Protein Family IF13964

Metagenome Isolate
209 Members
130 Samples
132 Scaffolds
394.65 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8067987626|8067988605|
Length
443 aa
Sequence
MRREQERGVRHDVSIPAVRDAPPDYAGSMASRKVFGIVLAGGEGKRLMPLTEDRAKPAVPFGGQYRLIDFALSNLLNSGLRQIVVLTQYKSHSLDRHVSQTWRLSGLLNSYVASVPAQQRLGKRWFSGSADAILQSLNLIYDEKPDIIVVVGADHVYRMDFSQMIDAHVASGAEATVAAIRQPISLANQFGVIDVDPKRPDRIRQFLEKPNDPVGLPDSPDEVFASMGNYVFDADALVDSVLRDGEQTSSSHDMGGDIIPSFVARGAAGVYDLQRNDVPGATDRDRYYWRDVGTLDSYYEAHQDLISVLPVFNLYNREWPIFSQQLNSPPAKVTRDARGALGTVIDSIVSLGSVISGAHIERSVLGPWSVVGSGAHVVDSILFDRARIDEGAHVKRAILDKEVVVEAGAEIGVDRAADLARGFIVTDSGLTVVGKGSRVRARA

📊 Sample Types

Isolate 36.8%
Metagenome 63.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.4%
Termitidae 17.4%
Formicidae 14.0%
Culicidae 7.4%
Kalotermitidae 7.4%
Scarabaeidae 5.0%
Cambaridae 4.1%
Elmidae 3.3%
Armadillidiidae 3.3%
Tenebrionidae 3.3%
Hydrophilidae 1.7%
Cerambycidae 1.7%
Pentatomidae 0.8%
Pyralidae 0.8%
Cimicidae 0.8%
Ixodidae 0.8%
Rhinotermitidae 0.8%
Reduviidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 199
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
2 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
3 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
4 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
5 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
6 2900368070 Nocardia aurantia RB56 Isolate Termitidae
7 8062747827 Yimella sp. cx-51 Isolate Cambaridae
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
10 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
11 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
12 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
13 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
14 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
15 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
16 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
17 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
18 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
19 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
20 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
24 8062637095 Yimella sp. cx-51 Isolate Cambaridae
25 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
26 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
27 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
28 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
31 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
32 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
33 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
34 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
35 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
36 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
37 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 649989992 Pseudonocardia sp. P1 Isolate Formicidae
41 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
42 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
46 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
47 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
48 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
49 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
50 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
51 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
52 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
53 3006468911 Streptomyces sp. RB17 Isolate Termitidae
54 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
55 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
56 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
57 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
