Protein Family IF14145

Metagenome Isolate
613 Members
399 Samples
225 Scaffolds
437 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8102094248|8102102199|
Length
494 aa
Sequence
VGNTPKISWFSLTLIATGTAPALSSPHCTFLIVALTQGALLSGPFDTSLTGDTMNSIASLTNKHDLDTSQRSRAQRIKAIVGASSGNLVEWYDFYAYAFTSIYFAAAFFPTGDRTSQLMAAAGIFAVGFFMRPLGGWLFGRIADRHGRKNSMLISVLMMCSGSLMIALLPTYASIGAWAPALLLVARLVQGLSVGGEYGTAATYMSEVAGKGKRGFYSSFQYVTLIGGQLLALLVLVLLQALLSADDIKDWGWRIPFIIGAATAVVAMYLRRSLVETGSEEAMHSKEAGSLSALLKHKRSVLVVMGLTMGGSLYFYTFTTYMQKYLVNTAHMAPKTVSMVMTGVLVVFMLLQPIFGALSDRIGRRNNMLLFSGLGTLASVPLLSALGQASSPFSAFALALGALVIASFYTSISGVVKAEVFPSTVRCLGVGFTYAVGNALFGGTAEYVALSLKAAGHEAWFPWYVASLVGVGFVASLMLPDSRKKSYLDGTWNA

πŸ“Š Sample Types

Isolate 63.0%
Metagenome 37.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 20.9%
Drosophilidae 10.2%
Unclassified 9.4%
Anthocoridae 8.1%
Elmidae 6.3%
Termitidae 5.0%
Culicidae 5.0%
Curculionidae 4.7%
Apidae 4.5%
Muscidae 3.7%
Tenebrionidae 3.1%
Armadillidiidae 2.6%
Calliphoridae 1.8%
Formicidae 1.6%
Pyralidae 1.6%
Cerambycidae 1.0%
Kalotermitidae 0.8%
Dytiscidae 0.8%
Scarabaeidae 0.5%
Hydrophilidae 0.5%
Berytidae 0.5%
Aphididae 0.5%
Sarcophagidae 0.5%
Largidae 0.5%
Bombycidae 0.5%
Crambidae 0.5%
Cambaridae 0.5%
Alydidae 0.5%
Thripidae 0.3%
Anthomyiidae 0.3%
Ocypodidae 0.3%
Rhopalidae 0.3%
Noctuidae 0.3%
Carabidae 0.3%
Eresidae 0.3%
Trigoniulidae 0.3%
Passalidae 0.3%
Portunidae 0.3%
Plutellidae 0.3%
Tephritidae 0.3%
Pentatomidae 0.3%
Siricidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 543
Eukaryota 0
Viruses 0
Unclassified 70

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
2 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
3 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
4 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
5 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
6 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
7 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
8 2870004507 Campylobacter coli 14983A Isolate Unclassified
9 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
10 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
11 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
12 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
13 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
14 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
15 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
16 2958255616 Serratia marcescens TM Isolate
17 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
23 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
24 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
25 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
26 2978778678 Bacillus cereus 25 Isolate Ocypodidae
27 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
28 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
29 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
30 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
31 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
35 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
36 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
37 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
38 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
39 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
40 8071333649 Escherichia coli PN108 Isolate Calliphoridae
41 8071338694 Escherichia coli PN87 Isolate Calliphoridae
42 8073624232 Bartonella sp. W8151 Isolate Apidae
43 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
44 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
45 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
46 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
47 8102117041 Caballeronia sp. INML3 Isolate Coreidae
48 8102131453 Caballeronia sp. INML5 Isolate Coreidae
49 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
50 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
51 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
52 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
53 8102982778 Erwinia sp. S63 Isolate Curculionidae
54 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
55 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
56 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
57 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
58 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
59 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
60 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
61 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
62 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
63 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
64 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
65 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
66 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
67 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
68 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
69 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
70 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
71 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
72 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
73 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
74 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
75 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
76 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
77 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
78 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
79 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
80 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
81 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
82 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
83 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
84 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
85 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
86 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
87 8022725327 Bacillus sp. SN10 Isolate Eresidae
88 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
89 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
90 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
91 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
92 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
93 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
94 8052469819 Pseudomonas putida DZ-F23 Isolate
95 8071343737 Escherichia coli PN119 Isolate Calliphoridae
96 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
97 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
98 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
99 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
100 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
101 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
102 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
103 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
104 2864755708 Massilia timonae S00006 Isolate Elmidae
105 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
106 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
107 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
108 2871771314 Pantoea sp. Ae16 Isolate Culicidae
109 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
110 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
111 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
112 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
113 2896955351 Streptomyces sp. GF20 Isolate Termitidae
114 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
115 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
116 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
117 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
118 2645727860 Winslowiella iniecta B120 Isolate Aphididae
119 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
120 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
121 2703719240 Serratia marcescens ano2 Isolate Unclassified
122 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
123 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
124 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
125 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
