Protein Family IF14086

Metagenome Isolate
308 Members
211 Samples
137 Scaffolds
552.82 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8102014801|8102015641|
Length
597 aa
Sequence
MVRLSPGYQTAGDARRVSAPLSDTAVQIKYWQAWRLGFVSTSTVEQDDVALVRDSMEYDVVIVGGGPAGLSAAIRLKQLAEEKGADISVCLLEKGSEIGAHILSGAVMDPRALTELIPDWKEQGAPLNVPVTEDRFLFLSETGAKAVPNWMLPHNFKNHGNYVISLANVTRWLGTVAEAMGVEIFPGFPAAEILFNDDGSVKGVATGNMGIGKDGQPTENFQLGMELHAKYTLFCEGCRGHLGRQLNERLHLSKDSDPQVYGIGIKELWEIDPAKHQPGLVIHTAGWPLESDTYGGSYLYHTDNNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYGARAITAGGLMSLPKLVFPGGALVGDNAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQGNRKHDELTDYPEAFRKSWLHDELHRARNFKQWMSKGLYLGTLMVGIEQKLFGGSVPWTLHHRHRDHEMLKPASQCKPIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDAAVPVNVNLRAYAGPESRFCPAGVYEFVKDDSDEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM

πŸ“Š Sample Types

Isolate 55.5%
Metagenome 44.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 38.5%
Unclassified 11.5%
Elmidae 9.1%
Formicidae 6.7%
Termitidae 6.7%
Kalotermitidae 5.3%
Drosophilidae 3.4%
Culicidae 3.4%
Armadillidiidae 2.9%
Curculionidae 1.9%
Rhinotermitidae 1.4%
Berytidae 1.0%
Largidae 1.0%
Apidae 1.0%
Hydrophilidae 1.0%
Psyllidae 1.0%
Alydidae 1.0%
Termopsidae 1.0%
Pteromalidae 0.5%
Calliphoridae 0.5%
Passalidae 0.5%
Tenebrionidae 0.5%
Crambidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 292
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
2 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
3 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
4 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
5 3006242587 Vibrio sp. RE86 Isolate Unclassified
6 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
7 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
8 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
9 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
10 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
11 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
12 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
13 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
18 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
19 8069748016 Caballeronia sp. LP003 Isolate Coreidae
20 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
21 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
22 8102109360 Caballeronia sp. INML2 Isolate Coreidae
23 8102145433 Caballeronia sp. LP006 Isolate Coreidae
24 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
25 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
26 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
27 2864755708 Massilia timonae S00006 Isolate Elmidae
28 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
29 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
30 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
31 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
32 3300000460 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 Metagenome Apidae
33 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
41 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
42 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
43 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
44 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
45 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
46 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
47 8100455565 Delftia sp. S67 Isolate Curculionidae
48 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
49 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
50 8102102351 Caballeronia sp. INML1 Isolate Coreidae
51 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
52 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
53 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
54 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
55 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
56 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
57 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
58 2868169047 Comamonas aquatica S00077 Isolate Elmidae
59 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
60 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
61 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
62 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
63 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
64 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
65 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