58 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
59 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
62 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
63 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
64 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
65 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
66 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
67 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
68 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
69 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
70 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
71 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
72 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
73 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
74 2862784999 Streptomyces sp. M41 Isolate Unclassified
75 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
76 2909412500 Yimella sp. cx-573 Isolate Cambaridae
77 2931425734 Nocardioides sp. J2M5 Isolate
78 2931430189 Tessaracoccus palaemonis J1M15 Isolate
79 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
80 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
81 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
82 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
83 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
84 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
85 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
86 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
87 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
88 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
89 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
90 2504756063 Isoptericola variabilis J5 Isolate Unclassified
91 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
92 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
93 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
94 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
95 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
96 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
97 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
98 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
99 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
100 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
101 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
102 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
103 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
104 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
105 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
106 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
107 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
108 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
109 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
110 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
111 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
112 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
113 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
114 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
115 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
116 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
117 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
118 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
119 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
120 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
121 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
122 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
123 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
124 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
125 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
126 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
127 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
128 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
129 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
130 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466730_030378 3300042625 Bacteria 3035
2 Ga0466704_191668 3300042643 Bacteria 22529
3 Ga0466724_05941 3300042649 Bacteria 68311
4 Ga0466723_310480 3300042618 Bacteria 13696
5 Ga0466728_320010 3300042620 Unclassified 4642
6 Ga0160432_100118 3300012818 Bacteria 76275
7 Ga0160432_100891 3300012818 Bacteria 12930
8 Ga0466707_334115 3300042601 Bacteria 1705
9 Ga0466713_082605 3300042602 Bacteria 26852
10 Ga0466713_085340 3300042602 Bacteria 38840
11 Ga0466716_463791 3300042605 Bacteria 3021
12 Ga0123357_10006944 3300009784 Bacteria 13913
13 Ga0123356_10298366 3300010049 Bacteria 1715
14 Ga0160464_100793 3300012805 Bacteria 17360
15 Ga0562379_0096 3300056790 Bacteria 309415
16 Ga0466734_125783 3300042623 Bacteria 1475
17 Ga0466704_329352 3300042643 Bacteria 4013
18 Ga0466704_384808 3300042643 Bacteria 5341
19 Ga0466723_168295 3300042618 Bacteria 9453
20 Ga0160459_100033 3300012831 Bacteria 259391
21 Ga0160447_105732 3300012849 Unclassified 3400
22 Ga0466707_192239 3300042601 Bacteria 58455
23 Ga0466713_067791 3300042602 Bacteria 94888
24 Ga0466713_110734 3300042602 Bacteria 5308
25 Ga0123357_10173890 3300009784 Bacteria 2538
26 Ga0123357_10271765 3300009784 Bacteria 1770
27 Ga0123357_10336605 3300009784 Bacteria 1466
28 Ga0123354_10007820 3300010882 Bacteria 16186
29 Ga0160464_100575 3300012805 Bacteria 24463
30 AustNasuHG_c1008515 3300000089 Bacteria 3630
31 Ga0466705_001810 3300042612 Bacteria 1865
32 Ga0562379_0256 3300056790 Bacteria 139436
33 Ga0562376_1353 3300056857 Bacteria 35020
34 Ga0466725_447615 3300042654 Bacteria 6872
35 Ga0466705_430981 3300042612 Bacteria 5677
36 Ga0466728_321186 3300042620 Bacteria 2362
37 Ga0160441_100872 3300012825 Bacteria 14780
38 Ga0160455_100886 3300012837 Bacteria 11339
39 Ga0160435_1012078 3300012857 Unclassified 1741
40 Ga0160457_1001559 3300012858 Bacteria 6126
41 Ga0466713_004199 3300042602 Bacteria 8039
42 Ga0466716_175407 3300042605 Bacteria 25596
43 Ga0123356_10269477 3300010049 Unclassified 1792
44 AustNasuHG_c1024664 3300000089 Bacteria 1901
45 Ga0466733_059557 3300042659 Bacteria 11427
46 Ga0466733_084639 3300042659 Bacteria 25822
47 Ga0466734_004146 3300042623 Bacteria 3662
48 Ga0466730_081587 3300042625 Bacteria 1860
49 Ga0466703_221626 3300042636 Bacteria 46159
50 Ga0466710_414203 3300042613 Bacteria 3094
51 Ga0160432_101848 3300012818 Bacteria 5662
52 Ga0160431_102543 3300012828 Unclassified 4211
53 Ga0160458_105825 3300012832 Bacteria 1454
54 Ga0160434_105997 3300012850 Unclassified 2008
55 Ga0160430_100407 3300012852 Bacteria 25654
56 Ga0466693_109461 3300042592 Bacteria 182600
57 Ga0466713_032693 3300042602 Bacteria 139937
58 Ga0466713_088144 3300042602 Bacteria 17171
59 Ga0466713_135216 3300042602 Bacteria 5097
60 Ga0466719_126830 3300042606 Bacteria 53853
61 Ga0123357_10065431 3300009784 Bacteria 4854
62 Ga0123354_10060104 3300010882 Bacteria 5627
63 JGI24699J35502_11133593 3300002509 Bacteria 12325
64 Ga0562374_0020 3300057007 Bacteria 1125244
65 Ga0466730_002766 3300042625 Bacteria 44764
66 Ga0466730_004385 3300042625 Bacteria 1420
67 Ga0466730_038154 3300042625 Bacteria 7607
68 Ga0466703_351953 3300042636 Bacteria 5003
69 Ga0466724_46140 3300042649 Bacteria 630192
70 Ga0466728_449811 3300042620 Bacteria 7374
