Protein Family IF13933
Metagenome
Isolate
173
Members
138
Samples
75
Scaffolds
296.22
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8062747827|8062750340|
- Length
- 332 aa
- Sequence
- MRTWQQSATDVDLALSGLAVVLAWWSNLLSTKESSLMNQTATGTARVKRGMAEMLKGGVIMDVVTPDQARIAEDAGAVAVMALERVPADIRAQGGVSRMSDPDMIDGIIEAVSIPVMAKARIGHFVEAQVLQSLGVDYIDESEVLTPADYANHIDKWQFTVPFVCGANNLGEALRRITEGAAMIRSKGEAGTGDVSNATTHMRQIRQEIRRLQNLPEDELFVAAKGLQAPYELVKEVAELGKLPVVLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGNPAERAAAIVKATTFHDDPDVIAKVSRGLGEAMVGINVDDIPVPHRLAERGW
Sample Types
Isolate
56.6%
Metagenome
43.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.3%
Termitidae
19.7%
Formicidae
14.4%
Blattidae
6.8%
Elmidae
3.0%
Tenebrionidae
3.0%
Kalotermitidae
3.0%
Scarabaeidae
2.3%
Cambaridae
2.3%
Culicidae
2.3%
Armadillidiidae
2.3%
Apidae
1.5%
Termopsidae
1.5%
Thomisidae
0.8%
Hodotermitidae
0.8%
Pyralidae
0.8%
Passalidae
0.8%
Pentatomidae
0.8%
Cerambycidae
0.8%
Reduviidae
0.8%
Ixodidae
0.8%
Curculionidae
0.8%
Hydrophilidae
0.8%
Cimicidae
0.8%
Siricidae
0.8%
Noctuidae
0.8%
Drosophilidae
0.8%
Taxonomy
Archaea
1
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 2 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 3 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 4 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 5 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 6 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 7 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 8 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 9 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 10 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 11 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 14 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 15 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 23 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 24 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 25 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 26 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 27 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 28 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 29 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 30 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 33 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 34 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 35 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 38 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 39 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 40 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 41 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 42 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 43 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 44 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 45 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 46 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 47 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 48 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 49 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 50 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 51 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 52 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 53 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 54 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 55 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 56 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 59 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 60 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 61 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 62 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 63 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 64 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 65 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 66 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 67 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 68 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 69 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 70 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 75 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 76 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 77 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 78 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 79 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 80 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 81 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 82 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 83 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 84 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 85 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 86 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 87 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 90 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 91 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 92 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 93 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 94 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 95 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 96 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 97 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 98 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 99 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 100 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 101 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 102 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 103 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 104 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 105 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 106 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 107 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 108 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 109 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 