Protein Family IF13949

Metagenome Isolate
246 Members
98 Samples
199 Scaffolds
375.72 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8065497608|8065499733|
Length
375 aa
Sequence
MLFNVYPLYDIEPVKAQGSYLWDTKGDRYLDLYGGHAVISVGHTHPHYVAALTDQLSKISFYSNSVKVSMQEELATKLGALSGYTDYALFLCNSGAEANENALKLASFHNGRTKVVSFKKSFHGRTAGAVAVTDNPAIVAPINYNEHVTFLPYNDVEAAQNGITDETCAVIVEGIQGVGGINVASDEFLQALRRRCDETGAILILDSVQCGYGRSGQFFSHQFSGIDPDLITMAKGMGNGFPIGGVLISPKFKATYGMLGTTFGGNHLACRAAIAVLDIMKEESLIDNAAKVGEHLMKGIEQIGGYKELRGRGLMIGIEYDFPVETLRNSLLFDHHIFTGVAGKHTLRLLPSLALRIEEADVFLEALSKEVKVVS

πŸ“Š Sample Types

Isolate 19.1%
Metagenome 80.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 33.3%
Termitidae 22.6%
Kalotermitidae 15.1%
Unclassified 7.5%
Rhinotermitidae 5.4%
Termopsidae 4.3%
Passalidae 3.2%
Apidae 2.2%
Hydrophilidae 2.2%
Bombycidae 1.1%
Tenebrionidae 1.1%
Elmidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 244
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
3 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
4 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
5 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
6 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
7 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
8 3004672520 Bacteroides sp. 51 Isolate Blattidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
21 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
28 2896321640 Sphingobacterium sp. xlx-130 Isolate
29 2922326829 Bacteroides sp. 224 Isolate Blattidae
30 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
31 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
32 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
38 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
39 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
40 2898741527 Sphingobacterium sp. xlx-73 Isolate
41 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
42 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
43 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
44 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
53 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
54 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
55 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
56 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
57 3004677695 Bacteroides sp. 214 Isolate Blattidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
60 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
61 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
62 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
63 2896330536 Sphingobacterium sp. xlx-96 Isolate
64 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
65 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
66 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
67 2832343623 Apibacter adventoris wkB180 Isolate Apidae
68 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
69 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
70 2923982719 Parabacteroides sp. 52 Isolate Blattidae
71 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
72 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
73 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
74 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
78 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
79 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
80 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
81 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
82 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
