Protein Family IF13720
Metagenome
Isolate
294
Members
226
Samples
77
Scaffolds
335.65
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8022439116|8022441285|
- Length
- 370 aa
- Sequence
- MHQPFLVLHKNNYSQIKHLYVLMHSINSITRTKGRAMAFNLRNRNFLKLLDFSTKEIQFLLELSAELKKAKYAGTEQKTLQGKNIALIFEKSSTRTRCAFEVAAFDQGAQVSYIGPSGSQIGHKESMKDTARVLGRMYDGIEYRGFGQSIVEELGTYAGVPVWNGLTDEFHPTQILADFLTMQEYGRGKQLHEMTFAYLGDARNNMGNSLMVGAAKMGIDIRLVAPKAFWPEEELVATCQTIAQQTGAKITLTESVEEGVKGCDFLYTDVWVSMGESAEAWDERVALMTPYQINMDVIKQTGNPHVKFMHCLPAFHNDETTVGKEVAEKYGMKGLEVTEEVFESEYSIVFDEAENRMHTIKAVMVATLGS
Sample Types
Isolate
73.1%
Metagenome
26.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.9%
Termitidae
10.6%
Anthocoridae
9.3%
Muscidae
6.0%
Drosophilidae
5.1%
Curculionidae
4.6%
Calliphoridae
4.2%
Kalotermitidae
2.8%
Tephritidae
2.3%
Culicidae
1.9%
Elmidae
1.9%
Apidae
1.9%
Sarcophagidae
1.4%
Palinuridae
1.4%
Tenebrionidae
1.4%
Talitridae
1.4%
Cerambycidae
1.4%
Armadillidiidae
0.9%
Pentatomidae
0.9%
Plutellidae
0.9%
Majidae
0.9%
Hodotermitidae
0.5%
Artemiidae
0.5%
Thripidae
0.5%
Anthomyiidae
0.5%
Siricidae
0.5%
Passalidae
0.5%
Rhinotermitidae
0.5%
Ceratophyllidae
0.5%
Nephropidae
0.5%
Carabidae
0.5%
Penaeidae
0.5%
Pteromalidae
0.5%
Formicidae
0.5%
Taxonomy
Archaea
0
Bacteria
274
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 4 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 5 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 6 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 7 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 8 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 9 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 10 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 11 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 12 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 13 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 14 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 15 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 16 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 17 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 18 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 19 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 20 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 21 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 22 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 23 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 34 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 35 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 36 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 37 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 38 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 39 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 40 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 41 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 42 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 43 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 44 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 45 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 46 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 47 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 48 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 49 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 50 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 51 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 52 | 2958255616 | Serratia marcescens TM | Isolate | |
| 53 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 54 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 55 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 56 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 62 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 63 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 64 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 65 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 66 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 67 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 68 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 69 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 70 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 71 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 72 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 73 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 74 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 75 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 76 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 77 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 78 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 79 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 80 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 81 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 82 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 83 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 84 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 85 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 86 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 87 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 88 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 89 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 90 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 91 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 92 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 93 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 94 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 95 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 96 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 97 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 98 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 99 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 100 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 101 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 102 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 103 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 104 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 105 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 106 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 107 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 108 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 109 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 110 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 111 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 112 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 113 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 114 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 115 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 116 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 117 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 118 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 119 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 120 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 121 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 122 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 123 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 124 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 125 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 126 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 127 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 128 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 129 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 130 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 131 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 132 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 133 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 134 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 135 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 136 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 137 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 138 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 139 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 140 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 141 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 142 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 143 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 144 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 145 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 146 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 147 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 148 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 149 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 150 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 151 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 