126 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
127 3006156446 Acinetobacter baretiae B10A Isolate Apidae
128 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
129 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
130 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
131 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
132 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
133 648276708 Pantoea sp. aB Isolate Unclassified
134 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
135 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
136 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
137 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
138 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
139 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
140 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
141 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
142 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
143 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
144 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
145 8073617375 Bartonella apis W8098 Isolate Apidae
146 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
147 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
148 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
149 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
150 8102102351 Caballeronia sp. INML1 Isolate Coreidae
151 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
152 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
153 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
154 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
155 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
156 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
157 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
158 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
159 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
160 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
161 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
162 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
163 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
164 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
165 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
166 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
167 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
168 2912749649 Streptomyces sp. GS7 Isolate Termitidae
169 2937735258 Serratia marcescens KZ11 Isolate Apidae
170 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
171 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
172 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
173 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
174 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
175 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
176 2751185853 Bartonella apis BBC0178 Isolate Apidae
177 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
178 2969145278 Bacillus cereus 29 Isolate Portunidae
179 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
180 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
181 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
182 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
183 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
184 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
185 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
186 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
187 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
188 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
189 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
190 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
191 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
192 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
193 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
194 8023757577 Caballeronia peredens LP006 Isolate Coreidae
195 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
196 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
197 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
198 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
199 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
200 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
201 8068944069 Bartonella choladocola W8125 Isolate Apidae
202 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
203 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
204 8073628750 Bartonella sp. W8167 Isolate Apidae
205 8100181737 Kosakonia sp. S58 Isolate Curculionidae
206 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
207 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
208 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
209 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
210 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
211 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
212 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
213 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
214 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
215 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
216 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
217 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
218 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
219 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
220 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
221 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
222 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
223 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
224 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
225 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
226 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
227 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
228 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
229 2978161719 Serratia marcescens KZ2 Isolate Apidae
230 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
231 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
232 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
233 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
234 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
235 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
236 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
237 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
238 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
239 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
240 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
241 8018312681 Enterobacter sp. OLF Isolate Tephritidae
242 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
243 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
244 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
245 8069748016 Caballeronia sp. LP003 Isolate Coreidae
246 8073626464 Bartonella apis W8152 Isolate Apidae
247 8099192374 Erwinia typographi IC4 Isolate Curculionidae
248 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
249 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
250 8102109360 Caballeronia sp. INML2 Isolate Coreidae
251 8102145433 Caballeronia sp. LP006 Isolate Coreidae
252 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
253 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
254 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
255 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
256 2836714267 Shimwellia blattae NCTC10965 Isolate
257 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
258 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
259 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
260 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
261 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
262 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
263 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
264 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
265 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
266 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
267 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
268 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