83 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
84 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
85 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
86 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
87 2896350215 Sphingobacterium sp. xlx-183 Isolate
88 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
89 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
90 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
91 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
92 3004667792 Bacteroides sp. 519 Isolate Blattidae
93 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
94 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
95 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
96 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
97 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
98 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_057024 3300042611 Bacteria 4695
2 Ga0466733_024711 3300042659 Bacteria 63451
3 Ga0123353_10162835 3300010167 Bacteria 3550
4 Ga0466701_074493 3300042598 Bacteria 3597
5 Ga0466707_012653 3300042601 Bacteria 5114
6 Ga0466707_022305 3300042601 Bacteria 2445
7 Ga0466707_331024 3300042601 Bacteria 15223
8 Ga0466713_058555 3300042602 Bacteria 16728
9 Ga0466716_114092 3300042605 Bacteria 13384
10 Ga0466719_087024 3300042606 Bacteria 2862
11 Ga0466722_208412 3300042609 Bacteria 6722
12 Ga0466705_497927 3300042612 Bacteria 2266
13 Ga0466711_161163 3300042615 Bacteria 17839
14 Ga0466726_100246 3300042619 Bacteria 3005
15 Ga0466728_024229 3300042620 Bacteria 24563
16 2227560738 2225789004 Bacteria 14473
17 IMNBL1DRAFT_c0000168 3300000062 Bacteria 58839
18 JGI24702J35022_10000615 3300002462 Bacteria 21682
19 JGI24702J35022_10137018 3300002462 Bacteria 1363
20 Ga0068302_10387241 3300005071 Bacteria 1704
21 Ga0068305_10032167 3300005083 Bacteria 15858
22 Ga0466730_025713 3300042625 Bacteria 3722
23 Ga0466704_486621 3300042643 Bacteria 6328
24 Ga0466704_584060 3300042643 Bacteria 9421
25 Ga0466725_333563 3300042654 Bacteria 10015
26 Ga0466690_180282 3300042590 Bacteria 25954
27 Ga0466690_336420 3300042590 Bacteria 10674
28 Ga0466693_373583 3300042592 Bacteria 2036
29 Ga0466691_150789 3300042593 Bacteria 10260
30 Ga0466696_163360 3300042596 Bacteria 29150
31 Ga0466705_236020 3300042612 Bacteria 47478
32 Ga0466705_317509 3300042612 Bacteria 8974
33 Ga0466705_319150 3300042612 Bacteria 11105
34 Ga0123355_10196571 3300009826 Bacteria 2956
35 Ga0123353_10212114 3300010167 Bacteria 3036
36 Ga0466713_041042 3300042602 Bacteria 19187
37 Ga0466713_047004 3300042602 Bacteria 5910
38 Ga0466713_048535 3300042602 Bacteria 16951
39 Ga0466714_082006 3300042603 Bacteria 191145
40 Ga0466711_111925 3300042615 Bacteria 13247
41 Ga0466715_170026 3300042616 Bacteria 29950
42 Ga0466718_129949 3300042617 Bacteria 1472
43 Ga0466726_081284 3300042619 Bacteria 1883
44 Ga0466728_059095 3300042620 Bacteria 40129
45 2227230799 2225789004 Bacteria 7362
46 JGI24702J35022_10000190 3300002462 Bacteria 32930
47 Ga0068305_10054066 3300005083 Bacteria 9316
48 Ga0466729_291406 3300042621 Bacteria 1771
49 Ga0466735_023729 3300042624 Bacteria 7648
50 Ga0466735_221859 3300042624 Bacteria 3793
51 Ga0466703_050871 3300042636 Bacteria 2778
52 Ga0466703_087213 3300042636 Bacteria 7693
53 Ga0466703_103094 3300042636 Bacteria 14416
54 Ga0466709_092167 3300042648 Bacteria 4550
55 Ga0466724_26359 3300042649 Bacteria 8789
56 Ga0466725_004387 3300042654 Bacteria 1523
57 Ga0466656_071707 3300042550 Bacteria 2419
58 Ga0562377_0004 3300056842 Bacteria 3525959
59 Ga0123353_10561871 3300010167 Bacteria 1643