110 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 111 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 112 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 113 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 114 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 115 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 116 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 117 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 118 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 119 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 120 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 121 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 122 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 123 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 124 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 125 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 126 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 127 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 128 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 129 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 130 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 131 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 132 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 133 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 134 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 135 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 136 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 137 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 138 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0092 | 3300056842 | Bacteria | 331889 |
| 2 | Ga0562377_1311 | 3300056842 | Unclassified | 27170 |
| 3 | Ga0562375_1158 | 3300056856 | Bacteria | 38813 |
| 4 | Ga0160452_101698 | 3300012834 | Unclassified | 5834 |
| 5 | Ga0466725_206287 | 3300042654 | Bacteria | 1427 |
| 6 | Ga0160466_100045 | 3300012809 | Bacteria | 162746 |
| 7 | JGI24695J34938_10001696 | 3300002450 | Bacteria | 18208 |
| 8 | JGI24695J34938_10006978 | 3300002450 | Bacteria | 6696 |
| 9 | Ga0068302_10067333 | 3300005071 | Bacteria | 2705 |
| 10 | Ga0466710_256256 | 3300042613 | Bacteria | 1662 |
| 11 | Ga0160435_1001031 | 3300012857 | Bacteria | 7385 |
| 12 | Ga0466730_035606 | 3300042625 | Unclassified | 2958 |
| 13 | Ga0466730_087211 | 3300042625 | Bacteria | 1337 |
| 14 | Ga0466704_384191 | 3300042643 | Bacteria | 24599 |
| 15 | Ga0123357_10008613 | 3300009784 | Bacteria | 12765 |
| 16 | Ga0466734_153413 | 3300042623 | Bacteria | 1278 |
| 17 | Ga0466735_082822 | 3300042624 | Bacteria | 1725 |
| 18 | Ga0466724_36962 | 3300042649 | Bacteria | 194212 |
| 19 | Ga0105005_1014416 | 3300007505 | Bacteria | 3742 |
| 20 | Ga0466705_184144 | 3300042612 | Bacteria | 2043 |
| 21 | Ga0466705_245540 | 3300042612 | Bacteria | 8406 |
| 22 | Ga0562378_0031 | 3300056814 | Bacteria | 530809 |
| 23 | Ga0562378_0051 | 3300056814 | Bacteria | 353762 |
| 24 | Ga0562375_3767 | 3300056856 | Unclassified | 13275 |
| 25 | Ga0160469_100364 | 3300012824 | Bacteria | 24577 |
| 26 | Ga0160445_101693 | 3300012847 | Bacteria | 5855 |
| 27 | Ga0466703_068290 | 3300042636 | Bacteria | 26944 |
| 28 | Ga0466725_354586 | 3300042654 | Bacteria | 1356 |
| 29 | Ga0123355_10003999 | 3300009826 | Bacteria | 21338 |
| 30 | Ga0123353_10000305 | 3300010167 | Unclassified | 61052 |
| 31 | Ga0123354_10023960 | 3300010882 | Bacteria | 9628 |
| 32 | Ga0466705_170146 | 3300042612 | Bacteria | 4018 |
| 33 | Ga0562378_0001 | 3300056814 | Bacteria | 3579584 |
| 34 | Ga0466718_033385 | 3300042617 | Bacteria | 11692 |
| 35 | Ga0466718_055884 | 3300042617 | Bacteria | 2221 |
| 36 | Ga0160456_101609 | 3300012820 | Bacteria | 5125 |
| 37 | Ga0466707_335480 | 3300042601 | Bacteria | 2633 |
| 38 | Ga0123357_10003855 | 3300009784 | Bacteria | 17390 |
| 39 | Ga0123357_10027971 | 3300009784 | Bacteria | 7625 |
| 40 | Ga0123355_10000640 | 3300009826 | Bacteria | 47434 |
| 41 | Ga0123356_10026243 | 3300010049 | Bacteria | 5473 |
| 42 | Ga0123356_10081746 | 3300010049 | Bacteria | 3057 |
| 43 | Ga0123353_10009462 | 3300010167 | Bacteria | 13464 |
| 44 | Ga0123354_10448742 | 3300010882 | Unclassified | 1047 |
| 45 | JGI24703J35330_11550389 | 3300002501 | Unclassified | 1225 |
| 46 | Ga0466693_249120 | 3300042592 | Bacteria | 5725 |
| 47 | Ga0466713_024505 | 3300042602 | Bacteria | 1253 |
| 48 | Ga0466730_035355 | 3300042625 | Bacteria | 1396 |
| 49 | Ga0123356_10006054 | 3300010049 | Bacteria | 12272 |
| 50 | Ga0123353_10000582 | 3300010167 | Unclassified | 44621 |
| 51 | 2227477123 | 2225789004 | Bacteria | 4598 |
| 52 | 2227580177 | 2225789004 | Bacteria | 13433 |
| 53 | Ga0562378_0006 | 3300056814 | Bacteria | 1902205 |
| 54 | Ga0562376_4013 | 3300056857 | Bacteria | 13424 |
| 55 | Ga0466718_157683 | 3300042617 | Bacteria | 1510 |
| 56 | Ga0160458_103465 | 3300012832 | Bacteria | 1988 |
| 57 | Ga0466656_025163 | 3300042550 | Bacteria | 3383 |
| 58 | Ga0466701_067340 | 3300042598 | Bacteria | 9194 |
| 59 | Ga0123357_10188410 | 3300009784 | Unclassified | 2386 |
| 60 | Ga0123355_10004286 | 3300009826 | Bacteria | 20738 |
| 61 | Ga0123355_10009017 | 3300009826 | Bacteria | 15120 |
| 62 | Ga0160454_100140 | 3300012798 | Bacteria | 86992 |
| 63 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 64 | Ga0160470_100245 | 3300012813 | Bacteria | 40981 |
| 65 | Ga0466701_017520 | 3300042598 | Bacteria | 1467 |
| 66 | Ga0466706_076035 | 3300042599 | Bacteria | 1410 |
| 67 | Ga0466707_083762 | 3300042601 | Unclassified | 1865 |
| 68 | Ga0466735_048391 | 3300042624 | Bacteria | 1466 |
| 69 | Ga0466724_62062 | 3300042649 | Bacteria | 4662 |
| 70 | Ga0466724_62237 | 3300042649 | Bacteria | 10420 |
| 71 | Ga0123355_10190159 | 3300009826 | Archaea | 3026 |
| 72 | Ga0123356_10000027 | 3300010049 | Bacteria | 165240 |
| 73 | Ga0123356_10034041 | 3300010049 | Unclassified | 4765 |
| 74 | Ga0123356_10058376 | 3300010049 | Unclassified | 3598 |
| 75 | JGI24695J34938_10017190 | 3300002450 | Bacteria | 3654 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.