269 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
270 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
271 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
272 2537562000 Bacillus cereus HD73 Isolate Pyralidae
273 2751185858 Bartonella apis BBC0122 Isolate Apidae
274 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
275 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
276 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
277 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
278 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
279 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
280 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
281 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
282 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
283 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
284 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
285 637000219 Pseudomonas entomophila L48 Isolate Unclassified
286 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
287 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
288 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
289 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
290 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
291 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
292 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
293 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
294 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
295 8071322446 Escherichia coli PN122 Isolate Calliphoridae
296 8073619611 Bartonella apis B10834G6 Isolate Apidae
297 8100171289 Kosakonia sp. S42 Isolate Curculionidae
298 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
299 8102124461 Caballeronia sp. INML3B Isolate Coreidae
300 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
301 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
302 8103002986 Erwinia sp. S38 Isolate Curculionidae
303 8103008710 Erwinia sp. S43 Isolate Curculionidae
304 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
305 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
306 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
307 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
308 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
309 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
310 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
311 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
312 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
313 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
314 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
315 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
316 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
317 2718217944 Serratia marcescens AS1 Isolate Culicidae
318 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
319 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
320 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
321 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
322 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
323 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
324 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
325 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
326 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
327 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
328 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
329 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
330 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
331 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
332 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
333 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
334 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
335 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
336 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
337 8100176769 Kosakonia sp. S57 Isolate Curculionidae
338 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
339 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
340 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
341 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
342 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
343 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
344 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
345 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
346 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
347 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
348 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
349 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
350 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
351 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
352 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
353 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
354 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
355 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
356 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
357 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
358 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
359 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
360 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
361 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
362 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
363 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
364 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
365 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
366 2547132081 Streptomyces sp. S4 Isolate Formicidae
367 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
368 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
369 2648501209 Winslowiella iniecta B149 Isolate Aphididae
370 2703719239 Serratia marcescens ano1 Isolate Unclassified
371 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
372 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
373 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
374 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
375 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
376 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
377 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
378 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
379 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
380 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
381 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
382 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
383 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
384 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
385 8004541719 Serratia marcescens KZ19 Isolate Apidae
386 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
387 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
388 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
389 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
390 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
391 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
392 8035422605 Pseudomonas monteilii CY06 Isolate
393 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
394 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
395 8073621894 Bartonella apis W8099 Isolate Apidae
396 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
397 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
398 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
399 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0053 3300056790 Bacteria 494968
2 Ga0562379_1520 3300056790 Unclassified 25935
3 Ga0562378_0054 3300056814 Bacteria 341243
4 Ga0562378_2985 3300056814 Unclassified 11779
5 Ga0562375_0316 3300056856 Unclassified 118047
6 Ga0160470_100179 3300012813 Bacteria 56481
7 Ga0160467_101111 3300012829 Unclassified 13650
8 Ga0160446_100033 3300012835 Bacteria 160075
9 Ga0160472_101030 3300012839 Bacteria 9890
10 Ga0160460_100053 3300012845 Bacteria 202960
11 Ga0160460_100527 3300012845 Unclassified 21588
12 Ga0160435_1006994 3300012857 Bacteria 2475
13 Ga0316159_10820 3300030930 Bacteria 4462
14 DPOL_contig02922 2035918003 Bacteria 4608