71 Ga0160469_103183 3300012824 Bacteria 2428
72 Ga0466707_029760 3300042601 Bacteria 5402
73 Ga0466707_121644 3300042601 Bacteria 13873
74 Ga0466713_064780 3300042602 Bacteria 3975
75 Ga0466719_407591 3300042606 Bacteria 5001
76 Ga0123356_10000137 3300010049 Bacteria 82109
77 Ga0123356_10244819 3300010049 Bacteria 1867
78 Ga0123356_10329075 3300010049 Bacteria 1644
79 Ga0160454_102284 3300012798 Unclassified 2210
80 Ga0466733_063884 3300042659 Bacteria 94180
81 Ga0466703_015457 3300042636 Bacteria 6433
82 Ga0466703_185011 3300042636 Bacteria 25098
83 Ga0466704_358733 3300042643 Unclassified 8145
84 Ga0466725_405685 3300042654 Bacteria 1971
85 Ga0466705_473868 3300042612 Unclassified 7185
86 Ga0466718_047686 3300042617 Bacteria 3881
87 Ga0466723_202928 3300042618 Bacteria 16495
88 Ga0160457_1003034 3300012858 Unclassified 3099
89 Ga0466691_071421 3300042593 Bacteria 7315
90 Ga0466696_225080 3300042596 Bacteria 14486
91 Ga0466696_381585 3300042596 Bacteria 5392
92 Ga0466700_385552 3300042600 Bacteria 18611
93 Ga0466707_256599 3300042601 Bacteria 2047
94 Ga0466707_410949 3300042601 Bacteria 6290
95 Ga0123353_10083844 3300010167 Bacteria 5130
96 Ga0123354_10000204 3300010882 Bacteria 51430
97 JGI24705J35276_12211870 3300002504 Bacteria 1869
98 JGI24705J35276_12233143 3300002504 Bacteria 4676
99 Ga0123357_10000937 3300009784 Bacteria 29683
100 Ga0466704_444563 3300042643 Bacteria 3339
101 Ga0160446_100077 3300012835 Bacteria 97363
102 Ga0160447_104114 3300012849 Bacteria 4398
103 Ga0160448_100428 3300012854 Bacteria 14808
104 Ga0466693_354246 3300042592 Bacteria 62518
105 Ga0466707_397359 3300042601 Bacteria 3584
106 Ga0123357_10126592 3300009784 Bacteria 3198
107 Ga0123356_10000060 3300010049 Bacteria 114492
108 Ga0123356_10001703 3300010049 Bacteria 24069
109 Ga0123356_10016516 3300010049 Bacteria 7039
110 Ga0123353_10096478 3300010167 Bacteria 4765
111 AglaG_contig09508 2084038013 Bacteria 1592
112 AustNasuHG_c1000299 3300000089 Bacteria 17184
113 Ga0072940_1137886 3300005200 Bacteria 3936
114 Ga0123357_10000007 3300009784 Bacteria 257289
115 Ga0466705_001161 3300042612 Bacteria 27928
116 Ga0466703_383518 3300042636 Bacteria 43660
117 Ga0466718_000175 3300042617 Bacteria 10256
118 Ga0466729_062079 3300042621 Bacteria 18297
119 Ga0160456_102255 3300012820 Bacteria 3697
120 Ga0160469_100216 3300012824 Bacteria 49012
121 Ga0160452_100059 3300012834 Bacteria 146119
122 Ga0160446_100225 3300012835 Bacteria 38731
123 Ga0160447_108970 3300012849 Bacteria 2334
124 Ga0160430_101227 3300012852 Bacteria 10058
125 Ga0160435_1003268 3300012857 Bacteria 3852
126 Ga0160436_1000500 3300012861 Bacteria 14763
127 Ga0466657_325722 3300042582 Bacteria 7078
128 Ga0466707_159556 3300042601 Bacteria 111445
129 Ga0123354_10129475 3300010882 Bacteria 3197
130 Ga0123354_10132078 3300010882 Bacteria 3147
131 Ga0072940_1099196 3300005200 Bacteria 6000
132 Ga0123357_10000122 3300009784 Bacteria 66741

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10336605 Ga0123357_103366052 347
2 3300042621 Ga0466729_062079 Ga0466729_062079_6458_7621 351
3 3300042602 Ga0466713_088144 Ga0466713_088144_7683_8846 354
4 iso_pr_bacteria 2820838073 2820840268 354
5 3300042601 Ga0466707_256599 Ga0466707_256599_241_1437 357
6 3300012831 Ga0160459_100033 Ga0160459_10003347 359
7 3300000089 AustNasuHG_c1024664 AustNasuHG_10246642 361
8 3300010167 Ga0123353_10096478 Ga0123353_100964782 361
9 3300042582 Ga0466657_325722 Ga0466657_325722_1327_2493 361
10 3300010049 Ga0123356_10000137 Ga0123356_1000013738 362
11 3300002509 JGI24699J35502_11133593 JGI24699J35502_111335936 363
12 3300010049 Ga0123356_10269477 Ga0123356_102694772 363