66 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
67 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
68 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
69 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
70 8023757577 Caballeronia peredens LP006 Isolate Coreidae
71 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
72 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
73 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
74 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
75 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
76 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
77 8100461708 Delftia sp. S65 Isolate Curculionidae
78 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
79 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
80 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
81 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
82 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
83 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
84 2864791955 Aeromonas veronii S00030 Isolate Elmidae
85 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
86 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
87 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
88 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
89 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
90 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
91 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
92 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
93 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
94 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
95 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
96 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
97 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
98 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
99 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
100 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
101 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
102 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
103 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
104 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
105 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
106 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
107 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
108 2864768727 Aeromonas veronii S00020 Isolate Elmidae
109 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
110 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
111 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
112 2773857880 Candidatus Profftella armatura YCPA Isolate Psyllidae
113 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
114 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
115 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
116 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
117 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
118 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
119 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
120 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
121 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
122 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
123 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
124 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
125 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
126 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
127 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
128 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
129 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
130 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
131 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
132 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
133 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
134 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
135 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
136 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
137 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
138 2864937364 Acidovorax soli S00198 Isolate Elmidae
139 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
140 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
141 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
142 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
143 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
144 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
145 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
146 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
147 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
148 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
149 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
150 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
151 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
152 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
153 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
154 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
155 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
156 8102117041 Caballeronia sp. INML3 Isolate Coreidae
157 8102131453 Caballeronia sp. INML5 Isolate Coreidae
158 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
159 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
160 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
161 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
162 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
163 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
164 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
165 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
166 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
167 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
168 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
169 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
170 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
171 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
172 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
173 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
174 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
175 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
176 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
177 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
178 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
179 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
180 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
181 8100449422 Delftia sp. S66 Isolate Curculionidae
182 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
183 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
184 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
185 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
186 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
187 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
188 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
189 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
190 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
191 2565956547 Candidatus Profftella armatura Isolate Psyllidae
192 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
193 2603880165 Burkholderiales A1 Isolate Unclassified
194 2603880170 Burkholderiales A2 Isolate Unclassified
195 2603880172 Burkholderiales C Isolate Unclassified
196 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
197 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
198 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
199 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
200 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
201 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
202 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
203 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
204 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
205 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
206 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
207 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
208 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
209 8102124461 Caballeronia sp. INML3B Isolate Coreidae
210 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
211 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10013280 3300010049 Bacteria 7958
2 Ga0466701_045808 3300042598 Bacteria 3788
3 Ga0466703_319537 3300042636 Bacteria 18153
4 Ga0466724_67423 3300042649 Bacteria 11419
5 Ga0466708_354131 3300042652 Bacteria 2934
6 Ga0466725_129448 3300042654 Bacteria 92830
7 2227358553 2225789004 Bacteria 121621
8 JGI24705J35276_12238357 3300002504 Bacteria 19944
9 CVPL010W_10003108 3300002931 Bacteria 20947
10 Ga0074278_109125 3300005721 Bacteria 5460
11 Ga0102734_1000315 3300007129 Bacteria 14446
12 Ga0103268_1002708 3300007192 Unclassified 3869