15 JGI24705J35276_12237942 3300002504 Bacteria 14337
16 Ga0074278_150158 3300005721 Unclassified 11068
17 Ga0104048_1002191 3300007143 Unclassified 7645
18 Ga0104050_1001897 3300007153 Bacteria 11603
19 Ga0105008_1096336 3300007507 Unclassified 2831
20 Ga0466701_017010 3300042598 Bacteria 74532
21 Ga0466730_022941 3300042625 Bacteria 238769
22 Ga0466724_37237 3300042649 Bacteria 305109
23 Ga0466724_67753 3300042649 Bacteria 2359
24 Ga0562379_0037 3300056790 Unclassified 665946
25 Ga0562375_1033 3300056856 Bacteria 43836
26 Ga0562376_0446 3300056857 Unclassified 76954
27 Ga0562376_4550 3300056857 Unclassified 11212
28 Ga0562374_1684 3300057007 Bacteria 24487
29 Ga0562374_3681 3300057007 Unclassified 7245
30 Ga0160432_100592 3300012818 Unclassified 20832
31 Ga0160446_100001 3300012835 Bacteria 625222
32 Ga0160444_100007 3300012841 Bacteria 612035
33 Ga0160460_100098 3300012845 Bacteria 124035
34 Ga0160433_104642 3300012846 Bacteria 2184
35 Ga0160445_100609 3300012847 Unclassified 15470
36 Ga0160443_100154 3300012848 Bacteria 98725
37 Ga0160447_101549 3300012849 Unclassified 8866
38 Ga0160434_100147 3300012850 Bacteria 37793
39 Ga0316159_10896 3300030930 Unclassified 11098
40 DPOL_contig04606 2035918003 Unclassified 11439
41 DPOL_contig06776 2035918003 Bacteria 51792
42 JGI24705J35276_12237140 3300002504 Bacteria 9944
43 Ga0074306_1117463 3300005309 Bacteria 3755
44 Ga0104051_1017146 3300007078 Unclassified 1687
45 Ga0104045_1002146 3300007085 Unclassified 6986
46 Ga0466697_096793 3300042611 Bacteria 9683
47 Ga0466731_356943 3300042622 Bacteria 4604
48 Ga0466730_030152 3300042625 Bacteria 41988
49 Ga0466730_044462 3300042625 Bacteria 20761
50 Ga0466724_01971 3300042649 Bacteria 27453
51 Ga0466724_28983 3300042649 Unclassified 5145
52 Ga0562378_0170 3300056814 Unclassified 162901
53 Ga0562375_0293 3300056856 Bacteria 126554
54 Ga0562375_5405 3300056856 Unclassified 7761
55 Ga0562375_6031 3300056856 Bacteria 6036
56 Ga0562376_0010 3300056857 Bacteria 898615
57 Ga0562376_5016 3300056857 Bacteria 9588
58 Ga0562374_0002 3300057007 Bacteria 3515001
59 Ga0562374_0105 3300057007 Unclassified 227040
60 Ga0160441_100054 3300012825 Bacteria 153887
61 Ga0160444_100047 3300012841 Bacteria 183558
62 Ga0160433_100029 3300012846 Bacteria 174368
63 Ga0160447_100006 3300012849 Bacteria 523520
64 Ga0160430_101766 3300012852 Unclassified 7575
65 Ga0160448_112054 3300012854 Bacteria 1720
66 Ga0160457_1000504 3300012858 Bacteria 17150
67 Ga0265387_1000204 3300024582 Bacteria 10351
68 Ga0466694_143069 3300042594 Bacteria 6271
69 FGTW_contig31611 2065487013 Bacteria 3812
70 Meta3P_1002185 3300002464 Unclassified 2985
71 Meta3P_1005570 3300002464 Bacteria 2950
72 Ga0063521_1001095 3300003973 Unclassified 8298
73 Ga0104019_1033202 3300007150 Bacteria 1875
74 Ga0466710_078403 3300042613 Bacteria 5977
75 Ga0466701_017095 3300042598 Bacteria 76328
76 Ga0466713_150448 3300042602 Unclassified 2307
77 Ga0466724_24382 3300042649 Bacteria 48265
78 Ga0466724_40729 3300042649 Bacteria 24497
79 Ga0160471_100077 3300012812 Unclassified 83047
80 Ga0530661_000046 3300056564 Bacteria 137604
81 Ga0562379_0018 3300056790 Bacteria 1119030
82 Ga0562375_1352 3300056856 Bacteria 34059
83 Ga0562374_0166 3300057007 Bacteria 152029
84 Ga0160453_101071 3300012814 Bacteria 11879
85 Ga0160469_100419 3300012824 Bacteria 21080
86 Ga0160458_102419 3300012832 Unclassified 2555
87 Ga0160460_100629 3300012845 Bacteria 17784
88 Ga0160433_102898 3300012846 Unclassified 3382
89 Ga0160447_100512 3300012849 Unclassified 18100
90 Ga0160447_101135 3300012849 Bacteria 10692
91 Ga0160447_105703 3300012849 Bacteria 3412
92 Ga0160434_100047 3300012850 Unclassified 94569
93 Ga0160448_105996 3300012854 Unclassified 3094
94 Ga0415639_100000 3300038395 Bacteria 6278
95 Ga0466657_354810 3300042582 Bacteria 1771
96 DPO_contig07628 2032320009 Bacteria 104304
97 DPOL_contig19208 2035918003 Bacteria 31872
98 Ga0466701_046810 3300042598 Bacteria 48005
99 Ga0466701_075800 3300042598 Unclassified 17618
100 Ga0466734_011332 3300042623 Bacteria 54595
101 Ga0466730_030567 3300042625 Bacteria 9324
102 Ga0466703_313734 3300042636 Bacteria 1845
103 Ga0466724_47083 3300042649 Bacteria 378486
104 Ga0123357_10096863 3300009784 Unclassified 3819
105 Ga0123353_10063034 3300010167 Bacteria 5946
106 Ga0160454_101096 3300012798 Bacteria 4614
107 Ga0466733_194017 3300042659 Bacteria 3972
108 Ga0530661_000034 3300056564 Bacteria 158771
109 Ga0562379_0001 3300056790 Bacteria 4904077
110 Ga0562379_1336 3300056790 Unclassified 29241
111 Ga0562378_0855 3300056814 Bacteria 40444
112 Ga0562377_0002 3300056842 Bacteria 4351833
113 Ga0562377_0438 3300056842 Bacteria 71236
114 Ga0562376_1212 3300056857 Bacteria 37533
115 Ga0562376_2309 3300056857 Bacteria 23221
116 Ga0562376_6222 3300056857 Unclassified 5699
117 Ga0160468_103341 3300012819 Unclassified 2233
118 Ga0160456_100039 3300012820 Bacteria 204704
119 Ga0160441_100589 3300012825 Bacteria 23421
120 Ga0160467_101006 3300012829 Unclassified 15443
121 Ga0160433_100624 3300012846 Bacteria 14444
122 Ga0160443_101210 3300012848 Bacteria 9791
123 Ga0160447_101544 3300012849 Unclassified 8879
124 Ga0160447_101821 3300012849 Unclassified 7936
125 Ga0160457_1000044 3300012858 Bacteria 205522
126 Ga0265387_1001070 3300024582 Bacteria 4062
127 Ga0466657_209837 3300042582 Bacteria 1557
128 SPBB_contig00125 2044078006 Bacteria 17926
129 FGTW_contig07926 2065487013 Unclassified 3603
130 2227480173 2225789004 Bacteria 89249
131 CVPL010L_1000729 3300002932 Unclassified 7830
132 Ga0063521_1000242 3300003973 Bacteria 37028
133 Ga0104019_1002813 3300007150 Bacteria 4340
134 Ga0105005_1283435 3300007505 Unclassified 1750
135 Ga0105008_1000026 3300007507 Unclassified 8430
136 Ga0105553_1033936 3300007767 Bacteria 8870
137 Ga0466701_035718 3300042598 Bacteria 66008
138 Ga0123354_10055936 3300010882 Bacteria 5897
139 Ga0160471_101508 3300012812 Bacteria 4526
140 Ga0562379_0043 3300056790 Bacteria 600332
141 Ga0562379_4220 3300056790 Unclassified 7767
142 Ga0562378_0342 3300056814 Unclassified 90969
143 Ga0562378_2462 3300056814 Bacteria 15231
144 Ga0562377_0219 3300056842 Bacteria 141429
145 Ga0562375_0095 3300056856 Bacteria 274307
146 Ga0562375_2563 3300056856 Bacteria 19884
147 Ga0562376_0073 3300056857 Bacteria 239892
148 Ga0562374_1121 3300057007 Bacteria 34552
149 Ga0160472_101390 3300012839 Unclassified 7259
150 Ga0160460_100010 3300012845 Bacteria 503980
151 Ga0160460_100045 3300012845 Bacteria 232961
152 Ga0160433_104726 3300012846 Bacteria 2152
153 Ga0160447_100397 3300012849 Bacteria 21623
154 Ga0160435_1000581 3300012857 Unclassified 11158
155 Ga0160435_1002661 3300012857 Unclassified 4324
156 Ga0160457_1000004 3300012858 Bacteria 638897
157 Ga0316159_11749 3300030930 Bacteria 2607
158 DPOL_contig14749 2035918003 Bacteria 17618
159 FGTW_contig26730 2065487013 Unclassified 8280
160 Ga0104019_1000035 3300007150 Bacteria 9057
161 Ga0466705_509868 3300042612 Bacteria 6195
162 Ga0466701_083531 3300042598 Bacteria 172160
163 Ga0466730_020361 3300042625 Bacteria 3723
164 Ga0466730_026965 3300042625 Bacteria 3401
165 Ga0466730_048655 3300042625 Unclassified 3321
166 Ga0123356_10267426 3300010049 Bacteria 1797
167 Ga0123354_10051921 3300010882 Bacteria 6183
168 Ga0160465_100057 3300012803 Bacteria 126446
169 Ga0562379_0120 3300056790 Bacteria 248805
170 Ga0562379_0235 3300056790 Bacteria 150481
171 Ga0160453_100112 3300012814 Bacteria 83531
172 Ga0160441_101025 3300012825 Unclassified 11879
173 Ga0160459_100012 3300012831 Bacteria 435648
174 Ga0160455_100006 3300012837 Bacteria 631412
175 Ga0160472_100033 3300012839 Bacteria 261259
176 Ga0160445_101170 3300012847 Unclassified 8146
177 Ga0160443_100018 3300012848 Bacteria 423460
178 Ga0160447_101620 3300012849 Unclassified 8591
179 Ga0160430_100022 3300012852 Bacteria 219260
180 Ga0160436_1001113 3300012861 Bacteria 7809
181 Ga0160436_1003311 3300012861 Bacteria 3956
182 Ga0247290_00453 3300035364 Unclassified 7866
183 Ga0247290_01261 3300035364 Unclassified 3049
184 Ga0466701_015671 3300042598 Bacteria 386482
185 SPBB_contig07226 2044078006 Bacteria 63389
186 Meta3P_1000177 3300002464 Unclassified 18055
187 JGI24705J35276_12234549 3300002504 Bacteria 5625
188 Ga0063521_1000145 3300003973 Bacteria 53435