13 3300012849 Ga0160447_105732 Ga0160447_1057325 363
14 3300042617 Ga0466718_000175 Ga0466718_000175_5576_6817 363
15 3300042613 Ga0466710_414203 Ga0466710_414203_956_2176 364
16 3300005200 Ga0072940_1099196 Ga0072940_10991968 365
17 3300012824 Ga0160469_100216 Ga0160469_10021643 365
18 3300042601 Ga0466707_121644 Ga0466707_121644_4916_6082 365
19 3300042643 Ga0466704_444563 Ga0466704_444563_1347_2561 365
20 3300000089 AustNasuHG_c1008515 AustNasuHG_10085152 367
21 3300042592 Ga0466693_109461 Ga0466693_109461_75199_76365 367
22 3300042617 Ga0466718_047686 Ga0466718_047686_514_1755 367
23 3300042625 Ga0466730_004385 Ga0466730_004385_74_1294 367
24 3300042654 Ga0466725_405685 Ga0466725_405685_453_1697 367
25 3300042654 Ga0466725_447615 Ga0466725_447615_5615_6781 367
26 3300009784 Ga0123357_10000007 Ga0123357_10000007172 368
27 3300042592 Ga0466693_354246 Ga0466693_354246_3490_4737 370
28 3300042625 Ga0466730_002766 Ga0466730_002766_34378_35595 370
29 3300000089 AustNasuHG_c1000299 AustNasuHG_10002993 371
30 3300005200 Ga0072940_1137886 Ga0072940_11378863 371
31 3300042618 Ga0466723_310480 Ga0466723_310480_8906_10147 371
32 3300042659 Ga0466733_084639 Ga0466733_084639_17711_18937 371
33 3300042602 Ga0466713_085340 Ga0466713_085340_32797_33963 372
34 3300042618 Ga0466723_168295 Ga0466723_168295_5572_6813 372
35 3300057007 Ga0562374_0020 Ga0562374_0020_836190_837431 372
36 iso_pr_bacteria 2820929059 2820930733 372
37 3300010049 Ga0123356_10000060 Ga0123356_1000006067 373
38 3300042612 Ga0466705_001161 Ga0466705_001161_22845_24092 373
39 3300056790 Ga0562379_0256 Ga0562379_0256_94277_95515 373
40 3300056857 Ga0562376_1353 Ga0562376_1353_23862_25100 373
41 3300012818 Ga0160432_100118 Ga0160432_10011837 374
42 3300009784 Ga0123357_10000937 Ga0123357_1000093713 375
43 3300009784 Ga0123357_10126592 Ga0123357_101265923 375
44 3300010167 Ga0123353_10083844 Ga0123353_100838441 375
45 3300012832 Ga0160458_105825 Ga0160458_1058251 375
46 3300012849 Ga0160447_108970 Ga0160447_1089702 375
47 3300012858 Ga0160457_1003034 Ga0160457_10030342 375
48 3300010049 Ga0123356_10016516 Ga0123356_100165162 376
49 3300010882 Ga0123354_10000204 Ga0123354_100002049 376
50 3300042602 Ga0466713_064780 Ga0466713_064780_1699_2913 376
51 3300010049 Ga0123356_10001703 Ga0123356_1000170321 377
52 3300012818 Ga0160432_101848 Ga0160432_1018486 377
53 3300010049 Ga0123356_10244819 Ga0123356_102448192 378
54 3300042593 Ga0466691_071421 Ga0466691_071421_1100_2341 378
55 3300042602 Ga0466713_135216 Ga0466713_135216_509_1732 378
56 3300042636 Ga0466703_221626 Ga0466703_221626_41775_43016 378
57 3300042659 Ga0466733_059557 Ga0466733_059557_140_1366 378
58 3300010882 Ga0123354_10007820 Ga0123354_100078203 379
59 3300042602 Ga0466713_032693 Ga0466713_032693_20175_21416 380
60 3300012835 Ga0160446_100077 Ga0160446_10007735 381
61 3300042605 Ga0466716_175407 Ga0466716_175407_4481_5722 381
62 3300010882 Ga0123354_10060104 Ga0123354_100601041 382
63 3300042623 Ga0466734_004146 Ga0466734_004146_808_2049 382
64 3300010049 Ga0123356_10329075 Ga0123356_103290751 383
65 3300042602 Ga0466713_004199 Ga0466713_004199_21_1241 383
66 3300042605 Ga0466716_463791 Ga0466716_463791_672_1916 384
67 3300042601 Ga0466707_159556 Ga0466707_159556_78405_79628 386
68 3300042612 Ga0466705_473868 Ga0466705_473868_5317_6540 386
69 3300010049 Ga0123356_10298366 Ga0123356_102983661 387
70 3300042620 Ga0466728_449811 Ga0466728_449811_4116_5363 387
71 3300042636 Ga0466703_351953 Ga0466703_351953_635_1858 387
72 3300042643 Ga0466704_329352 Ga0466704_329352_657_1880 387
73 3300042602 Ga0466713_067791 Ga0466713_067791_5350_6576 388
