.