189 Ga0072941_1086779 3300005201 Bacteria 1489
190 Ga0104019_1005008 3300007150 Unclassified 5452
191 Ga0105005_1033358 3300007505 Bacteria 38792
192 Ga0466701_040255 3300042598 Bacteria 2879
193 Ga0466713_141786 3300042602 Bacteria 40104
194 Ga0466724_38326 3300042649 Bacteria 5595
195 Ga0466724_56282 3300042649 Bacteria 2003
196 Ga0123356_10011519 3300010049 Bacteria 8616
197 Ga0160471_102316 3300012812 Unclassified 3212
198 Ga0562375_2050 3300056856 Unclassified 23951
199 Ga0562374_0114 3300057007 Unclassified 201948
200 Ga0160470_103575 3300012813 Bacteria 2452
201 Ga0160456_101046 3300012820 Bacteria 7212
202 Ga0160452_100109 3300012834 Bacteria 105778
203 Ga0160460_101031 3300012845 Bacteria 11323
204 Ga0160433_100055 3300012846 Bacteria 127717
205 Ga0160443_100052 3300012848 Bacteria 243926
206 Ga0160434_100367 3300012850 Bacteria 13915
207 Ga0160435_1000011 3300012857 Bacteria 218385
208 Ga0160435_1003383 3300012857 Bacteria 3782
209 Ga0316159_10426 3300030930 Bacteria 6610
210 Ga0316159_11068 3300030930 Unclassified 7256
211 Ga0316159_12405 3300030930 Unclassified 2781
212 DPO_contig07629 2032320009 Unclassified 20577
213 Ga0063521_1001516 3300003973 Unclassified 6252
214 Ga0104045_1077821 3300007085 Bacteria 1475
215 Ga0104041_1001781 3300007106 Unclassified 3387
216 Ga0105008_1118754 3300007507 Unclassified 1858
217 Ga0127649_100218 3300009460 Bacteria 28391
218 Ga0466701_039316 3300042598 Bacteria 319732
219 Ga0466713_070399 3300042602 Bacteria 88794
220 Ga0466730_019284 3300042625 Bacteria 194806
221 Ga0466730_031437 3300042625 Unclassified 37757
222 Ga0466704_619655 3300042643 Bacteria 9329
223 Ga0466724_31225 3300042649 Unclassified 40243
224 Ga0466724_59086 3300042649 Bacteria 5503
225 Ga0466724_62794 3300042649 Bacteria 39531

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007507 Ga0105008_1000026 Ga0105008_10000268 360
2 2035918003 DPOL_contig02922 DPOLB_1827360 374
3 3300007507 Ga0105008_1096336 Ga0105008_10963362 378
4 3300007507 Ga0105008_1118754 Ga0105008_11187541 378
5 3300012846 Ga0160433_102898 Ga0160433_1028981 409
6 3300012858 Ga0160457_1000504 Ga0160457_100050412 409
7 3300042598 Ga0466701_083531 Ga0466701_083531_92980_94269 409
8 3300042649 Ga0466724_01971 Ga0466724_01971_18672_19961 409
9 3300007150 Ga0104019_1005008 Ga0104019_10050082 410
10 2065487013 FGTW_contig26730 FGTW_01209460 411
11 3300042649 Ga0466724_38326 Ga0466724_38326_2513_3748 411
12 iso_pr_bacteria 2619619079 2620603508 414
13 2032320009 DPO_contig07629 DPOB_467800 415
14 2035918003 DPOL_contig19208 DPOLB_83740 415
15 3300012846 Ga0160433_104642 Ga0160433_1046422 415
16 3300002464 Meta3P_1000177 Meta3P_100017712 416
17 3300012841 Ga0160444_100007 Ga0160444_100007293 416
18 3300012852 Ga0160430_101766 Ga0160430_1017663 416
19 3300012837 Ga0160455_100006 Ga0160455_100006322 419
20 3300042649 Ga0466724_40729 Ga0466724_40729_18852_20141 419
21 3300012846 Ga0160433_100029 Ga0160433_100029150 420
22 iso_pr_bacteria 2854548700 2854549699 420
23 iso_pr_bacteria 2858119979 2858122266 420
24 iso_pr_bacteria 2870004507 2870004665 420
25 3300012825 Ga0160441_100589 Ga0160441_10058919 421
26 3300012825 Ga0160441_101025 Ga0160441_1010259 421
27 3300042625 Ga0466730_026965 Ga0466730_026965_1772_3070 421
28 3300042625 Ga0466730_031437 Ga0466730_031437_36111_37409 421
29 iso_pr_bacteria 8062647588 8062649071 421
30 iso_pr_bacteria 2619619082 2620609714 422
31 iso_pr_bacteria 2854576727 2854578667 422
32 iso_pr_bacteria 2858084324 2858085986 422
33 iso_pr_bacteria 2902668162 2902668625 422
34 iso_pr_bacteria 648276708 648768018 422
35 iso_pr_bacteria 8103002986 8103004310 422
36 iso_pr_bacteria 8103008710 8103010350 422
37 3300012839 Ga0160472_100033 Ga0160472_100033122 423
38 3300012839 Ga0160472_101390 Ga0160472_1013902 423
39 3300012845 Ga0160460_100010 Ga0160460_100010313 423
40 3300012847 Ga0160445_101170 Ga0160445_1011702 423
41 3300012850 Ga0160434_100147 Ga0160434_1001473 423
42 3300056856 Ga0562375_6031 Ga0562375_6031_2576_3895 423
43 iso_pr_bacteria 2898991528 2898992186 423
44 3300030930 Ga0316159_11749 Ga0316159_117492 424
45 iso_pr_bacteria 2597490292 2598961697 424
46 iso_pr_bacteria 2858102877 2858105248 424
47 iso_pr_bacteria 2858129007 2858129322 424
48 iso_pr_bacteria 2859315706 2859318071 424
49 iso_pr_bacteria 2868677537 2868678082 424
50 iso_pr_bacteria 2871760914 2871763651 424
51 iso_pr_bacteria 2871771314 2871773575 424
52 iso_pr_bacteria 8102982778 8102983854 424
53 iso_pr_bacteria 2834852038 2834853248 425
54 3300024582 Ga0265387_1000204 Ga0265387_100020410 426
55 3300030930 Ga0316159_10896 Ga0316159_108961 426
56 3300042602 Ga0466713_070399 Ga0466713_070399_622_1920 426
57 3300056790 Ga0562379_0043 Ga0562379_0043_432212_433510 426
58 3300057007 Ga0562374_0114 Ga0562374_0114_38052_39428 426
59 iso_pr_bacteria 2854518031 2854518238 426
60 iso_pr_bacteria 2858105562 2858107244 426
61 iso_pr_bacteria 2858110640 2858110871 426
62 iso_pr_bacteria 2868683769 2868684813 426
63 2035918003 DPOL_contig06776 DPOLB_927630 427
64 iso_pr_bacteria 2617271320 2619532720 427
65 iso_pr_bacteria 2786546124 2786627207 427
66 iso_pr_bacteria 2835335304 2835338366 427
67 iso_pr_bacteria 2837516909 2837518112 427
68 iso_pr_bacteria 2843864159 2843866069 427
69 iso_pr_bacteria 2846386538 2846390435 427
70 iso_pr_bacteria 2854520951 2854523102 427
71 iso_pr_bacteria 2864955722 2864958631 427
72 iso_pr_bacteria 2864976888 2864979334 427
73 iso_pr_bacteria 651324000 651475877 427
74 3300003973 Ga0063521_1000145 Ga0063521_100014514 428
75 3300003973 Ga0063521_1001095 Ga0063521_10010955 428
76 3300042582 Ga0466657_354810 Ga0466657_354810_287_1573 428
77 3300056857 Ga0562376_6222 Ga0562376_6222_1217_2503 428
78 iso_pr_bacteria 2828301124 2828301681 428
79 iso_pr_bacteria 2864934081 2864934248 428
80 3300012846 Ga0160433_100055 Ga0160433_100055140 429
81 3300030930 Ga0316159_12405 Ga0316159_124052 429
82 3300035364 Ga0247290_00453 Ga0247290_00453_801_2108 429
83 3300035364 Ga0247290_01261 Ga0247290_01261_797_2104 429
84 3300042598 Ga0466701_017095 Ga0466701_017095_53024_54313 429
85 3300042649 Ga0466724_62794 Ga0466724_62794_34101_35390 429
86 3300056790 Ga0562379_0235 Ga0562379_0235_111045_112394 429
87 3300056856 Ga0562375_1352 Ga0562375_1352_25834_27183 429
88 iso_pr_bacteria 2619619082 2620613256 429
89 iso_pr_bacteria 2990166910 2990171101 429
90 iso_pr_bacteria 2997878596 2997882114 429
91 iso_pr_bacteria 3007473699 3007474276 429
92 iso_pr_bacteria 3007478678 3007479415 429
93 iso_pr_bacteria 637000219 638000242 429
94 iso_pr_bacteria 648276708 648770767 429
95 iso_pr_bacteria 8011329375 8011329945 429
96 iso_pr_bacteria 8035422605 8035424421 429
97 iso_pr_bacteria 8052469819 8052472710 429
98 iso_pr_bacteria 8102087471 8102093533 429
99 2035918003 DPOL_contig04606 DPOLB_233310 430
100 3300007505 Ga0105005_1283435 Ga0105005_12834352 430
101 3300007767 Ga0105553_1033936 Ga0105553_10339367 430
102 3300012814 Ga0160453_101071 Ga0160453_1010719 430
103 3300012831 Ga0160459_100012 Ga0160459_10001212 430
104 3300012849 Ga0160447_101821 Ga0160447_1018217 430
105 3300012857 Ga0160435_1000581 Ga0160435_10005812 430
106 3300012861 Ga0160436_1003311 Ga0160436_10033112 430
107 3300042636 Ga0466703_313734 Ga0466703_313734_32_1405 430
108 3300056564 Ga0530661_000046 Ga0530661_000046_23592_24884 430
109 3300057007 Ga0562374_0105 Ga0562374_0105_188559_189935 430
110 iso_pr_bacteria 2681813507 2684381824 430
111 iso_pr_bacteria 2751185853 2753586263 430
112 iso_pr_bacteria 2864751016 2864753634 430
113 iso_pr_bacteria 8082291289 8082291952 430
114 iso_pr_bacteria 8103002986 8103008336 430
115 iso_pr_bacteria 8103008710 8103009270 430
116 2032320009 DPO_contig07628 DPOB_465590 431
117 2044078006 SPBB_contig00125 SPBB_1134170 431
118 2044078006 SPBB_contig07226 SPBB_1164990 431
119 2065487013 FGTW_contig31611 FGTW_01934820 431
120 3300010882 Ga0123354_10051921 Ga0123354_100519213 431
121 3300010882 Ga0123354_10055936 Ga0123354_100559362 431
122 3300042602 Ga0466713_141786 Ga0466713_141786_38531_39826 431
123 3300042625 Ga0466730_048655 Ga0466730_048655_1749_3044 431
124 3300042649 Ga0466724_31225 Ga0466724_31225_38612_39907 431
125 iso_pr_bacteria 2519899622 2520386835 431