74 3300042606 Ga0466719_126830 Ga0466719_126830_22382_23605 388
75 3300002504 JGI24705J35276_12211870 JGI24705J35276_122118702 389
76 3300042600 Ga0466700_385552 Ga0466700_385552_4145_5371 389
77 3300009784 Ga0123357_10173890 Ga0123357_101738902 390
78 3300012834 Ga0160452_100059 Ga0160452_10005967 391
79 3300056790 Ga0562379_0096 Ga0562379_0096_55337_56575 391
80 3300012857 Ga0160435_1003268 Ga0160435_10032684 392
81 3300042601 Ga0466707_334115 Ga0466707_334115_318_1559 392
82 3300012824 Ga0160469_103183 Ga0160469_1031832 393
83 3300042643 Ga0466704_191668 Ga0466704_191668_18724_19947 393
84 3300042659 Ga0466733_063884 Ga0466733_063884_78571_79815 393
85 3300042601 Ga0466707_192239 Ga0466707_192239_20197_21504 394
86 iso_pr_bacteria 2873586004 2873587421 394
87 3300042596 Ga0466696_381585 Ga0466696_381585_1062_2249 395
88 3300042601 Ga0466707_029760 Ga0466707_029760_1526_2749 395
89 3300042623 Ga0466734_125783 Ga0466734_125783_108_1349 395
90 3300042636 Ga0466703_383518 Ga0466703_383518_18128_19351 395
91 iso_pr_bacteria 2671180625 2673532373 395
92 iso_pr_bacteria 2675903497 2678194925 395
93 iso_pr_bacteria 2718217924 2719368889 395
94 iso_pr_bacteria 2856671350 2856677075 395
95 iso_pr_bacteria 2856947901 2856952049 395
96 iso_pr_bacteria 2856966858 2856968015 395
97 iso_pr_bacteria 649989992 650094747 395
98 3300009784 Ga0123357_10271765 Ga0123357_102717651 396
99 3300042618 Ga0466723_202928 Ga0466723_202928_12673_13914 396
100 iso_pr_bacteria 2545824723 2546570316 398
101 iso_pr_bacteria 2675903013 2676271651 398
102 iso_pr_bacteria 2862075925 2862076577 398
103 iso_pr_bacteria 8109397740 8109398493 398
104 iso_pr_bacteria 2862784999 2862789444 399
105 iso_pr_bacteria 2873196663 2873200152 399
106 3300012837 Ga0160455_100886 Ga0160455_10088611 400
107 3300042612 Ga0466705_001810 Ga0466705_001810_559_1764 401
108 3300042620 Ga0466728_320010 Ga0466728_320010_3387_4631 401
109 3300042643 Ga0466704_384808 Ga0466704_384808_2033_3238 401
110 3300042601 Ga0466707_410949 Ga0466707_410949_4247_5455 402
111 3300012805 Ga0160464_100575 Ga0160464_10057519 404
112 3300012820 Ga0160456_102255 Ga0160456_1022553 404
113 3300042625 Ga0466730_038154 Ga0466730_038154_485_1726 404
114 3300042636 Ga0466703_015457 Ga0466703_015457_1824_3038 404
115 3300042636 Ga0466703_185011 Ga0466703_185011_21716_22930 404
116 3300042643 Ga0466704_358733 Ga0466704_358733_5413_6627 404
117 iso_pr_bacteria 2864899338 2864901692 404
118 iso_pr_bacteria 2900354037 2900360174 404
119 iso_pr_bacteria 2900368070 2900375564 404
120 3300042625 Ga0466730_030378 Ga0466730_030378_819_2036 405
121 iso_pr_bacteria 2772190761 2772884932 405
122 iso_pr_bacteria 2820857933 2820862450 405
123 iso_pr_bacteria 2864773010 2864773683 405
124 iso_pr_bacteria 2864918810 2864921181 405
125 iso_pr_bacteria 2864964650 2864965805 405
126 iso_pr_bacteria 8053361298 8053364418 405
127 3300042602 Ga0466713_082605 Ga0466713_082605_3130_4350 406
128 iso_pr_bacteria 2515154106 2515600261 406
129 iso_pr_bacteria 3006468911 3006472188 406
130 iso_pr_bacteria 8046957834 8046965924 406
131 3300010882 Ga0123354_10132078 Ga0123354_101320782 407
132 3300042606 Ga0466719_407591 Ga0466719_407591_1342_2565 407
133 3300042620 Ga0466728_321186 Ga0466728_321186_12_1274 407
134 iso_pr_bacteria 2820807258 2820808375 407
135 iso_pr_bacteria 2820944107 2820945350 407
136 iso_pr_bacteria 2821314491 2821316592 407
137 iso_pr_bacteria 8030347546 8030349537 407
138 3300002504 JGI24705J35276_12233143 JGI24705J35276_122331435 408
139 3300009784 Ga0123357_10000122 Ga0123357_1000012212 408
140 3300009784 Ga0123357_10006944 Ga0123357_100069442 408
