Protein Family IF13720

Metagenome Isolate
294 Members
226 Samples
77 Scaffolds
335.65 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8022439116|8022441285|
Length
370 aa
Sequence
MHQPFLVLHKNNYSQIKHLYVLMHSINSITRTKGRAMAFNLRNRNFLKLLDFSTKEIQFLLELSAELKKAKYAGTEQKTLQGKNIALIFEKSSTRTRCAFEVAAFDQGAQVSYIGPSGSQIGHKESMKDTARVLGRMYDGIEYRGFGQSIVEELGTYAGVPVWNGLTDEFHPTQILADFLTMQEYGRGKQLHEMTFAYLGDARNNMGNSLMVGAAKMGIDIRLVAPKAFWPEEELVATCQTIAQQTGAKITLTESVEEGVKGCDFLYTDVWVSMGESAEAWDERVALMTPYQINMDVIKQTGNPHVKFMHCLPAFHNDETTVGKEVAEKYGMKGLEVTEEVFESEYSIVFDEAENRMHTIKAVMVATLGS

📊 Sample Types

Isolate 73.1%
Metagenome 26.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.9%
Termitidae 10.6%
Anthocoridae 9.3%
Muscidae 6.0%
Drosophilidae 5.1%
Curculionidae 4.6%
Calliphoridae 4.2%
Kalotermitidae 2.8%
Tephritidae 2.3%
Culicidae 1.9%
Elmidae 1.9%
Apidae 1.9%
Sarcophagidae 1.4%
Palinuridae 1.4%
Tenebrionidae 1.4%
Talitridae 1.4%
Cerambycidae 1.4%
Armadillidiidae 0.9%
Pentatomidae 0.9%
Plutellidae 0.9%
Majidae 0.9%
Hodotermitidae 0.5%
Artemiidae 0.5%
Thripidae 0.5%
Anthomyiidae 0.5%
Siricidae 0.5%
Passalidae 0.5%
Rhinotermitidae 0.5%
Ceratophyllidae 0.5%
Nephropidae 0.5%
Carabidae 0.5%
Penaeidae 0.5%
Pteromalidae 0.5%
Formicidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 274
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
4 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
5 8100176769 Kosakonia sp. S57 Isolate Curculionidae
6 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
7 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
8 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
9 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
10 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
11 2718217944 Serratia marcescens AS1 Isolate Culicidae
12 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
13 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
14 2864768727 Aeromonas veronii S00020 Isolate Elmidae
15 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
16 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
17 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
18 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
19 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
20 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
21 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
22 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
23 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
33 651324086 Plautia crossota stali symbiont Isolate Unclassified
34 8022087107 Vibrio sp. OULL4 Isolate Unclassified
35 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
36 8071333649 Escherichia coli PN108 Isolate Calliphoridae
37 8071338694 Escherichia coli PN87 Isolate Calliphoridae
38 8102982778 Erwinia sp. S63 Isolate Curculionidae
39 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
40 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
41 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
42 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
43 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
44 2850895757 Vibrio campbellii 170502 Isolate Unclassified
45 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
46 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
47 2872471378 Vibrio owensii V180403 Isolate Unclassified
48 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
49 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
50 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
51 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
52 2958255616 Serratia marcescens TM Isolate
53 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
54 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
55 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
63 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
64 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
65 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
66 8100181737 Kosakonia sp. S58 Isolate Curculionidae
67 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
68 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
69 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
70 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
71 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
72 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
73 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
74 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
75 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
76 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
77 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
78 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
79 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
80 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
81 2937735258 Serratia marcescens KZ11 Isolate Apidae
82 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
83 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
84 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
85 2978102237 Serratia fonticola AeS1 Isolate Culicidae
86 3006461590 Streptomyces sp. RB5 Isolate Termitidae
87 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
88 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
89 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
90 8021546568 Klebsiella sp. Kps Isolate Tephritidae
91 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
92 8071322446 Escherichia coli PN122 Isolate Calliphoridae
93 8100171289 Kosakonia sp. S42 Isolate Curculionidae
94 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
95 8103002986 Erwinia sp. S38 Isolate Curculionidae
96 8103008710 Erwinia sp. S43 Isolate Curculionidae
97 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
98 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
99 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
100 2836714267 Shimwellia blattae NCTC10965 Isolate
101 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
102 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
103 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
104 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
105 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
106 2971189173 Yersinia pestis A-1249 Isolate Unclassified
107 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
108 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
109 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
110 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
111 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
112 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
113 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
114 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
115 640963010 Vibrio harveyi HY01 Isolate Unclassified
116 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
117 648276708 Pantoea sp. aB Isolate Unclassified
118 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
119 8022345672 Vibrio sp. 070316B Isolate Unclassified
120 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