126 iso_pr_bacteria 2597489944 2598060264 431
127 iso_pr_bacteria 2864745180 2864747522 431
128 iso_pr_bacteria 2864853652 2864855079 431
129 iso_pr_bacteria 2871760914 2871762551 431
130 iso_pr_bacteria 3003869270 3003870722 431
131 iso_pr_bacteria 3003878002 3003879715 431
132 iso_pr_bacteria 8018312681 8018317429 431
133 iso_pr_bacteria 8023724303 8023727187 431
134 iso_pr_bacteria 8023747282 8023748932 431
135 iso_pr_bacteria 8023752828 8023753862 431
136 iso_pr_bacteria 8023757577 8023760461 431
137 iso_pr_bacteria 8023764196 8023766782 431
138 iso_pr_bacteria 8024001094 8024004241 431
139 iso_pr_bacteria 8024014383 8024017357 431
140 iso_pr_bacteria 8024019580 8024022784 431
141 iso_pr_bacteria 8024025509 8024029245 431
142 iso_pr_bacteria 8024037630 8024040876 431
143 iso_pr_bacteria 8024044713 8024048467 431
144 iso_pr_bacteria 8025650824 8025657625 431
145 iso_pr_bacteria 8025658853 8025665300 431
146 iso_pr_bacteria 8025666332 8025670087 431
147 iso_pr_bacteria 8025671076 8025676948 431
148 iso_pr_bacteria 8025678175 8025684929 431
149 iso_pr_bacteria 8025685901 8025692770 431
150 iso_pr_bacteria 8025694439 8025701058 431
151 iso_pr_bacteria 8025701579 8025702010 431
152 iso_pr_bacteria 8025708040 8025713623 431
153 iso_pr_bacteria 8025716094 8025721046 431
154 iso_pr_bacteria 8025723035 8025727682 431
155 iso_pr_bacteria 8025728939 8025733494 431
156 iso_pr_bacteria 8025735396 8025739140 431
157 iso_pr_bacteria 8025740903 8025746282 431
158 iso_pr_bacteria 8025747911 8025753087 431
159 iso_pr_bacteria 8025756023 8025761201 431
160 iso_pr_bacteria 8069748016 8069752981 431
161 iso_pr_bacteria 8069755105 8069760281 431
162 iso_pr_bacteria 8069763219 8069768598 431
163 iso_pr_bacteria 8069770227 8069771877 431
164 iso_pr_bacteria 8069775773 8069776807 431
165 iso_pr_bacteria 8078130113 8078133351 431
166 iso_pr_bacteria 8101951471 8101954749 431
167 iso_pr_bacteria 8101960468 8101963705 431
168 iso_pr_bacteria 8101967387 8101970684 431
169 iso_pr_bacteria 8101974301 8101977477 431
170 iso_pr_bacteria 8101981714 8101984750 431
171 iso_pr_bacteria 8101988189 8101991294 431
172 iso_pr_bacteria 8101994502 8101997765 431
173 iso_pr_bacteria 8102001125 8102004100 431
174 iso_pr_bacteria 8102007614 8102010856 431
175 iso_pr_bacteria 8102014801 8102018145 431
176 iso_pr_bacteria 8102020860 8102023958 431
177 iso_pr_bacteria 8102026984 8102030123 431
178 iso_pr_bacteria 8102033761 8102037192 431
179 iso_pr_bacteria 8102041249 8102045084 431
180 iso_pr_bacteria 8102047609 8102050821 431
181 iso_pr_bacteria 8102054868 8102057764 431
182 iso_pr_bacteria 8102060671 8102064817 431
183 iso_pr_bacteria 8102067727 8102070933 431
184 iso_pr_bacteria 8102074813 8102078934 431
185 iso_pr_bacteria 8102081745 8102084795 431
186 iso_pr_bacteria 8102087471 8102091226 431
187 iso_pr_bacteria 8102094248 8102097412 431
188 iso_pr_bacteria 8102102351 8102105442 431
189 iso_pr_bacteria 8102109360 8102112509 431
190 iso_pr_bacteria 8102117041 8102120157 431
191 iso_pr_bacteria 8102124461 8102127566 431
192 iso_pr_bacteria 8102131453 8102137466 431
193 iso_pr_bacteria 8102138357 8102141493 431
194 iso_pr_bacteria 8102145433 8102148317 431
195 iso_pr_bacteria 8102152052 8102154638 431
196 iso_pr_bacteria 8102161003 8102163188 431
197 iso_pr_bacteria 8102169119 8102172863 431
198 iso_pr_bacteria 8102174626 8102179181 431
199 iso_pr_bacteria 8102181083 8102185730 431
200 iso_pr_bacteria 8102186987 8102191937 431
201 iso_pr_bacteria 8102193924 8102199505 431
202 iso_pr_bacteria 8102201977 8102202408 431
203 iso_pr_bacteria 8102208438 8102215239 431
204 iso_pr_bacteria 8102216467 8102223086 431
205 iso_pr_bacteria 8102223607 8102229479 431
206 iso_pr_bacteria 8102230706 8102237575 431
207 iso_pr_bacteria 8102239244 8102245996 431
208 iso_pr_bacteria 8102246966 8102250721 431
209 iso_pr_bacteria 8102251710 8102258157 431
210 iso_pr_bacteria 8102264549 8102267686 431
211 iso_pr_bacteria 8102271933 8102275074 431
212 iso_pr_bacteria 8102279326 8102282604 431
213 iso_pr_bacteria 8102286609 8102289863 431
214 iso_pr_bacteria 8102312426 8102315413 431
215 2065487013 FGTW_contig07926 FGTW_02339450 432
216 2225789004 2227480173 2227938095 432
217 3300002932 CVPL010L_1000729 CVPL010L_10007296 432
218 3300007150 Ga0104019_1033202 Ga0104019_10332022 432
219 3300010049 Ga0123356_10011519 Ga0123356_100115192 432
220 3300012824 Ga0160469_100419 Ga0160469_10041910 432
221 3300012829 Ga0160467_101111 Ga0160467_1011118 432
222 3300012847 Ga0160445_100609 Ga0160445_1006095 432
223 3300012849 Ga0160447_100512 Ga0160447_1005128 432
224 3300012852 Ga0160430_100022 Ga0160430_10002247 432
225 3300024582 Ga0265387_1001070 Ga0265387_10010704 432
226 3300030930 Ga0316159_10426 Ga0316159_104263 432
227 3300042625 Ga0466730_030152 Ga0466730_030152_40226_41524 432
228 3300056790 Ga0562379_0120 Ga0562379_0120_185661_186974 432
229 3300056790 Ga0562379_1336 Ga0562379_1336_20328_21641 432
230 3300056856 Ga0562375_2563 Ga0562375_2563_16155_17453 432
231 3300056856 Ga0562375_5405 Ga0562375_5405_4025_5323 432
232 3300056857 Ga0562376_0446 Ga0562376_0446_70275_71588 432
233 iso_pr_bacteria 2507262057 2507515785 432
234 iso_pr_bacteria 2519899623 2520396072 432
235 iso_pr_bacteria 2588253791 2588729356 432
236 iso_pr_bacteria 2765235945 2766084973 432
237 iso_pr_bacteria 2778261152 2779036438 432
238 iso_pr_bacteria 2778261153 2779042833 432
239 iso_pr_bacteria 2816332478 2818027698 432
240 iso_pr_bacteria 2824588292 2824593287 432
241 iso_pr_bacteria 2854536247 2854539743 432
242 iso_pr_bacteria 2864903489 2864907525 432
243 iso_pr_bacteria 2873776654 2873778898 432
244 iso_pr_bacteria 2938192669 2938193201 432
245 iso_pr_bacteria 8001059720 8001061110 432
246 iso_pr_bacteria 8004118532 8004122272 432
247 iso_pr_bacteria 8021535516 8021537501 432
248 iso_pr_bacteria 8028002147 8028005320 432
249 iso_pr_bacteria 8062647588 8062649731 432
250 iso_pr_bacteria 8065497608 8065497806 432
251 iso_pr_bacteria 8071322446 8071326548 432
252 iso_pr_bacteria 8071333649 8071337961 432
253 iso_pr_bacteria 8071338694 8071342720 432
254 iso_pr_bacteria 8071343737 8071347895 432
255 iso_pr_bacteria 8073124432 8073127274 432
256 iso_pr_bacteria 8100171289 8100176619 432
257 iso_pr_bacteria 8100176769 8100177255 432
258 iso_pr_bacteria 8100181737 8100182078 432
259 iso_pr_bacteria 8110023836 8110026680 432
260 3300007078 Ga0104051_1017146 Ga0104051_10171462 433
261 3300007106 Ga0104041_1001781 Ga0104041_10017812 433
262 3300007505 Ga0105005_1033358 Ga0105005_103335832 433
263 3300009460 Ga0127649_100218 Ga0127649_10021817 433
264 3300030930 Ga0316159_10820 Ga0316159_108204 433
265 3300042582 Ga0466657_209837 Ga0466657_209837_213_1514 433
266 3300056790 Ga0562379_0001 Ga0562379_0001_2743452_2744753 433
267 3300056842 Ga0562377_0002 Ga0562377_0002_34222_35523 433
268 3300056842 Ga0562377_0002 Ga0562377_0002_3912739_3914040 433
269 3300056842 Ga0562377_0219 Ga0562377_0219_26643_27944 433
270 iso_pr_bacteria 2513020017 2513099617 433
271 iso_pr_bacteria 2531839602 2534152826 433
272 iso_pr_bacteria 2537561600 2537924531 433
273 iso_pr_bacteria 2645727860 2647289976 433
274 iso_pr_bacteria 2648501209 2648987040 433
275 iso_pr_bacteria 2836714267 2836715289 433
276 iso_pr_bacteria 2841175817 2841177151 433
277 iso_pr_bacteria 2856068565 2856071852 433
278 iso_pr_bacteria 2858089842 2858090732 433
279 iso_pr_bacteria 2864739902 2864741610 433
280 iso_pr_bacteria 2864926767 2864927607 433
281 iso_pr_bacteria 2876334352 2876336123 433
282 iso_pr_bacteria 2876358570 2876359412 433
283 iso_pr_bacteria 2898991528 2898993056 433
284 iso_pr_bacteria 2921816052 2921820483 433
285 iso_pr_bacteria 2921842437 2921844832 433
286 iso_pr_bacteria 2937387794 2937391852 433
287 iso_pr_bacteria 2937427229 2937429375 433
288 iso_pr_bacteria 2957730672 2957734209 433
289 iso_pr_bacteria 2964846109 2964847458 433
290 iso_pr_bacteria 2964859436 2964863645 433
291 iso_pr_bacteria 2967915117 2967915351 433
292 iso_pr_bacteria 2967924226 2967924571 433
293 iso_pr_bacteria 2970322301 2970324720 433
294 iso_pr_bacteria 2970335472 2970339138 433
295 iso_pr_bacteria 2977691992 2977693302 433
296 iso_pr_bacteria 2977727922 2977729788 433
297 iso_pr_bacteria 2977745872 2977747015 433