13 Ga0466726_244774 3300042619 Bacteria 12649
14 Ga0123354_10000317 3300010882 Bacteria 44262
15 Ga0160464_100127 3300012805 Bacteria 86084
16 Ga0160470_100374 3300012813 Bacteria 22445
17 Ga0160440_100022 3300012815 Bacteria 270723
18 Ga0160456_100239 3300012820 Unclassified 27715
19 Ga0160456_100591 3300012820 Unclassified 10891
20 Ga0160459_100120 3300012831 Unclassified 60956
21 Ga0160458_102471 3300012832 Bacteria 2515
22 Ga0160444_100053 3300012841 Bacteria 166531
23 Ga0160444_100221 3300012841 Unclassified 49006
24 Ga0160447_100400 3300012849 Bacteria 21508
25 Ga0466690_109842 3300042590 Bacteria 9167
26 Ga0466691_159396 3300042593 Bacteria 9478
27 Ga0466695_225508 3300042595 Bacteria 3939
28 Ga0466701_049822 3300042598 Bacteria 24808
29 Ga0466713_015935 3300042602 Bacteria 2359
30 Ga0466716_372900 3300042605 Bacteria 2108
31 Ga0466730_030162 3300042625 Bacteria 1792
32 Ga0466704_184201 3300042643 Bacteria 2847
33 Ga0466704_616674 3300042643 Bacteria 2343
34 Ga0466725_370639 3300042654 Bacteria 3998
35 Ga0466725_417003 3300042654 Bacteria 7426
36 Ga0102734_1007291 3300007129 Bacteria 2496
37 Ga0103264_1000480 3300007188 Bacteria 22479
38 Ga0103264_1000918 3300007188 Bacteria 24747
39 Ga0103264_1027914 3300007188 Bacteria 2645
40 Ga0160447_105302 3300012849 Unclassified 3628
41 Ga0466696_270776 3300042596 Bacteria 14952
42 Ga0466734_154274 3300042623 Bacteria 3243
43 Ga0466724_55683 3300042649 Bacteria 8504
44 Ga0466708_114385 3300042652 Bacteria 5417
45 JGI24705J35276_12238350 3300002504 Bacteria 19798
46 CVPL010W_10015023 3300002931 Bacteria 5701
47 CVPL010W_10029078 3300002931 Bacteria 2325
48 CVPL005W_1000448 3300002934 Bacteria 16571
49 Ga0102739_1001096 3300007095 Bacteria 4620
50 Ga0102737_1000442 3300007142 Bacteria 13669
51 Ga0466715_312256 3300042616 Bacteria 2671
52 Ga0466723_130492 3300042618 Bacteria 9199
53 Ga0160468_100034 3300012819 Bacteria 232419
54 Ga0160467_100035 3300012829 Bacteria 221416
55 Ga0466696_079449 3300042596 Bacteria 4106
56 Ga0466701_025086 3300042598 Bacteria 26396
57 Ga0466730_023906 3300042625 Bacteria 118383
58 Ga0466709_262544 3300042648 Bacteria 2208
59 CVPL005W_1000591 3300002934 Bacteria 13531
60 Ga0063521_1000019 3300003973 Bacteria 139495
61 Ga0102736_1000500 3300007052 Bacteria 12005
62 Ga0103261_1000127 3300007083 Bacteria 13703
63 Ga0103264_1000005 3300007188 Bacteria 151532
64 Ga0466710_003215 3300042613 Unclassified 26277
65 Ga0466729_139503 3300042621 Bacteria 2906
66 Ga0160471_100575 3300012812 Unclassified 9757
67 Ga0160459_103008 3300012831 Unclassified 2525
68 Ga0160460_100085 3300012845 Bacteria 136620
69 Ga0160433_100357 3300012846 Bacteria 26972
70 Ga0466657_012444 3300042582 Bacteria 321104
71 Ga0466717_227339 3300042604 Bacteria 7911
72 Ga0466734_016069 3300042623 Bacteria 26526
73 Ga0466730_030029 3300042625 Bacteria 423027
74 Ga0466724_46819 3300042649 Bacteria 306737
75 Ga0466725_267511 3300042654 Bacteria 13384
76 SCG598O02_11474 3300000460 Bacteria 36366
77 JGI24705J35276_12222200 3300002504 Bacteria 2401
78 Ga0102735_1000016 3300007080 Bacteria 52643
79 Ga0102739_1003343 3300007095 Bacteria 2363
80 Ga0104041_1000909 3300007106 Bacteria 17276
81 Ga0102740_1001160 3300007140 Bacteria 6872
82 Ga0102740_1002194 3300007140 Unclassified 4593
83 Ga0102737_1000045 3300007142 Bacteria 35604
84 Ga0103264_1001854 3300007188 Bacteria 9400
85 Ga0103264_1019834 3300007188 Bacteria 3269
86 Ga0103267_1000152 3300007190 Bacteria 27149
87 Ga0123357_10000453 3300009784 Bacteria 39621
88 Ga0123354_10053566 3300010882 Unclassified 6067
89 Ga0160464_100224 3300012805 Unclassified 55897
90 Ga0160440_100074 3300012815 Bacteria 121934
91 Ga0160459_100395 3300012831 Bacteria 18203
92 Ga0160472_102220 3300012839 Bacteria 4569
93 Ga0160445_100001 3300012847 Bacteria 765249
94 Ga0466717_069670 3300042604 Unclassified 3394
95 Ga0466722_004257 3300042609 Bacteria 4479
96 Ga0466735_153631 3300042624 Bacteria 2730
97 Ga0466704_012791 3300042643 Bacteria 8912
98 Ga0466724_27834 3300042649 Unclassified 5930
99 JGI24705J35276_12235965 3300002504 Bacteria 7233
100 Ga0103266_1000001 3300007067 Bacteria 138973
101 Ga0102737_1000403 3300007142 Bacteria 14574
102 Ga0466715_018363 3300042616 Bacteria 4634
103 Ga0123354_10057799 3300010882 Bacteria 5773
104 Ga0160467_100238 3300012829 Bacteria 68691
105 Ga0466693_066850 3300042592 Bacteria 2804
106 Ga0466691_115414 3300042593 Bacteria 2077
107 Ga0466701_016971 3300042598 Unclassified 71478
108 Ga0466703_175071 3300042636 Bacteria 2481