60 Ga0123353_10788391 3300010167 Bacteria 1315
61 Ga0466706_025187 3300042599 Bacteria 51793
62 Ga0466716_411427 3300042605 Bacteria 2179
63 Ga0466719_176856 3300042606 Bacteria 5125
64 Ga0466722_033577 3300042609 Bacteria 6386
65 Ga0466705_422055 3300042612 Bacteria 15480
66 Ga0466711_480067 3300042615 Bacteria 1926
67 Ga0466715_358298 3300042616 Bacteria 8462
68 Ga0466715_485052 3300042616 Bacteria 31199
69 Ga0466723_028729 3300042618 Bacteria 46525
70 Ga0466723_366064 3300042618 Bacteria 2316
71 Ga0466726_462384 3300042619 Bacteria 2840
72 Ga0466728_016460 3300042620 Bacteria 9793
73 Ga0072941_1313972 3300005201 Bacteria 2265
74 Ga0466703_097578 3300042636 Bacteria 6295
75 Ga0466709_270482 3300042648 Bacteria 5513
76 Ga0466727_101626 3300042655 Bacteria 3487
77 Ga0466727_249898 3300042655 Bacteria 3004
78 Ga0466692_016162 3300042591 Bacteria 24466
79 Ga0466696_037357 3300042596 Bacteria 3080
80 Ga0466699_342042 3300042597 Bacteria 2579
81 Ga0123355_10007783 3300009826 Bacteria 16124
82 Ga0466706_091938 3300042599 Bacteria 5178
83 Ga0466706_203302 3300042599 Bacteria 74431
84 Ga0466713_143155 3300042602 Bacteria 188721
85 Ga0466717_135245 3300042604 Bacteria 2450
86 Ga0466716_012780 3300042605 Bacteria 10330
87 Ga0466711_025258 3300042615 Bacteria 45468
88 Ga0466715_149956 3300042616 Bacteria 15041
89 Ga0466715_332096 3300042616 Bacteria 3103
90 Ga0466715_455874 3300042616 Bacteria 3637
91 Ga0466715_613283 3300042616 Bacteria 7780
92 Ga0466723_023805 3300042618 Bacteria 54844
93 Ga0466723_078652 3300042618 Bacteria 2412
94 Ga0466729_206962 3300042621 Bacteria 5639
95 Ga0466735_059475 3300042624 Bacteria 3292
96 Ga0466735_098762 3300042624 Bacteria 2308
97 Ga0466703_024117 3300042636 Bacteria 4423
98 Ga0466703_046692 3300042636 Bacteria 10487
99 Ga0466703_198032 3300042636 Bacteria 3979
100 Ga0466704_589446 3300042643 Bacteria 8974
101 Ga0466727_080326 3300042655 Bacteria 10492
102 Ga0466692_052543 3300042591 Unclassified 1930
103 Ga0466691_108850 3300042593 Bacteria 6164
104 Ga0466694_277648 3300042594 Bacteria 3016
105 Ga0466733_061316 3300042659 Bacteria 145079
106 Ga0466733_210265 3300042659 Bacteria 1699
107 Ga0466706_110068 3300042599 Bacteria 33466
108 Ga0466706_169288 3300042599 Bacteria 28222
109 Ga0466706_187394 3300042599 Bacteria 4318
110 Ga0466713_035202 3300042602 Bacteria 9215
111 Ga0466722_169207 3300042609 Bacteria 3201
112 Ga0466722_263608 3300042609 Bacteria 34147
113 Ga0466705_448736 3300042612 Bacteria 6019
114 Ga0466711_006554 3300042615 Bacteria 9234
115 Ga0466711_137330 3300042615 Bacteria 35994
116 IMNBL1DRAFT_c0040947 3300000062 Bacteria 1561
117 JGI24702J35022_10062011 3300002462 Bacteria 2001
118 Ga0466704_233224 3300042643 Bacteria 19918
119 Ga0466708_014247 3300042652 Bacteria 21773
120 Ga0466708_154124 3300042652 Bacteria 1823
121 Ga0466708_330262 3300042652 Bacteria 27220
122 Ga0466727_190108 3300042655 Bacteria 14426
123 Ga0466656_311475 3300042550 Bacteria 2351
124 Ga0466693_175882 3300042592 Bacteria 1816
125 Ga0466696_028061 3300042596 Bacteria 36603
126 Ga0466696_186658 3300042596 Bacteria 14592
127 Ga0466733_053401 3300042659 Bacteria 4199
128 Ga0466733_084365 3300042659 Bacteria 13107
129 Ga0466733_135375 3300042659 Bacteria 4055
130 Ga0466713_081773 3300042602 Bacteria 94516
131 Ga0466713_119741 3300042602 Bacteria 23414
132 Ga0466714_010700 3300042603 Bacteria 109081
133 Ga0466716_154470 3300042605 Bacteria 9230
134 Ga0466716_244016 3300042605 Bacteria 6074
135 Ga0466719_516946 3300042606 Bacteria 3721