298 iso_pr_bacteria 2979682021 2979685931 433
299 iso_pr_bacteria 3004364956 3004365257 433
300 iso_pr_bacteria 8025650824 8025655331 433
301 iso_pr_bacteria 8025658853 8025663120 433
302 iso_pr_bacteria 8025678175 8025682450 433
303 iso_pr_bacteria 8025685901 8025690724 433
304 iso_pr_bacteria 8025694439 8025698903 433
305 iso_pr_bacteria 8025708040 8025712314 433
306 iso_pr_bacteria 8102094248 8102099452 433
307 iso_pr_bacteria 8102193924 8102198196 433
308 iso_pr_bacteria 8102208438 8102212945 433
309 iso_pr_bacteria 8102216467 8102220931 433
310 iso_pr_bacteria 8102230706 8102235529 433
311 iso_pr_bacteria 8102239244 8102243517 433
312 iso_pr_bacteria 8102251710 8102255977 433
313 3300003973 Ga0063521_1000242 Ga0063521_100024243 434
314 3300012820 Ga0160456_101046 Ga0160456_1010465 434
315 3300012834 Ga0160452_100109 Ga0160452_10010999 434
316 3300012858 Ga0160457_1000004 Ga0160457_1000004511 434
317 3300042598 Ga0466701_039316 Ga0466701_039316_243581_244885 434
318 3300042625 Ga0466730_030567 Ga0466730_030567_3319_4623 434
319 3300056790 Ga0562379_0018 Ga0562379_0018_50140_51504 434
320 iso_pr_bacteria 2772190761 2772882698 434
321 iso_pr_bacteria 2833053935 2833058094 434
322 iso_pr_bacteria 2855798354 2855800179 434
323 iso_pr_bacteria 2871771314 2871772596 434
324 iso_pr_bacteria 2900132049 2900133041 434
325 iso_pr_bacteria 3006156446 3006157120 434
326 iso_pr_bacteria 8035321120 8035325538 434
327 iso_pr_bacteria 8035326735 8035329467 434
328 iso_pr_bacteria 8099192374 8099193097 434
329 iso_pr_bacteria 8102982778 8102984167 434
330 3300007085 Ga0104045_1077821 Ga0104045_10778211 435
331 3300010167 Ga0123353_10063034 Ga0123353_100630341 435
332 3300012818 Ga0160432_100592 Ga0160432_10059213 435
333 3300012819 Ga0160468_103341 Ga0160468_1033412 435
334 3300012835 Ga0160446_100033 Ga0160446_10003398 435
335 3300012845 Ga0160460_100527 Ga0160460_10052714 435
336 3300012848 Ga0160443_101210 Ga0160443_1012106 435
337 3300030930 Ga0316159_11068 Ga0316159_110682 435
338 3300042602 Ga0466713_150448 Ga0466713_150448_829_2136 435
339 3300042625 Ga0466730_020361 Ga0466730_020361_713_2020 435
340 3300056856 Ga0562375_1033 Ga0562375_1033_30283_31590 435
341 iso_pr_bacteria 2523533511 2523592933 435
342 iso_pr_bacteria 2547132081 2547293525 435
343 iso_pr_bacteria 2547132185 2547709065 435
344 iso_pr_bacteria 2551306516 2553381653 435
345 iso_pr_bacteria 2551306531 2553448762 435
346 iso_pr_bacteria 2864847319 2864848565 435
347 iso_pr_bacteria 2864903489 2864908071 435
348 iso_pr_bacteria 2864926767 2864927563 435
349 iso_pr_bacteria 2874880541 2874880544 435
350 iso_pr_bacteria 2896955351 2896961766 435
351 iso_pr_bacteria 2900132049 2900133039 435
352 iso_pr_bacteria 2900132049 2900133040 435
353 iso_pr_bacteria 3001462594 3001464013 435
354 iso_pr_bacteria 3003869270 3003874207 435
355 iso_pr_bacteria 3003878002 3003883801 435
356 iso_pr_bacteria 8065466226 8065467446 435
357 iso_pr_bacteria 8065469765 8065471237 435
358 iso_pr_bacteria 8067483258 8067487809 435
359 iso_pr_bacteria 8077783556 8077789685 435
360 3300007153 Ga0104050_1001897 Ga0104050_10018972 436
361 3300012835 Ga0160446_100001 Ga0160446_100001362 436
362 3300012845 Ga0160460_100045 Ga0160460_100045176 436
363 3300012857 Ga0160435_1000011 Ga0160435_100001155 436
364 3300042649 Ga0466724_59086 Ga0466724_59086_3828_5138 436
365 iso_pr_bacteria 2703719239 2706052618 436
366 iso_pr_bacteria 2703719240 2706057942 436
367 iso_pr_bacteria 2718217944 2719464530 436
368 iso_pr_bacteria 2847708326 2847712516 436
369 iso_pr_bacteria 2874434233 2874437435 436
370 iso_pr_bacteria 2874504452 2874508582 436
371 iso_pr_bacteria 2878947168 2878951469 436
372 iso_pr_bacteria 2922113941 2922116448 436
373 iso_pr_bacteria 2937735258 2937738008 436
374 iso_pr_bacteria 2937751072 2937753988 436
375 iso_pr_bacteria 2958255616 2958256011 436
376 iso_pr_bacteria 2961206375 2961211055 436
377 iso_pr_bacteria 2961232173 2961235071 436
378 iso_pr_bacteria 2961247850 2961252703 436
379 iso_pr_bacteria 2965197371 2965200182 436
380 iso_pr_bacteria 2970791725 2970794732 436
381 iso_pr_bacteria 2978161719 2978165680 436
382 iso_pr_bacteria 2996406003 2996408758 436
383 iso_pr_bacteria 2996467878 2996471030 436
384 iso_pr_bacteria 8004285568 8004288216 436
385 iso_pr_bacteria 8004307473 8004310038 436
386 iso_pr_bacteria 8004541719 8004544671 436
387 iso_pr_bacteria 8004571736 8004574923 436
388 iso_pr_bacteria 8004582426 8004585113 436
389 3300002464 Meta3P_1002185 Meta3P_10021852 437
390 3300002464 Meta3P_1005570 Meta3P_10055701 437
391 3300005309 Ga0074306_1117463 Ga0074306_11174631 437
392 3300007143 Ga0104048_1002191 Ga0104048_10021912 437
393 3300007150 Ga0104019_1000035 Ga0104019_10000356 437
394 3300042649 Ga0466724_37237 Ga0466724_37237_146965_148302 437
395 iso_pr_bacteria 2515154106 2515600308 437
396 iso_pr_bacteria 3001459110 3001459572 437
397 iso_pr_bacteria 8012935351 8012937165 437
398 iso_pr_bacteria 8024031916 8024035343 437
399 iso_pr_bacteria 8065462725 8065464133 437
400 iso_pr_bacteria 8074288691 8074289944 437
401 iso_pr_bacteria 8074292191 8074293564 437
402 3300012845 Ga0160460_101031 Ga0160460_1010319 438
403 3300012848 Ga0160443_100018 Ga0160443_10001873 438
404 3300042613 Ga0466710_078403 Ga0466710_078403_2260_3630 438
405 3300042625 Ga0466730_044462 Ga0466730_044462_10659_11975 438
406 3300056564 Ga0530661_000034 Ga0530661_000034_73670_75082 438
407 iso_pr_bacteria 2864847319 2864852517 438
408 iso_pr_bacteria 2997878596 2997880217 438
409 3300012845 Ga0160460_100629 Ga0160460_1006295 439
410 3300012849 Ga0160447_101544 Ga0160447_1015443 439
411 3300012857 Ga0160435_1002661 Ga0160435_10026612 439
412 3300012857 Ga0160435_1003383 Ga0160435_10033832 439
413 iso_pr_bacteria 2651870110 2653794910 439
414 iso_pr_bacteria 2751185858 2753595280 439
415 iso_pr_bacteria 2820115951 2820121116 439
416 iso_pr_bacteria 2864804954 2864808348 439
417 iso_pr_bacteria 2864840607 2864842605 439
418 iso_pr_bacteria 2864843793 2864846148 439
419 iso_pr_bacteria 2864863795 2864865674 439
420 iso_pr_bacteria 2885043073 2885045249 439
421 iso_pr_bacteria 2885046828 2885048901 439
422 iso_pr_bacteria 2885050628 2885052767 439
423 iso_pr_bacteria 2885054481 2885056579 439
424 iso_pr_bacteria 2885058212 2885060549 439
425 iso_pr_bacteria 2885061987 2885064222 439
426 iso_pr_bacteria 2885065815 2885067942 439
427 iso_pr_bacteria 2990166910 2990169770 439
428 iso_pr_bacteria 8068941587 8068941685 439
429 iso_pr_bacteria 8068944069 8068945093 439
430 iso_pr_bacteria 8073617375 8073618723 439
431 iso_pr_bacteria 8073619611 8073620633 439
432 iso_pr_bacteria 8073621894 8073622117 439
433 iso_pr_bacteria 8073624232 8073625659 439
434 iso_pr_bacteria 8073626464 8073626775 439
435 iso_pr_bacteria 8073628750 8073629936 439
436 2035918003 DPOL_contig14749 DPOLB_1965970 440
437 3300003973 Ga0063521_1001516 Ga0063521_10015161 440
438 3300005201 Ga0072941_1086779 Ga0072941_10867791 440
439 3300005721 Ga0074278_150158 Ga0074278_1501586 440
440 3300007085 Ga0104045_1002146 Ga0104045_10021465 440
441 3300007150 Ga0104019_1002813 Ga0104019_10028133 440
442 3300009784 Ga0123357_10096863 Ga0123357_100968631 440
443 3300042598 Ga0466701_075800 Ga0466701_075800_2777_4099 440
444 3300042649 Ga0466724_47083 Ga0466724_47083_198115_199437 440
445 iso_pr_bacteria 2537562000 2539436674 440
446 iso_pr_bacteria 2563367190 2565789635 440
447 iso_pr_bacteria 2822232166 2822238420 440
448 iso_pr_bacteria 2822450720 2822455956 440
449 iso_pr_bacteria 2864782175 2864783496 440
450 iso_pr_bacteria 2912849059 2912849912 440
451 iso_pr_bacteria 2916873227 2916876902 440
452 iso_pr_bacteria 2969145278 2969146689 440
453 iso_pr_bacteria 2978778678 2978780527 440
454 iso_pr_bacteria 2997878596 2997882095 440
455 iso_pr_bacteria 643886085 644678437 440
456 iso_pr_bacteria 643886087 644666220 440
457 iso_pr_bacteria 643886090 644660116 440
458 iso_pr_bacteria 643886091 644647072 440
459 iso_pr_bacteria 8011357093 8011360252 440
460 iso_pr_bacteria 8022725327 8022727528 440
461 iso_pr_bacteria 8022781829 8022784146 440
462 iso_pr_bacteria 8035321120 8035325014 440
463 iso_pr_bacteria 8035326735 8035330290 440
464 iso_pr_bacteria 8061039349 8061040996 440