141 3300009784 Ga0123357_10065431 Ga0123357_100654313 408
142 3300010882 Ga0123354_10129475 Ga0123354_101294752 408
143 iso_pr_bacteria 2648501322 2649449479 408
144 iso_pr_bacteria 2820901319 2820901722 408
145 iso_pr_bacteria 2873558832 2873561384 408
146 iso_pr_bacteria 2931430189 2931430899 408
147 iso_pr_bacteria 8067071256 8067074141 408
148 iso_pr_bacteria 8077775691 8077776950 408
149 iso_pr_bacteria 2820818506 2820819916 409
150 iso_pr_bacteria 2818991478 2819785689 410
151 iso_pr_bacteria 2547132042 2547180958 411
152 iso_pr_bacteria 2820849606 2820850251 411
153 iso_pr_bacteria 2856882415 2856885101 411
154 iso_pr_bacteria 2856954254 2856956726 411
155 iso_pr_bacteria 2856960404 2856963106 411
156 iso_pr_bacteria 2856973192 2856976269 411
157 iso_pr_bacteria 2859970369 2859971010 411
158 iso_pr_bacteria 2859977607 2859978455 411
159 3300042596 Ga0466696_225080 Ga0466696_225080_6542_7780 412
160 3300042612 Ga0466705_430981 Ga0466705_430981_2891_4129 412
161 iso_pr_bacteria 2681812870 2682012574 412
162 iso_pr_bacteria 2847305884 2847309383 412
163 iso_pr_bacteria 2883361506 2883363136 412
164 3300042602 Ga0466713_110734 Ga0466713_110734_2308_3549 413
165 iso_pr_bacteria 2504756063 2504977039 413
166 iso_pr_bacteria 2816332114 2816397842 413
167 iso_pr_bacteria 2818991320 2819438686 413
168 iso_pr_bacteria 2820809073 2820809708 413
169 iso_pr_bacteria 2820825283 2820827204 413
170 iso_pr_bacteria 2820922474 2820922542 413
171 iso_pr_bacteria 2820926697 2820928222 413
172 iso_pr_bacteria 2837204985 2837207567 413
173 iso_pr_bacteria 2848356102 2848356787 413
174 iso_pr_bacteria 2861945162 2861946820 413
175 iso_pr_bacteria 2883683260 2883685002 413
176 iso_pr_bacteria 2884351759 2884353912 413
177 2084038013 AglaG_contig09508 AglaG_00000300 414
178 3300012805 Ga0160464_100793 Ga0160464_1007939 414
179 3300012852 Ga0160430_100407 Ga0160430_1004079 414
180 3300012857 Ga0160435_1012078 Ga0160435_10120782 414
181 3300012858 Ga0160457_1001559 Ga0160457_10015593 414
182 3300012861 Ga0160436_1000500 Ga0160436_100050013 414
183 3300042649 Ga0466724_05941 Ga0466724_05941_41453_42697 414
184 3300042649 Ga0466724_46140 Ga0466724_46140_344340_345584 414
185 iso_pr_bacteria 2820845766 2820848056 414
186 iso_pr_bacteria 2820894511 2820897335 414
187 iso_pr_bacteria 2836973655 2836976887 414
188 iso_pr_bacteria 2909881144 2909882691 414
189 iso_pr_bacteria 2910090113 2910090649 414
190 iso_pr_bacteria 2918394494 2918395191 414
191 3300012798 Ga0160454_102284 Ga0160454_1022842 415
192 3300012818 Ga0160432_100891 Ga0160432_1008918 415
193 3300012825 Ga0160441_100872 Ga0160441_1008723 415
194 3300012828 Ga0160431_102543 Ga0160431_1025432 415
195 3300012835 Ga0160446_100225 Ga0160446_10022527 415
196 3300012849 Ga0160447_104114 Ga0160447_1041144 415
197 3300012850 Ga0160434_105997 Ga0160434_1059972 415
198 3300012852 Ga0160430_101227 Ga0160430_1012275 415
199 3300012854 Ga0160448_100428 Ga0160448_10042810 415
200 3300042625 Ga0466730_081587 Ga0466730_081587_520_1767 415
201 iso_pr_bacteria 2884613238 2884616730 415
202 iso_pr_bacteria 2909412500 2909415222 415
203 iso_pr_bacteria 8062637095 8062638557 415
204 iso_pr_bacteria 8062747827 8062749977 415
205 iso_pr_bacteria 2931425734 2931427944 417
206 3300042601 Ga0466707_397359 Ga0466707_397359_894_2150 418
207 iso_pr_bacteria 8118075156 8118079493 425
208 iso_pr_bacteria 646564587 646804000 427
209 iso_pr_bacteria 8067987626 8067988605 443

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00483 NTP_transferase Nucleotidyl transferase 36 305 0.95
PF12804 NTP_transf_3 MobA-like NTP transferase domain 36 180 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.