136 Ga0466719_525073 3300042606 Bacteria 16045
137 Ga0466715_019255 3300042616 Bacteria 20255
138 JGI24702J35022_10014193 3300002462 Bacteria 4397
139 JGI24705J35276_12238515 3300002504 Bacteria 24729
140 Ga0466703_086970 3300042636 Bacteria 15652
141 Ga0466703_122215 3300042636 Bacteria 2213
142 Ga0466704_050220 3300042643 Bacteria 8094
143 Ga0466704_384670 3300042643 Bacteria 3587
144 Ga0466708_016632 3300042652 Bacteria 33440
145 Ga0466708_224946 3300042652 Bacteria 22929
146 Ga0466725_021095 3300042654 Bacteria 3798
147 Ga0466727_108549 3300042655 Bacteria 17021
148 Ga0466691_009362 3300042593 Bacteria 25845
149 Ga0466696_183745 3300042596 Bacteria 2576
150 Ga0466697_225439 3300042611 Bacteria 1325
151 Ga0466733_012253 3300042659 Bacteria 22612
152 Ga0466733_050761 3300042659 Bacteria 17441
153 Ga0123356_10030209 3300010049 Bacteria 5071
154 Ga0466706_177210 3300042599 Bacteria 1703
155 Ga0466707_172209 3300042601 Bacteria 2142
156 Ga0466713_062703 3300042602 Bacteria 41012
157 Ga0466714_077607 3300042603 Bacteria 5030
158 Ga0466722_222321 3300042609 Bacteria 2985
159 Ga0466711_514729 3300042615 Bacteria 3137
160 Ga0466726_088502 3300042619 Bacteria 5659
161 Ga0466726_382673 3300042619 Bacteria 11863
162 Ga0466729_051045 3300042621 Bacteria 12078
163 2227549628 2225789004 Bacteria 15100
164 IMNBL1DRAFT_c0005060 3300000062 Bacteria 7677
165 JGI24702J35022_10019767 3300002462 Bacteria 3663
166 JGI24702J35022_10053053 3300002462 Bacteria 2162
167 JGI24699J35502_11134161 3300002509 Bacteria 40857
168 Ga0068305_10011192 3300005083 Bacteria 12110
169 Ga0068305_10754363 3300005083 Bacteria 1525
170 Ga0466709_028246 3300042648 Bacteria 8755
171 Ga0466727_049307 3300042655 Bacteria 7513
172 Ga0466727_267683 3300042655 Bacteria 8892
173 Ga0415639_017098 3300038395 Bacteria 1236
174 Ga0466691_010037 3300042593 Bacteria 10367
175 Ga0466691_060905 3300042593 Bacteria 24431
176 Ga0466696_163519 3300042596 Bacteria 6387
177 Ga0466696_353529 3300042596 Bacteria 7911
178 Ga0466733_123170 3300042659 Bacteria 64337
179 Ga0466706_031307 3300042599 Bacteria 5508
180 Ga0466706_203102 3300042599 Bacteria 35690
181 Ga0466707_160373 3300042601 Bacteria 6916
182 Ga0466713_008449 3300042602 Bacteria 4908
183 Ga0466716_074953 3300042605 Bacteria 6010
184 Ga0466716_245123 3300042605 Bacteria 2622
185 Ga0466716_370868 3300042605 Bacteria 19469
186 Ga0466719_061154 3300042606 Bacteria 6149
187 Ga0466722_043264 3300042609 Bacteria 4667
188 Ga0466715_270340 3300042616 Unclassified 11644
189 Ga0466723_108082 3300042618 Bacteria 9241
190 Ga0466728_278489 3300042620 Bacteria 5380
191 Ga0466728_325649 3300042620 Bacteria 7234
192 Ga0466728_399272 3300042620 Bacteria 209367
193 2226991485 2225789003 Bacteria 7193
194 IMNBL1DRAFT_c0002288 3300000062 Bacteria 13463
195 Ga0068305_10304430 3300005083 Bacteria 4660
196 Ga0466731_407173 3300042622 Bacteria 1235
197 Ga0466704_406582 3300042643 Bacteria 13152
198 Ga0466709_011326 3300042648 Bacteria 23746
199 Ga0466690_177855 3300042590 Bacteria 9617

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_245123 Ga0466716_245123_1275_2333 352
2 3300042596 Ga0466696_163360 Ga0466696_163360_27541_28602 353
3 3300042624 Ga0466735_221859 Ga0466735_221859_2698_3759 353
4 3300042619 Ga0466726_081284 Ga0466726_081284_88_1209 356
5 3300042592 Ga0466693_175882 Ga0466693_175882_235_1362 361
6 3300005083 Ga0068305_10304430 Ga0068305_103044301 362
7 3300042655 Ga0466727_249898 Ga0466727_249898_1840_2952 370
8 3300005071 Ga0068302_10387241 Ga0068302_103872412 371
9 3300042601 Ga0466707_172209 Ga0466707_172209_142_1257 371