465 iso_pr_bacteria 8061045771 8061052796 440
466 iso_pr_bacteria 8061100935 8061102254 440
467 3300002504 JGI24705J35276_12234549 JGI24705J35276_122345496 441
468 3300002504 JGI24705J35276_12237140 JGI24705J35276_122371407 441
469 3300012820 Ga0160456_100039 Ga0160456_100039167 441
470 3300012854 Ga0160448_105996 Ga0160448_1059962 441
471 3300042598 Ga0466701_083531 Ga0466701_083531_119972_121297 441
472 3300042623 Ga0466734_011332 Ga0466734_011332_2769_4094 441
473 3300057007 Ga0562374_0166 Ga0562374_0166_12086_13411 441
474 iso_pr_bacteria 2515154106 2515603629 441
475 iso_pr_bacteria 2864739902 2864741599 441
476 iso_pr_bacteria 2864960361 2864962245 441
477 3300010049 Ga0123356_10267426 Ga0123356_102674261 442
478 3300042598 Ga0466701_017010 Ga0466701_017010_46764_48092 442
479 3300042649 Ga0466724_56282 Ga0466724_56282_507_1835 442
480 3300012813 Ga0160470_100179 Ga0160470_10017922 443
481 3300012832 Ga0160458_102419 Ga0160458_1024192 443
482 3300012849 Ga0160447_101620 Ga0160447_1016206 443
483 3300012854 Ga0160448_112054 Ga0160448_1120542 443
484 3300012861 Ga0160436_1001113 Ga0160436_10011136 443
485 3300042598 Ga0466701_046810 Ga0466701_046810_24423_25754 443
486 3300042649 Ga0466724_24382 Ga0466724_24382_24525_25856 443
487 3300056814 Ga0562378_0855 Ga0562378_0855_24803_26218 443
488 iso_pr_bacteria 2515154100 2515558000 443
489 iso_pr_bacteria 2864870719 2864872597 443
490 3300012798 Ga0160454_101096 Ga0160454_1010963 444
491 3300012849 Ga0160447_101135 Ga0160447_1011353 444
492 3300042594 Ga0466694_143069 Ga0466694_143069_4197_5531 444
493 3300042598 Ga0466701_035718 Ga0466701_035718_56125_57459 444
494 3300042598 Ga0466701_040255 Ga0466701_040255_1316_2650 444
495 3300042622 Ga0466731_356943 Ga0466731_356943_197_1531 444
496 3300042625 Ga0466730_022941 Ga0466730_022941_214897_216231 444
497 3300056790 Ga0562379_0053 Ga0562379_0053_221041_222507 444
498 3300056790 Ga0562379_1520 Ga0562379_1520_17981_19417 444
499 3300056814 Ga0562378_0170 Ga0562378_0170_66181_67617 444
500 3300057007 Ga0562374_0002 Ga0562374_0002_254130_255596 444
501 iso_pr_bacteria 2864761044 2864763534 444
502 3300012803 Ga0160465_100057 Ga0160465_100057121 445
503 3300012825 Ga0160441_100054 Ga0160441_10005469 445
504 3300012829 Ga0160467_101006 Ga0160467_1010069 445
505 3300012848 Ga0160443_100154 Ga0160443_10015429 445
506 3300012858 Ga0160457_1000044 Ga0160457_1000044124 445
507 3300042649 Ga0466724_67753 Ga0466724_67753_34_1371 445
508 iso_pr_bacteria 2873565274 2873566007 445
509 3300002504 JGI24705J35276_12237942 JGI24705J35276_122379427 446
510 3300042611 Ga0466697_096793 Ga0466697_096793_113_1453 446
511 3300056814 Ga0562378_2985 Ga0562378_2985_9061_10485 446
512 3300056856 Ga0562375_0316 Ga0562375_0316_103413_104837 446
513 3300056856 Ga0562375_2050 Ga0562375_2050_14382_15806 446
514 iso_pr_bacteria 2864755708 2864758144 446
515 iso_pr_bacteria 3003869270 3003875167 446
516 iso_pr_bacteria 8067483258 8067488199 446
517 3300012846 Ga0160433_100624 Ga0160433_1006249 447
518 3300012846 Ga0160433_104726 Ga0160433_1047261 448
519 iso_pr_bacteria 2864816158 2864818121 448
520 iso_pr_bacteria 2864899338 2864899758 448
521 3300012812 Ga0160471_102316 Ga0160471_1023162 449
522 3300012814 Ga0160453_100112 Ga0160453_10011240 449
523 3300012849 Ga0160447_100006 Ga0160447_100006439 449
524 iso_pr_bacteria 2548876789 2549846836 449
525 3300038395 Ga0415639_100000 Ga0415639_100000_487_1839 450
526 3300056814 Ga0562378_0342 Ga0562378_0342_33737_35191 450
527 iso_pr_bacteria 2864773010 2864773231 451
528 iso_pr_bacteria 2864918810 2864920874 451
529 iso_pr_bacteria 2864964650 2864964871 451
530 3300012849 Ga0160447_105703 Ga0160447_1057033 452
531 3300056842 Ga0562377_0438 Ga0562377_0438_64901_66355 452
532 3300056857 Ga0562376_1212 Ga0562376_1212_10971_12389 452
533 3300056856 Ga0562375_0095 Ga0562375_0095_139402_140763 453
534 3300056857 Ga0562376_4550 Ga0562376_4550_9647_11008 453
535 3300057007 Ga0562374_1684 Ga0562374_1684_13391_14752 453
536 iso_pr_bacteria 8012935351 8012935450 453
537 3300012813 Ga0160470_103575 Ga0160470_1035753 454
538 3300012845 Ga0160460_100098 Ga0160460_10009810 454
539 3300012850 Ga0160434_100047 Ga0160434_10004769 454
540 iso_pr_bacteria 2724678956 2724790055 454
541 iso_pr_bacteria 2915160415 2915162788 454
542 3300042598 Ga0466701_015671 Ga0466701_015671_138153_139520 455
543 3300042625 Ga0466730_019284 Ga0466730_019284_20059_21426 455
544 3300042649 Ga0466724_28983 Ga0466724_28983_2453_3820 455
545 iso_pr_bacteria 2894897082 2894898830 456
546 iso_pr_bacteria 2894897082 2894898862 456
547 iso_pr_bacteria 2894900265 2894902754 456
548 iso_pr_bacteria 2894929448 2894931008 456
549 iso_pr_bacteria 2894932631 2894934037 456
550 iso_pr_bacteria 2894935787 2894938406 456
551 iso_pr_bacteria 2894944011 2894945681 456
552 iso_pr_bacteria 2894966443 2894968122 456
553 iso_pr_bacteria 2894974975 2894977284 456
554 iso_pr_bacteria 2894981435 2894983301 456
555 3300012845 Ga0160460_100053 Ga0160460_1000532 457
556 3300056790 Ga0562379_0037 Ga0562379_0037_25328_26701 457
557 3300056857 Ga0562376_0010 Ga0562376_0010_631616_632989 457
558 3300057007 Ga0562374_1121 Ga0562374_1121_16372_17745 457
559 iso_pr_bacteria 2671180625 2673530856 457
560 iso_pr_bacteria 2675903497 2678193308 457
561 3300012812 Ga0160471_100077 Ga0160471_10007765 458
562 3300012850 Ga0160434_100367 Ga0160434_1003672 458
563 3300056856 Ga0562375_0293 Ga0562375_0293_91342_92718 458
564 3300057007 Ga0562374_3681 Ga0562374_3681_4160_5536 458
565 iso_pr_bacteria 2912749649 2912755063 458
566 iso_pr_bacteria 8012935351 8012937696 458
567 iso_pr_bacteria 2915157839 2915158998 459
568 iso_pr_bacteria 2915160415 2915161345 459
569 3300012849 Ga0160447_101549 Ga0160447_1015494 460
570 3300012857 Ga0160435_1006994 Ga0160435_10069942 460
571 iso_pr_bacteria 2873620646 2873621165 460
572 iso_pr_bacteria 2918394494 2918397284 460
573 3300012841 Ga0160444_100047 Ga0160444_10004741 461
574 3300012848 Ga0160443_100052 Ga0160443_10005259 461
575 3300056814 Ga0562378_2462 Ga0562378_2462_4858_6243 461
576 3300056857 Ga0562376_2309 Ga0562376_2309_12666_14051 461
577 iso_pr_bacteria 2894897082 2894899150 462
578 iso_pr_bacteria 2894900265 2894901629 462
579 iso_pr_bacteria 2894926108 2894927627 462
580 iso_pr_bacteria 2894929448 2894930837 462
581 iso_pr_bacteria 2894932631 2894933166 462
582 iso_pr_bacteria 2894935787 2894937257 462
583 iso_pr_bacteria 2894944011 2894947081 462
584 iso_pr_bacteria 2894966443 2894968744 462
585 iso_pr_bacteria 2894974975 2894975443 462
586 iso_pr_bacteria 2894981435 2894981956 462
587 3300042612 Ga0466705_509868 Ga0466705_509868_2272_3666 464
588 3300056814 Ga0562378_0054 Ga0562378_0054_152288_153682 464
589 3300042643 Ga0466704_619655 Ga0466704_619655_4937_6337 466
590 iso_pr_bacteria 2873620646 2873621020 466
591 iso_pr_bacteria 8025658853 8025660000 467
592 iso_pr_bacteria 8102251710 8102252857 467
593 iso_pr_bacteria 2873614151 2873616340 470
594 iso_pr_bacteria 8025650824 8025651628 470
595 iso_pr_bacteria 8102208438 8102209242 470
596 iso_pr_bacteria 8025678175 8025678998 472
597 iso_pr_bacteria 8025694439 8025695331 472
598 iso_pr_bacteria 8102216467 8102217359 472
599 iso_pr_bacteria 8102239244 8102240067 472
600 3300012849 Ga0160447_100397 Ga0160447_10039719 473
601 iso_pr_bacteria 8025685901 8025687141 473
602 iso_pr_bacteria 8102230706 8102231946 473
603 3300056857 Ga0562376_0073 Ga0562376_0073_123057_124481 474
604 iso_pr_bacteria 8025671076 8025671910 474
605 iso_pr_bacteria 8102223607 8102224441 474
606 3300012839 Ga0160472_101030 Ga0160472_1010307 476
607 iso_pr_bacteria 2873617540 2873618408 476
608 iso_pr_bacteria 2873614151 2873616479 479
609 3300056790 Ga0562379_4220 Ga0562379_4220_4357_5811 484
610 3300056857 Ga0562376_5016 Ga0562376_5016_5676_7142 488
611 3300012812 Ga0160471_101508 Ga0160471_1015084 493
612 3300042659 Ga0466733_194017 Ga0466733_194017_1291_2772 493
613 iso_pr_bacteria 8102094248 8102102199 494

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00083 Sugar_tr Sugar (and other) transporter 81 271 0.88
PF07690 MFS_1 Major Facilitator Superfamily 103 331 0.71

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.