152 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 153 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 154 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 155 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 156 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 157 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 158 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 159 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 160 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 161 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 162 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 163 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 164 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 165 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 166 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 167 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 168 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 169 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 170 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 171 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 172 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 173 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 174 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 175 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 176 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 177 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 178 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 179 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 180 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 181 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 182 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 183 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 184 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 185 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 186 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 187 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 188 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 189 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 190 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 191 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 192 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 193 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 194 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 195 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 196 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 197 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 198 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 199 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 200 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 201 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 202 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 203 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 204 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 205 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 206 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 207 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 208 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 209 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 210 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 211 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 212 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 213 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 214 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 215 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 216 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 217 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 218 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 219 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 220 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 221 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 222 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 223 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 224 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 225 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 226 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10574589 | 3300010049 | Bacteria | 1290 |
| 2 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 3 | Ga0466707_007431 | 3300042601 | Bacteria | 1211 |
| 4 | Ga0466717_119711 | 3300042604 | Bacteria | 1403 |
| 5 | Meta3P_1001056 | 3300002464 | Unclassified | 19245 |
| 6 | Ga0063521_1000438 | 3300003973 | Bacteria | 21570 |
| 7 | Ga0104042_1122350 | 3300007130 | Bacteria | 1580 |
| 8 | Ga0105553_1041827 | 3300007767 | Unclassified | 7600 |
| 9 | Ga0265387_1000038 | 3300024582 | Bacteria | 43313 |
| 10 | Ga0415639_093781 | 3300038395 | Bacteria | 3843 |
| 11 | Ga0466690_122710 | 3300042590 | Bacteria | 2699 |
| 12 | Ga0466699_414075 | 3300042597 | Unclassified | 1667 |
| 13 | Ga0466724_19270 | 3300042649 | Bacteria | 2235 |
| 14 | Ga0123356_10272487 | 3300010049 | Unclassified | 1783 |
| 15 | Ga0466707_086697 | 3300042601 | Bacteria | 2042 |
| 16 | Ga0466713_045406 | 3300042602 | Bacteria | 136940 |
| 17 | Ga0247289_0079 | 3300035363 | Unclassified | 27593 |
| 18 | Ga0415639_039165 | 3300038395 | Bacteria | 5163 |
| 19 | Ga0466690_185031 | 3300042590 | Bacteria | 2761 |
| 20 | Ga0466691_024824 | 3300042593 | Bacteria | 35368 |
| 21 | Ga0466691_037510 | 3300042593 | Unclassified | 7134 |
| 22 | Ga0466730_001710 | 3300042625 | Unclassified | 9343 |
| 23 | Ga0466697_068570 | 3300042611 | Bacteria | 5602 |
| 24 | Ga0123357_10004068 | 3300009784 | Bacteria | 17034 |
| 25 | Ga0123353_10027012 | 3300010167 | Bacteria | 8786 |
| 26 | Ga0123353_10201826 | 3300010167 | Bacteria | 3128 |
| 27 | Ga0466701_054223 | 3300042598 | Bacteria | 4770 |
| 28 | Ga0466700_320808 | 3300042600 | Bacteria | 2069 |
| 29 | Ga0466695_356182 | 3300042595 | Bacteria | 1251 |
| 30 | Ga0466730_072545 | 3300042625 | Bacteria | 3240 |
| 31 | Ga0466724_46828 | 3300042649 | Unclassified | 17089 |
| 32 | Ga0466707_284362 | 3300042601 | Bacteria | 185230 |
| 33 | Ga0466707_386736 | 3300042601 | Bacteria | 3557 |
| 34 | Ga0466720_136251 | 3300042607 | Bacteria | 1221 |
| 35 | Ga0247290_00221 | 3300035364 | Unclassified | 16089 |
| 36 | Ga0466693_246506 | 3300042592 | Bacteria | 1418 |
| 37 | Ga0466733_192391 | 3300042659 | Bacteria | 3546 |
| 38 | Ga0123353_10022182 | 3300010167 | Bacteria | 9560 |
| 39 | Ga0466706_125382 | 3300042599 | Bacteria | 59039 |
| 40 | DPOL_contig00592 | 2035918003 | Unclassified | 36688 |
| 41 | DPOL_contig00812 | 2035918003 | Unclassified | 17760 |
| 42 | HBC_ctgsDRAFT_1003031 | 3300000333 | Bacteria | 3831 |
| 43 | Ga0063521_1000039 | 3300003973 | Bacteria | 113027 |
| 44 | Ga0160468_101083 | 3300012819 | Bacteria | 7801 |
| 45 | Ga0247289_0567 | 3300035363 | Unclassified | 5172 |
| 46 | Ga0247290_02366 | 3300035364 | Unclassified | 1739 |
| 47 | Ga0123353_10002383 | 3300010167 | Bacteria | 23355 |
| 48 | Ga0123353_10975973 | 3300010167 | Bacteria | 1142 |
| 49 | Ga0466713_103812 | 3300042602 | Bacteria | 226548 |
| 50 | HBC_ctgsDRAFT_1000804 | 3300000333 | Bacteria | 6939 |
| 51 | Ga0104044_1147901 | 3300007136 | Unclassified | 1375 |
| 52 | Ga0247289_0085 | 3300035363 | Unclassified | 27078 |
| 53 | Ga0247289_0270 | 3300035363 | Unclassified | 10129 |
| 54 | Ga0466696_177114 | 3300042596 | Bacteria | 2770 |
| 55 | Ga0466718_165575 | 3300042617 | Bacteria | 14624 |
| 56 | Ga0466723_058187 | 3300042618 | Bacteria | 3167 |
| 57 | Ga0466729_277082 | 3300042621 | Bacteria | 3546 |
| 58 | Ga0466730_024860 | 3300042625 | Bacteria | 4273 |
| 59 | Ga0466708_231633 | 3300042652 | Bacteria | 19062 |
| 60 | Ga0123357_10019256 | 3300009784 | Bacteria | 9090 |
| 61 | Ga0123354_10189902 | 3300010882 | Bacteria | 2305 |
| 62 | Ga0466713_117968 | 3300042602 | Bacteria | 408806 |
| 63 | Ga0466714_027765 | 3300042603 | Bacteria | 4139 |
| 64 | Ga0466717_022959 | 3300042604 | Bacteria | 1207 |
| 65 | FGTW_contig11579 | 2065487013 | Bacteria | 1874 |
| 66 | Ga0105008_1000297 | 3300007507 | Bacteria | 13442 |
| 67 | Ga0247290_00566 | 3300035364 | Unclassified | 6240 |
| 68 | Ga0466731_308042 | 3300042622 | Bacteria | 3228 |
| 69 | Ga0466730_009344 | 3300042625 | Bacteria | 2668 |
| 70 | Ga0466730_077351 | 3300042625 | Unclassified | 7115 |
| 71 | Ga0466709_381806 | 3300042648 | Bacteria | 5035 |
| 72 | Ga0466724_20936 | 3300042649 | Bacteria | 31695 |
| 73 | SWWA_contig00913__length_13473___numreads_253 | 2100351016 | Unclassified | 13473 |
| 74 | 2227358542 | 2225789004 | Bacteria | 136224 |
| 75 | Ga0160433_103943 | 3300012846 | Bacteria | 2491 |
| 76 | Ga0466695_033631 | 3300042595 | Bacteria | 1855 |
| 77 | Ga0466730_042960 | 3300042625 | Bacteria | 9347 |
Family Sequences
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.