10 3300042605 Ga0466716_012780 Ga0466716_012780_6931_8046 371
11 3300042620 Ga0466728_024229 Ga0466728_024229_18813_19928 371
12 3300042616 Ga0466715_358298 Ga0466715_358298_4912_6045 372
13 3300038395 Ga0415639_017098 Ga0415639_017098_30_1151 373
14 3300042591 Ga0466692_052543 Ga0466692_052543_489_1610 373
15 3300042599 Ga0466706_110068 Ga0466706_110068_8847_9968 373
16 3300042599 Ga0466706_187394 Ga0466706_187394_2712_3833 373
17 3300042599 Ga0466706_203102 Ga0466706_203102_26296_27417 373
18 3300042599 Ga0466706_203302 Ga0466706_203302_49944_51065 373
19 3300042601 Ga0466707_012653 Ga0466707_012653_1838_2959 373
20 3300042602 Ga0466713_058555 Ga0466713_058555_6086_7207 373
21 3300042602 Ga0466713_081773 Ga0466713_081773_71538_72659 373
22 3300042602 Ga0466713_143155 Ga0466713_143155_150041_151162 373
23 3300042603 Ga0466714_077607 Ga0466714_077607_3761_4882 373
24 3300042603 Ga0466714_082006 Ga0466714_082006_125423_126544 373
25 3300042605 Ga0466716_074953 Ga0466716_074953_912_2033 373
26 3300042605 Ga0466716_154470 Ga0466716_154470_6313_7434 373
27 3300042609 Ga0466722_222321 Ga0466722_222321_593_1714 373
28 3300042611 Ga0466697_057024 Ga0466697_057024_2853_3974 373
29 3300042612 Ga0466705_422055 Ga0466705_422055_12625_13746 373
30 3300042615 Ga0466711_006554 Ga0466711_006554_6534_7655 373
31 3300042615 Ga0466711_025258 Ga0466711_025258_8861_9982 373
32 3300042615 Ga0466711_111925 Ga0466711_111925_11176_12297 373
33 3300042615 Ga0466711_480067 Ga0466711_480067_433_1554 373
34 3300042616 Ga0466715_270340 Ga0466715_270340_8289_9410 373
35 3300042620 Ga0466728_016460 Ga0466728_016460_6608_7729 373
36 3300042620 Ga0466728_059095 Ga0466728_059095_7704_8825 373
37 3300042620 Ga0466728_399272 Ga0466728_399272_43114_44235 373
38 3300042625 Ga0466730_025713 Ga0466730_025713_2289_3410 373
39 3300042643 Ga0466704_384670 Ga0466704_384670_1052_2173 373
40 3300042652 Ga0466708_016632 Ga0466708_016632_2394_3515 373
41 3300042654 Ga0466725_004387 Ga0466725_004387_256_1377 373
42 3300042655 Ga0466727_101626 Ga0466727_101626_1431_2552 373
43 3300042659 Ga0466733_053401 Ga0466733_053401_2874_3995 373
44 3300042659 Ga0466733_061316 Ga0466733_061316_48088_49209 373
45 3300042659 Ga0466733_084365 Ga0466733_084365_488_1609 373
46 3300042659 Ga0466733_135375 Ga0466733_135375_703_1824 373
47 iso_pr_bacteria 2695420314 2695470868 373
48 iso_pr_bacteria 2695420317 2695486188 373
49 iso_pr_bacteria 2873600114 2873603359 373
50 iso_pr_bacteria 2873610414 2873613753 373
51 iso_pr_bacteria 2910942425 2910946708 373
52 iso_pr_bacteria 2910949487 2910952605 373
53 iso_pr_bacteria 2910959314 2910961516 373
54 iso_pr_bacteria 2940195863 2940197680 373
55 iso_pr_bacteria 2940199050 2940202229 373
56 iso_pr_bacteria 2940209341 2940210997 373
57 iso_pr_bacteria 2940244548 2940246110 373
58 iso_pr_bacteria 2940248789 2940249934 373
59 iso_pr_bacteria 2940253009 2940254008 373
60 iso_pr_bacteria 2940257232 2940258176 373
61 iso_pr_bacteria 2940346213 2940348374 373
62 iso_pr_bacteria 8100157865 8100161153 373
63 iso_pr_bacteria 8100166142 8100168549 373
64 2225789004 2227549628 2228078078 374
65 3300005083 Ga0068305_10011192 Ga0068305_100111926 374
66 3300009826 Ga0123355_10196571 Ga0123355_101965713 374
67 3300010167 Ga0123353_10162835 Ga0123353_101628352 374
68 3300010167 Ga0123353_10788391 Ga0123353_107883911 374
69 3300042550 Ga0466656_311475 Ga0466656_311475_648_1772 374
70 3300042592 Ga0466693_373583 Ga0466693_373583_623_1747 374
71 3300042594 Ga0466694_277648 Ga0466694_277648_1246_2370 374