109 Ga0466704_066993 3300042643 Bacteria 4630
110 Ga0466724_16154 3300042649 Bacteria 19441
111 Ga0466724_29704 3300042649 Bacteria 15292
112 Ga0466724_63720 3300042649 Bacteria 129732
113 CVPL010W_10023250 3300002931 Unclassified 3205
114 CVPL010W_10028888 3300002931 Bacteria 2349
115 Ga0103264_1021051 3300007188 Bacteria 3165
116 Ga0103268_1000143 3300007192 Bacteria 45376
117 Ga0466710_092386 3300042613 Bacteria 4378
118 Ga0466710_247030 3300042613 Bacteria 5556
119 Ga0530661_000967 3300056564 Bacteria 16957
120 Ga0160431_100035 3300012828 Bacteria 118984
121 Ga0160445_100092 3300012847 Bacteria 91124
122 Ga0466701_089505 3300042598 Bacteria 28812
123 Ga0466722_016785 3300042609 Bacteria 14806
124 Ga0466734_005640 3300042623 Bacteria 2867
125 Ga0466703_416603 3300042636 Bacteria 2744
126 Ga0466708_261851 3300042652 Bacteria 27510
127 Ga0466725_095288 3300042654 Bacteria 30521
128 Ga0466725_398419 3300042654 Bacteria 4104
129 CVPL010W_10000127 3300002931 Bacteria 74707
130 CVPL010W_10009181 3300002931 Bacteria 9069
131 CVPL005L_10001082 3300002938 Bacteria 37702
132 Ga0102734_1009295 3300007129 Bacteria 2261
133 Ga0103264_1000193 3300007188 Bacteria 58174
134 Ga0103264_1000588 3300007188 Bacteria 17801
135 Ga0123357_10000011 3300009784 Bacteria 173575
136 Ga0123357_10000362 3300009784 Bacteria 42826
137 Ga0466705_418382 3300042612 Bacteria 8300

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042595 Ga0466695_225508 Ga0466695_225508_2547_3929 460
2 iso_pr_bacteria 2597489902 2597922947 460
3 iso_pr_bacteria 8025708040 8025715922 485
4 iso_pr_bacteria 8102193924 8102201805 485
5 iso_pr_bacteria 2820132692 2820132921 490
6 iso_pr_bacteria 2820115951 2820117449 495
7 3300009784 Ga0123357_10000453 Ga0123357_1000045332 496
8 iso_pr_bacteria 2681813507 2684384225 511
9 3300042649 Ga0466724_27834 Ga0466724_27834_3279_4910 519
10 3300012832 Ga0160458_102471 Ga0160458_1024712 521
11 3300042654 Ga0466725_129448 Ga0466725_129448_16741_18375 528
12 3300042636 Ga0466703_319537 Ga0466703_319537_2362_3999 531
13 3300042613 Ga0466710_003215 Ga0466710_003215_13529_15172 532
14 3300042649 Ga0466724_16154 Ga0466724_16154_1043_2674 533
15 3300042643 Ga0466704_184201 Ga0466704_184201_138_1772 534
16 3300042625 Ga0466730_030162 Ga0466730_030162_167_1774 535
17 iso_pr_bacteria 8025728939 8025730133 535
18 iso_pr_bacteria 8102174626 8102175820 535
19 3300002931 CVPL010W_10009181 CVPL010W_100091811 536
20 3300042652 Ga0466708_114385 Ga0466708_114385_304_1950 536
21 3300042652 Ga0466708_261851 Ga0466708_261851_1149_2867 536
22 3300002931 CVPL010W_10023250 CVPL010W_100232502 538
23 3300002934 CVPL005W_1000448 CVPL005W_10004482 538
24 3300007083 Ga0103261_1000127 Ga0103261_10001272 538
25 3300007188 Ga0103264_1000918 Ga0103264_100091817 538
26 iso_pr_bacteria 2891720358 2891720689 540
27 3300007095 Ga0102739_1001096 Ga0102739_10010964 541
28 3300042593 Ga0466691_159396 Ga0466691_159396_7626_9251 541
29 3300042623 Ga0466734_154274 Ga0466734_154274_1586_3211 541
30 3300007188 Ga0103264_1000480 Ga0103264_100048018 542
31 3300007188 Ga0103264_1021051 Ga0103264_10210511 542
32 3300042593 Ga0466691_115414 Ga0466691_115414_56_1684 542
33 3300042613 Ga0466710_092386 Ga0466710_092386_313_1941 542
34 3300042636 Ga0466703_175071 Ga0466703_175071_641_2287 542
35 iso_pr_bacteria 2864764899 2864766061 542
36 iso_pr_bacteria 2864768727 2864769854 542
37 iso_pr_bacteria 2864791955 2864792012 542
38 iso_pr_bacteria 2864796242 2864799663 542
39 3300003973 Ga0063521_1000019 Ga0063521_100001976 543
40 3300012812 Ga0160471_100575 Ga0160471_1005752 543
41 3300012815 Ga0160440_100074 Ga0160440_100074108 543
42 3300012820 Ga0160456_100239 Ga0160456_10023919 543
43 3300012829 Ga0160467_100035 Ga0160467_10003585 543
44 3300012839 Ga0160472_102220 Ga0160472_1022203 544
45 3300042605 Ga0466716_372900 Ga0466716_372900_171_1805 544
46 3300042609 Ga0466722_004257 Ga0466722_004257_599_2233 544
47 3300042616 Ga0466715_018363 Ga0466715_018363_571_2205 544
48 3300042619 Ga0466726_244774 Ga0466726_244774_10545_12179 544
49 3300042621 Ga0466729_139503 Ga0466729_139503_732_2366 544
50 3300042643 Ga0466704_012791 Ga0466704_012791_6962_8596 544
51 3300042643 Ga0466704_066993 Ga0466704_066993_2569_4203 544
52 3300042643 Ga0466704_616674 Ga0466704_616674_119_1753 544
53 iso_pr_bacteria 2556921622 2558099811 544
54 iso_pr_bacteria 2864859030 2864861630 544
55 iso_pr_bacteria 2864914039 2864916953 544
56 iso_pr_bacteria 2864988360 2864990426 544