72 3300042596 Ga0466696_183745 Ga0466696_183745_1399_2523 374
73 3300042598 Ga0466701_074493 Ga0466701_074493_61_1185 374
74 3300042599 Ga0466706_091938 Ga0466706_091938_2206_3330 374
75 3300042601 Ga0466707_331024 Ga0466707_331024_7115_8239 374
76 3300042602 Ga0466713_048535 Ga0466713_048535_143_1267 374
77 3300042604 Ga0466717_135245 Ga0466717_135245_526_1650 374
78 3300042609 Ga0466722_208412 Ga0466722_208412_3604_4728 374
79 3300042612 Ga0466705_497927 Ga0466705_497927_236_1360 374
80 3300042616 Ga0466715_332096 Ga0466715_332096_1480_2604 374
81 3300042618 Ga0466723_028729 Ga0466723_028729_1760_2884 374
82 3300042618 Ga0466723_366064 Ga0466723_366064_435_1559 374
83 3300042619 Ga0466726_382673 Ga0466726_382673_498_1622 374
84 3300042624 Ga0466735_023729 Ga0466735_023729_6328_7452 374
85 3300042624 Ga0466735_059475 Ga0466735_059475_51_1175 374
86 3300042636 Ga0466703_097578 Ga0466703_097578_751_1875 374
87 3300042636 Ga0466703_103094 Ga0466703_103094_1142_2266 374
88 3300042643 Ga0466704_589446 Ga0466704_589446_1306_2430 374
89 3300042648 Ga0466709_028246 Ga0466709_028246_3711_4835 374
90 3300042659 Ga0466733_024711 Ga0466733_024711_34415_35539 374
91 3300042659 Ga0466733_050761 Ga0466733_050761_10271_11395 374
92 3300042659 Ga0466733_123170 Ga0466733_123170_43070_44194 374
93 iso_pr_bacteria 2820788205 2820788288 374
94 iso_pr_bacteria 2910926975 2910928670 374
95 iso_pr_bacteria 2922326829 2922328703 374
96 iso_pr_bacteria 2940205530 2940206287 374
97 iso_pr_bacteria 2940212447 2940213439 374
98 iso_pr_bacteria 2940298504 2940299258 374
99 iso_pr_bacteria 2940302308 2940303300 374
100 iso_pr_bacteria 2940306115 2940306803 374
101 iso_pr_bacteria 2940309933 2940310619 374
102 iso_pr_bacteria 2940313741 2940314666 374
103 iso_pr_bacteria 2940317558 2940318481 374
104 iso_pr_bacteria 2940321370 2940322293 374
105 iso_pr_bacteria 2940325180 2940326172 374
106 iso_pr_bacteria 2940328985 2940329741 374
107 iso_pr_bacteria 2940332795 2940333483 374
108 iso_pr_bacteria 3004672520 3004674831 374
109 iso_pr_bacteria 3004677695 3004680167 374
110 2225789003 2226991485 2227341724 375
111 2225789004 2227230799 2227666889 375
112 3300000062 IMNBL1DRAFT_c0005060 IMNBL1DRAFT_00050608 375
113 3300010167 Ga0123353_10561871 Ga0123353_105618712 375
114 3300042590 Ga0466690_180282 Ga0466690_180282_16693_17820 375
115 3300042590 Ga0466690_336420 Ga0466690_336420_9341_10468 375
116 3300042596 Ga0466696_037357 Ga0466696_037357_937_2064 375
117 3300042599 Ga0466706_177210 Ga0466706_177210_492_1619 375
118 3300042602 Ga0466713_008449 Ga0466713_008449_3519_4646 375
119 3300042602 Ga0466713_047004 Ga0466713_047004_4312_5439 375
120 3300042602 Ga0466713_119741 Ga0466713_119741_13631_14758 375
121 3300042606 Ga0466719_087024 Ga0466719_087024_1125_2252 375
122 3300042606 Ga0466719_525073 Ga0466719_525073_247_1374 375
123 3300042609 Ga0466722_169207 Ga0466722_169207_481_1608 375
124 3300042612 Ga0466705_317509 Ga0466705_317509_3076_4203 375
125 3300042616 Ga0466715_170026 Ga0466715_170026_20115_21242 375
126 3300042616 Ga0466715_485052 Ga0466715_485052_10322_11449 375
127 3300042620 Ga0466728_325649 Ga0466728_325649_5383_6510 375
128 3300042622 Ga0466731_407173 Ga0466731_407173_57_1184 375
129 3300042636 Ga0466703_087213 Ga0466703_087213_6255_7382 375
130 3300042643 Ga0466704_050220 Ga0466704_050220_6768_7895 375
131 3300042643 Ga0466704_406582 Ga0466704_406582_9679_10806 375
132 3300042654 Ga0466725_021095 Ga0466725_021095_346_1473 375
133 3300056842 Ga0562377_0004 Ga0562377_0004_1205077_1206204 375
134 iso_pr_bacteria 2832343623 2832343732 375
135 iso_pr_bacteria 2923982719 2923984847 375
136 iso_pr_bacteria 2940202316 2940203842 375
137 iso_pr_bacteria 2940371297 2940372588 375
138 iso_pr_bacteria 8065497608 8065499733 375
139 3300000062 IMNBL1DRAFT_c0000168 IMNBL1DRAFT_000016844 376
140 3300000062 IMNBL1DRAFT_c0002288 IMNBL1DRAFT_00022884 376
141 3300002462 JGI24702J35022_10000615 JGI24702J35022_1000061515 376
142 3300002462 JGI24702J35022_10019767 JGI24702J35022_100197672 376
143 3300002462 JGI24702J35022_10062011 JGI24702J35022_100620112 376
144 3300042596 Ga0466696_353529 Ga0466696_353529_6297_7427 376
145 3300042599 Ga0466706_025187 Ga0466706_025187_16104_17234 376
146 3300042602 Ga0466713_035202 Ga0466713_035202_5976_7106 376
147 3300042602 Ga0466713_062703 Ga0466713_062703_37381_38511 376
148 3300042605 Ga0466716_411427 Ga0466716_411427_749_1879 376
149 3300042606 Ga0466719_516946 Ga0466719_516946_991_2121 376
150 3300042609 Ga0466722_263608 Ga0466722_263608_21980_23110 376
151 3300042612 Ga0466705_236020 Ga0466705_236020_26448_27578 376
152 3300042612 Ga0466705_319150 Ga0466705_319150_7757_8887 376
153 3300042615 Ga0466711_161163 Ga0466711_161163_5445_6575 376
154 3300042618 Ga0466723_078652 Ga0466723_078652_340_1470 376
155 3300042619 Ga0466726_462384 Ga0466726_462384_275_1405 376
156 3300042624 Ga0466735_098762 Ga0466735_098762_819_1949 376
157 3300042643 Ga0466704_233224 Ga0466704_233224_6010_7140 376
158 3300042643 Ga0466704_584060 Ga0466704_584060_5078_6208 376
159 3300042648 Ga0466709_011326 Ga0466709_011326_5228_6358 376
160 3300042652 Ga0466708_330262 Ga0466708_330262_19414_20544 376
161 3300042655 Ga0466727_080326 Ga0466727_080326_4994_6124 376
162 3300042655 Ga0466727_267683 Ga0466727_267683_560_1690 376
163 2225789004 2227560738 2228097430 377
164 3300002504 JGI24705J35276_12238515 JGI24705J35276_1223851513 377
165 3300002509 JGI24699J35502_11134161 JGI24699J35502_1113416130 377
166 3300010049 Ga0123356_10030209 Ga0123356_100302094 377
167 3300042590 Ga0466690_177855 Ga0466690_177855_291_1424 377
168 3300042593 Ga0466691_010037 Ga0466691_010037_166_1299 377
169 3300042593 Ga0466691_150789 Ga0466691_150789_5695_6828 377
170 3300042596 Ga0466696_028061 Ga0466696_028061_24130_25263 377
171 3300042605 Ga0466716_370868 Ga0466716_370868_6645_7778 377
172 3300042606 Ga0466719_061154 Ga0466719_061154_3436_4569 377
173 3300042606 Ga0466719_176856 Ga0466719_176856_506_1639 377
174 3300042609 Ga0466722_043264 Ga0466722_043264_3301_4434 377
175 3300042612 Ga0466705_448736 Ga0466705_448736_3923_5056 377
176 3300042616 Ga0466715_455874 Ga0466715_455874_304_1437 377
177 3300042616 Ga0466715_613283 Ga0466715_613283_1632_2765 377
178 3300042618 Ga0466723_023805 Ga0466723_023805_9714_10847 377
179 3300042618 Ga0466723_108082 Ga0466723_108082_569_1702 377
180 3300042619 Ga0466726_100246 Ga0466726_100246_126_1259 377
181 3300042620 Ga0466728_278489 Ga0466728_278489_3941_5074 377
182 3300042621 Ga0466729_051045 Ga0466729_051045_7359_8492 377
183 3300042621 Ga0466729_206962 Ga0466729_206962_4354_5487 377
184 3300042636 Ga0466703_086970 Ga0466703_086970_11751_12884 377
185 3300042636 Ga0466703_122215 Ga0466703_122215_789_1922 377
186 3300042636 Ga0466703_198032 Ga0466703_198032_2238_3371 377
187 3300042648 Ga0466709_092167 Ga0466709_092167_530_1663 377
188 3300042649 Ga0466724_26359 Ga0466724_26359_83_1216 377
189 3300042652 Ga0466708_224946 Ga0466708_224946_1253_2386 377
190 3300042655 Ga0466727_108549 Ga0466727_108549_15223_16356 377
191 3300042655 Ga0466727_190108 Ga0466727_190108_768_1901 377