57 3300042590 Ga0466690_109842 Ga0466690_109842_2728_4365 545
58 3300042604 Ga0466717_069670 Ga0466717_069670_182_1819 545
59 3300042616 Ga0466715_312256 Ga0466715_312256_338_1975 545
60 iso_pr_bacteria 2820123897 2820125058 545
61 3300012815 Ga0160440_100022 Ga0160440_100022200 546
62 3300012831 Ga0160459_103008 Ga0160459_1030081 546
63 3300007052 Ga0102736_1000500 Ga0102736_10005006 547
64 3300012831 Ga0160459_100395 Ga0160459_1003958 547
65 3300042582 Ga0466657_012444 Ga0466657_012444_246655_248298 547
66 3300042654 Ga0466725_095288 Ga0466725_095288_25553_27196 547
67 iso_pr_bacteria 2820084079 2820084613 547
68 iso_pr_bacteria 2820086750 2820088057 547
69 iso_pr_bacteria 2820103659 2820104541 547
70 iso_pr_bacteria 2820152154 2820152652 547
71 iso_pr_bacteria 2864777284 2864778106 547
72 iso_pr_bacteria 8025685901 8025690387 547
73 iso_pr_bacteria 8102230706 8102235192 547
74 3300009784 Ga0123357_10000362 Ga0123357_100003626 548
75 3300010049 Ga0123356_10013280 Ga0123356_100132805 548
76 3300010882 Ga0123354_10000317 Ga0123354_100003176 548
77 3300042596 Ga0466696_270776 Ga0466696_270776_7933_9579 548
78 3300042618 Ga0466723_130492 Ga0466723_130492_3484_5130 548
79 3300042648 Ga0466709_262544 Ga0466709_262544_206_1852 548
80 iso_pr_bacteria 2603880165 2606015234 548
81 iso_pr_bacteria 2603880170 2606029473 548
82 iso_pr_bacteria 2603880172 2606033587 548
83 iso_pr_bacteria 2687453742 2689989417 548
84 iso_pr_bacteria 2687453753 2690036938 548
85 iso_pr_bacteria 2855798354 2855802526 548
86 3300002931 CVPL010W_10003108 CVPL010W_1000310811 549
87 3300002931 CVPL010W_10028888 CVPL010W_100288882 549
88 3300002931 CVPL010W_10029078 CVPL010W_100290782 549
89 3300002938 CVPL005L_10001082 CVPL005L_100010829 549
90 3300007140 Ga0102740_1001160 Ga0102740_10011603 549
91 3300007142 Ga0102737_1000045 Ga0102737_100004523 549
92 3300007142 Ga0102737_1000403 Ga0102737_10004037 549
93 3300007188 Ga0103264_1000005 Ga0103264_100000514 549
94 3300007188 Ga0103264_1000193 Ga0103264_100019357 549
95 3300007188 Ga0103264_1000588 Ga0103264_100058815 549
96 3300007188 Ga0103264_1001854 Ga0103264_10018545 549
97 3300007188 Ga0103264_1019834 Ga0103264_10198342 549
98 3300007188 Ga0103264_1027914 Ga0103264_10279142 549
99 3300012805 Ga0160464_100224 Ga0160464_1002243 549
100 3300012819 Ga0160468_100034 Ga0160468_10003419 549
101 3300012841 Ga0160444_100053 Ga0160444_10005364 549
102 3300012847 Ga0160445_100092 Ga0160445_10009263 549
103 3300042598 Ga0466701_045808 Ga0466701_045808_1845_3494 549
104 3300042612 Ga0466705_418382 Ga0466705_418382_209_1858 549
105 iso_pr_bacteria 2864751016 2864751290 549
106 3300042596 Ga0466696_079449 Ga0466696_079449_653_2305 550
107 3300042609 Ga0466722_016785 Ga0466722_016785_8768_10420 550
108 iso_pr_bacteria 2571042003 2571062200 550
109 iso_pr_bacteria 2820082748 2820083614 550
110 iso_pr_bacteria 2820093073 2820093117 550
111 iso_pr_bacteria 2828301124 2828302508 550
112 iso_pr_bacteria 2864955722 2864957912 550
113 3300010882 Ga0123354_10053566 Ga0123354_100535665 551
114 3300012845 Ga0160460_100085 Ga0160460_1000854 551
115 3300012846 Ga0160433_100357 Ga0160433_10035713 551
116 3300042636 Ga0466703_416603 Ga0466703_416603_434_2089 551
117 3300056564 Ga0530661_000967 Ga0530661_000967_4750_6405 551
118 iso_pr_bacteria 2864808494 2864810640 551
119 iso_pr_bacteria 2864812326 2864814430 551
120 3300000460 SCG598O02_11474 SCG598O02_1147422 552
121 3300009784 Ga0123357_10000011 Ga0123357_10000011100 552
122 3300012820 Ga0160456_100591 Ga0160456_1005916 552
123 3300012831 Ga0160459_100120 Ga0160459_10012045 552
124 3300012847 Ga0160445_100001 Ga0160445_100001304 552
125 iso_pr_bacteria 3006242587 3006246227 552
126 3300002504 JGI24705J35276_12222200 JGI24705J35276_122222002 553
127 3300002504 JGI24705J35276_12238357 JGI24705J35276_1223835713 553
128 3300002504 JGI24705J35276_12238350 JGI24705J35276_1223835013 554
129 3300005721 Ga0074278_109125 Ga0074278_1091251 555
130 iso_pr_bacteria 8102047609 8102053646 555
131 3300042624 Ga0466735_153631 Ga0466735_153631_759_2429 556
132 iso_pr_bacteria 2834230000 2834230190 556
133 iso_pr_bacteria 2597489944 2598057200 557
134 iso_pr_bacteria 3003869270 3003870344 557
135 iso_pr_bacteria 3003869270 3003875860 557
136 iso_pr_bacteria 3003878002 3003879187 557
137 iso_pr_bacteria 3003878002 3003888849 557
138 iso_pr_bacteria 8023724303 8023729203 557
139 iso_pr_bacteria 8023747282 8023752311 557
140 iso_pr_bacteria 8023752828 8023755403 557
141 iso_pr_bacteria 8023757577 8023762477 557
142 iso_pr_bacteria 8023764196 8023766406 557
143 iso_pr_bacteria 8024001094 8024002211 557
144 iso_pr_bacteria 8024014383 8024015402 557
145 iso_pr_bacteria 8024019580 8024021352 557
146 iso_pr_bacteria 8024025509 8024027251 557
147 iso_pr_bacteria 8024037630 8024038692 557
148 iso_pr_bacteria 8024044713 8024045760 557
149 iso_pr_bacteria 8025650824 8025651849 557
150 iso_pr_bacteria 8025658853 8025660229 557
151 iso_pr_bacteria 8025666332 8025667386 557
152 iso_pr_bacteria 8025671076 8025672141 557
153 iso_pr_bacteria 8025678175 8025679239 557
154 iso_pr_bacteria 8025685901 8025687370 557
155 iso_pr_bacteria 8025694439 8025695552 557
156 iso_pr_bacteria 8025701579 8025704062 557
157 iso_pr_bacteria 8025701579 8025707340 557
158 iso_pr_bacteria 8025708040 8025709178 557
159 iso_pr_bacteria 8025708040 8025711600 557
160 iso_pr_bacteria 8025708040 8025715534 557
161 iso_pr_bacteria 8025716094 8025717449 557
162 iso_pr_bacteria 8025723035 8025724045 557
163 iso_pr_bacteria 8025735396 8025737890 557
164 iso_pr_bacteria 8025740903 8025741939 557
165 iso_pr_bacteria 8025747911 8025749064 557
166 iso_pr_bacteria 8025756023 8025757176 557
167 iso_pr_bacteria 8069748016 8069750819 557
168 iso_pr_bacteria 8069755105 8069756258 557
169 iso_pr_bacteria 8069763219 8069764255 557
170 iso_pr_bacteria 8069770227 8069775256 557
171 iso_pr_bacteria 8069775773 8069778348 557
172 iso_pr_bacteria 8078130113 8078131220 557
173 iso_pr_bacteria 8078130113 8078135657 557
174 iso_pr_bacteria 8101951471 8101952592 557
175 iso_pr_bacteria 8101960468 8101961591 557
176 iso_pr_bacteria 8101967387 8101968509 557
177 iso_pr_bacteria 8101974301 8101975413 557
178 iso_pr_bacteria 8101981714 8101982847 557
179 iso_pr_bacteria 8101988189 8101989402 557
180 iso_pr_bacteria 8101994502 8101995852 557
181 iso_pr_bacteria 8102001125 8102002114 557
182 iso_pr_bacteria 8102007614 8102008694 557
183 iso_pr_bacteria 8102014801 8102015881 557
184 iso_pr_bacteria 8102020860 8102022277 557
185 iso_pr_bacteria 8102026984 8102028167 557
186 iso_pr_bacteria 8102033761 8102035090 557
187 iso_pr_bacteria 8102041249 8102042298 557
188 iso_pr_bacteria 8102041249 8102047099 557
189 iso_pr_bacteria 8102047609 8102048828 557
190 iso_pr_bacteria 8102054868 8102055964 557
191 iso_pr_bacteria 8102060671 8102061957 557
192 iso_pr_bacteria 8102067727 8102068882 557
193 iso_pr_bacteria 8102074813 8102076028 557
194 iso_pr_bacteria 8102081745 8102082967 557
195 iso_pr_bacteria 8102087471 8102088603 557
196 iso_pr_bacteria 8102094248 8102095637 557
197 iso_pr_bacteria 8102094248 8102101723 557
198 iso_pr_bacteria 8102102351 8102103418 557
199 iso_pr_bacteria 8102109360 8102110441 557
200 iso_pr_bacteria 8102117041 8102118074 557
201 iso_pr_bacteria 8102124461 8102125697 557
202 iso_pr_bacteria 8102131453 8102131608 557
203 iso_pr_bacteria 8102138357 8102139417 557
204 iso_pr_bacteria 8102145433 8102150333 557
205 iso_pr_bacteria 8102152052 8102154262 557
206 iso_pr_bacteria 8102161003 8102165966 557
207 iso_pr_bacteria 8102169119 8102171613 557
208 iso_pr_bacteria 8102181083 8102182093 557
209 iso_pr_bacteria 8102186987 8102188343 557
210 iso_pr_bacteria 8102193924 8102195061 557
211 iso_pr_bacteria 8102193924 8102197482 557
212 iso_pr_bacteria 8102193924 8102201416 557
213 iso_pr_bacteria 8102201977 8102204460 557
214 iso_pr_bacteria 8102201977 8102207738 557
215 iso_pr_bacteria 8102208438 8102209463 557
216 iso_pr_bacteria 8102216467 8102217580 557
217 iso_pr_bacteria 8102223607 8102224672 557
218 iso_pr_bacteria 8102230706 8102232175 557
219 iso_pr_bacteria 8102239244 8102240307 557
220 iso_pr_bacteria 8102246966 8102248020 557
221 iso_pr_bacteria 8102251710 8102253086 557
222 iso_pr_bacteria 8102264549 8102265770 557
223 iso_pr_bacteria 8102271933 8102273231 557
224 iso_pr_bacteria 8102279326 8102280421 557
225 iso_pr_bacteria 8102286609 8102287902 557
226 iso_pr_bacteria 8102312426 8102313554 557
227 3300012805 Ga0160464_100127 Ga0160464_10012742 558
228 iso_pr_bacteria 2864755708 2864758936 558
229 iso_pr_bacteria 2864968865 2864969231 558
230 iso_pr_bacteria 8102087471 8102091998 558
231 iso_pr_bacteria 3003869270 3003869876 559
232 iso_pr_bacteria 8023764196 8023771087 559
233 iso_pr_bacteria 8024031916 8024033040 559
234 iso_pr_bacteria 8078130113 8078133258 559
235 3300042602 Ga0466713_015935 Ga0466713_015935_626_2308 560
236 3300042649 Ga0466724_67423 Ga0466724_67423_9704_11386 560