192 3300042659 Ga0466733_012253 Ga0466733_012253_5324_6457 377
193 iso_pr_bacteria 2579779088 2582238727 377
194 iso_pr_bacteria 2896321640 2896322390 377
195 iso_pr_bacteria 2896330536 2896333041 377
196 iso_pr_bacteria 2896350215 2896352857 377
197 iso_pr_bacteria 2898741527 2898743251 377
198 iso_pr_bacteria 3004667792 3004670845 377
199 3300000062 IMNBL1DRAFT_c0040947 IMNBL1DRAFT_00409472 378
200 3300005201 Ga0072941_1313972 Ga0072941_13139722 378
201 3300042550 Ga0466656_071707 Ga0466656_071707_686_1822 378
202 3300042593 Ga0466691_060905 Ga0466691_060905_10601_11737 378
203 3300042596 Ga0466696_163519 Ga0466696_163519_3568_4704 378
204 3300042596 Ga0466696_186658 Ga0466696_186658_12213_13349 378
205 3300042597 Ga0466699_342042 Ga0466699_342042_124_1260 378
206 3300042599 Ga0466706_031307 Ga0466706_031307_3485_4621 378
207 3300042602 Ga0466713_041042 Ga0466713_041042_12476_13612 378
208 3300042605 Ga0466716_114092 Ga0466716_114092_4990_6126 378
209 3300042611 Ga0466697_225439 Ga0466697_225439_80_1216 378
210 3300042616 Ga0466715_149956 Ga0466715_149956_6272_7408 378
211 3300042636 Ga0466703_050871 Ga0466703_050871_1510_2646 378
212 3300042648 Ga0466709_270482 Ga0466709_270482_2768_3904 378
213 3300042655 Ga0466727_049307 Ga0466727_049307_2230_3366 378
214 3300002462 JGI24702J35022_10000190 JGI24702J35022_100001909 379
215 3300002462 JGI24702J35022_10014193 JGI24702J35022_100141932 379
216 3300005083 Ga0068305_10032167 Ga0068305_100321677 379
217 3300042601 Ga0466707_160373 Ga0466707_160373_3881_5020 379
218 3300042636 Ga0466703_024117 Ga0466703_024117_2405_3544 379
219 3300042654 Ga0466725_333563 Ga0466725_333563_8492_9631 379
220 iso_pr_bacteria 2820750388 2820750945 379
221 iso_pr_bacteria 2864886855 2864889849 379
222 3300002462 JGI24702J35022_10137018 JGI24702J35022_101370182 380
223 3300005083 Ga0068305_10054066 Ga0068305_100540667 380
224 3300005083 Ga0068305_10754363 Ga0068305_107543632 380
225 3300010167 Ga0123353_10212114 Ga0123353_102121143 380
226 3300042599 Ga0466706_169288 Ga0466706_169288_10488_11630 380
227 3300042605 Ga0466716_244016 Ga0466716_244016_3553_4695 380
228 3300042609 Ga0466722_033577 Ga0466722_033577_1202_2344 380
229 3300042615 Ga0466711_514729 Ga0466711_514729_400_1542 380
230 3300042591 Ga0466692_016162 Ga0466692_016162_6886_8031 381
231 3300042652 Ga0466708_014247 Ga0466708_014247_9579_10727 382
232 3300042593 Ga0466691_009362 Ga0466691_009362_24376_25527 383
233 3300042593 Ga0466691_108850 Ga0466691_108850_226_1377 383
234 3300042619 Ga0466726_088502 Ga0466726_088502_238_1392 384
235 3300042617 Ga0466718_129949 Ga0466718_129949_200_1357 385
236 3300042643 Ga0466704_486621 Ga0466704_486621_915_2075 386
237 3300042603 Ga0466714_010700 Ga0466714_010700_14120_15325 387
238 3300042652 Ga0466708_154124 Ga0466708_154124_96_1259 387
239 3300002462 JGI24702J35022_10053053 JGI24702J35022_100530532 388
240 3300042615 Ga0466711_137330 Ga0466711_137330_29646_30812 388
241 3300042621 Ga0466729_291406 Ga0466729_291406_381_1556 391
242 3300042616 Ga0466715_019255 Ga0466715_019255_10254_11432 392
243 3300042636 Ga0466703_046692 Ga0466703_046692_8949_10133 394
244 3300042601 Ga0466707_022305 Ga0466707_022305_1160_2347 395
245 3300009826 Ga0123355_10007783 Ga0123355_100077836 407
246 3300042659 Ga0466733_210265 Ga0466733_210265_308_1546 412

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00202 Aminotran_3 Aminotransferase class-III 11 369 0.94

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.95 0.97 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.