237 iso_pr_bacteria 2529292851 2530235114 560
238 iso_pr_bacteria 2841260384 2841263311 560
239 iso_pr_bacteria 2850131454 2850133860 560
240 iso_pr_bacteria 2896187957 2896191594 560
241 iso_pr_bacteria 8101676404 8101679087 560
242 iso_pr_bacteria 8101680043 8101682433 560
243 iso_pr_bacteria 8101683685 8101684091 560
244 iso_pr_bacteria 2537561600 2537923681 561
245 iso_pr_bacteria 2565956547 2566132029 561
246 iso_pr_bacteria 2773857880 2774724998 561
247 3300007106 Ga0104041_1000909 Ga0104041_10009092 562
248 iso_pr_bacteria 2518285616 2518643301 563
249 3300042592 Ga0466693_066850 Ga0466693_066850_108_1802 564
250 3300042654 Ga0466725_398419 Ga0466725_398419_2230_3924 564
251 3300042654 Ga0466725_417003 Ga0466725_417003_213_1907 564
252 iso_pr_bacteria 8025701579 8025707582 564
253 iso_pr_bacteria 8025728939 8025732310 564
254 iso_pr_bacteria 8102014801 8102019654 564
255 iso_pr_bacteria 8102174626 8102177997 564
256 iso_pr_bacteria 8102201977 8102207980 564
257 2225789004 2227358553 2227804778 565
258 3300042623 Ga0466734_016069 Ga0466734_016069_20125_21822 565
259 3300012849 Ga0160447_100400 Ga0160447_1004002 566
260 3300042598 Ga0466701_016971 Ga0466701_016971_44069_45769 566
261 3300042598 Ga0466701_049822 Ga0466701_049822_465_2165 566
262 3300042598 Ga0466701_089505 Ga0466701_089505_7993_9693 566
263 3300042604 Ga0466717_227339 Ga0466717_227339_3601_5301 566
264 3300042613 Ga0466710_247030 Ga0466710_247030_1108_2808 566
265 3300042623 Ga0466734_005640 Ga0466734_005640_527_2227 566
266 3300042625 Ga0466730_030029 Ga0466730_030029_250032_251732 566
267 3300042654 Ga0466725_267511 Ga0466725_267511_4852_6552 566
268 3300042654 Ga0466725_370639 Ga0466725_370639_1668_3368 566
269 iso_pr_bacteria 2820059968 2820061050 566
270 iso_pr_bacteria 2868169047 2868169978 566
271 iso_pr_bacteria 8100449422 8100453020 566
272 iso_pr_bacteria 8100455565 8100456663 566
273 iso_pr_bacteria 8100461708 8100465693 566
274 3300002504 JGI24705J35276_12235965 JGI24705J35276_122359652 567
275 3300007067 Ga0103266_1000001 Ga0103266_100000140 567
276 3300007080 Ga0102735_1000016 Ga0102735_100001621 567
277 3300007095 Ga0102739_1003343 Ga0102739_10033431 567
278 3300007129 Ga0102734_1000315 Ga0102734_10003156 567
279 3300007129 Ga0102734_1007291 Ga0102734_10072913 567
280 3300007192 Ga0103268_1000143 Ga0103268_100014314 567
281 3300010882 Ga0123354_10057799 Ga0123354_100577996 567
282 3300012813 Ga0160470_100374 Ga0160470_10037419 567
283 3300012829 Ga0160467_100238 Ga0160467_10023845 567
284 3300012841 Ga0160444_100221 Ga0160444_10022140 567
285 3300012849 Ga0160447_105302 Ga0160447_1053023 567
286 3300042598 Ga0466701_025086 Ga0466701_025086_16029_17732 567
287 3300042625 Ga0466730_023906 Ga0466730_023906_31977_33680 567
288 3300042649 Ga0466724_29704 Ga0466724_29704_4936_6639 567
289 3300002934 CVPL005W_1000591 CVPL005W_10005916 568
290 3300007140 Ga0102740_1002194 Ga0102740_10021943 568
291 3300012828 Ga0160431_100035 Ga0160431_10003551 568
292 3300042649 Ga0466724_46819 Ga0466724_46819_166134_167840 568
293 3300042649 Ga0466724_55683 Ga0466724_55683_717_2423 568
294 3300042649 Ga0466724_63720 Ga0466724_63720_58629_60335 568
295 iso_pr_bacteria 2864826666 2864826930 568
296 iso_pr_bacteria 2864870719 2864874750 568
297 iso_pr_bacteria 2864937364 2864944103 568
298 iso_pr_bacteria 2864960361 2864964391 568
299 iso_pr_bacteria 2873565274 2873566938 568
300 iso_pr_bacteria 2873571580 2873576494 568
301 3300007129 Ga0102734_1009295 Ga0102734_10092952 569
302 3300007192 Ga0103268_1002708 Ga0103268_10027081 569
303 3300002931 CVPL010W_10015023 CVPL010W_100150231 570
304 3300007142 Ga0102737_1000442 Ga0102737_10004424 570
305 3300007190 Ga0103267_1000152 Ga0103267_100015222 571
306 3300042652 Ga0466708_354131 Ga0466708_354131_256_2016 586
307 3300002931 CVPL010W_10000127 CVPL010W_1000012737 591
308 iso_pr_bacteria 8102014801 8102015641 597

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21162 ETFQO_UQ-bd ETF-QO, ubiquinone-binding 261 354 0.98
PF05187 ETF_QO Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S 493 594 0.98
PF01266 DAO FAD dependent oxidoreductase 59 100 0.85
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 62 107 0.85
PF01946 Thi4 Thi4 family 53 105 0.79
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 58 93 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF05187 GO:0051536 iron-sulfur cluster binding MF
PF07992 GO:0016491 oxidoreductase activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.