121 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
122 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
123 2511231129 Vibrio sp. EJY3 Isolate Unclassified
124 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
125 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
126 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
127 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
128 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
129 2703719240 Serratia marcescens ano2 Isolate Unclassified
130 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
131 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
132 2896955351 Streptomyces sp. GF20 Isolate Termitidae
133 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
134 2908136803 Vibrio owensii 1700302 Isolate Unclassified
135 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
136 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
137 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
138 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
139 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
140 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
141 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
142 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
143 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
144 8022096067 Vibrio sp. SALL6 Isolate Unclassified
145 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
146 8051461712 Vibrio vulnificus Vv002 Isolate
147 8060845732 Vibrio vulnificus Vv006 Isolate
148 8071343737 Escherichia coli PN119 Isolate Calliphoridae
149 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
150 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
151 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
152 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
153 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
154 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
155 2862784999 Streptomyces sp. M41 Isolate Unclassified
156 2864791955 Aeromonas veronii S00030 Isolate Elmidae
157 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
158 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
159 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
160 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
161 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
162 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
163 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
164 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
165 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
166 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
167 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
168 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
169 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
170 8018312681 Enterobacter sp. OLF Isolate Tephritidae
171 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
172 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
173 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
174 8051534459 Vibrio vulnificus Vv004 Isolate
175 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
176 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
177 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
178 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
179 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
180 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
181 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
182 2791355473 Vibrio barjaei 3062 Isolate Unclassified
183 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
184 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
185 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
186 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
187 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
188 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
189 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
190 2898975184 Erwinia dacicola IL Isolate Tephritidae
191 2908241010 Streptomyces sp. HF10 Isolate Termitidae
192 2912817845 Streptomyces griseus SID164 Isolate
193 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
194 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
195 2978161719 Serratia marcescens KZ2 Isolate Apidae
196 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
197 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
198 3006242587 Vibrio sp. RE86 Isolate Unclassified
199 3006468911 Streptomyces sp. RB17 Isolate Termitidae
200 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
201 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
202 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
203 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
204 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
205 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
206 8004541719 Serratia marcescens KZ19 Isolate Apidae
207 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
208 8051551332 Vibrio vulnificus Vv003 Isolate
209 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
210 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
211 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
212 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
213 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
214 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
215 2703719239 Serratia marcescens ano1 Isolate Unclassified
216 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
217 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
218 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
219 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
220 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
221 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
222 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
223 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
224 2912570088 Vibrio parahaemolyticus CHN25 Isolate
225 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
226 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10574589 3300010049 Bacteria 1290
2 Ga0466706_123047 3300042599 Bacteria 432554
3 Ga0466707_007431 3300042601 Bacteria 1211
4 Ga0466717_119711 3300042604 Bacteria 1403
5 Meta3P_1001056 3300002464 Unclassified 19245
6 Ga0063521_1000438 3300003973 Bacteria 21570
7 Ga0104042_1122350 3300007130 Bacteria 1580
8 Ga0105553_1041827 3300007767 Unclassified 7600
9 Ga0265387_1000038 3300024582 Bacteria 43313
10 Ga0415639_093781 3300038395 Bacteria 3843
11 Ga0466690_122710 3300042590 Bacteria 2699
12 Ga0466699_414075 3300042597 Unclassified 1667
13 Ga0466724_19270 3300042649 Bacteria 2235
14 Ga0123356_10272487 3300010049 Unclassified 1783
15 Ga0466707_086697 3300042601 Bacteria 2042
16 Ga0466713_045406 3300042602 Bacteria 136940
17 Ga0247289_0079 3300035363 Unclassified 27593
18 Ga0415639_039165 3300038395 Bacteria 5163
19 Ga0466690_185031 3300042590 Bacteria 2761
20 Ga0466691_024824 3300042593 Bacteria 35368
21 Ga0466691_037510 3300042593 Unclassified 7134
22 Ga0466730_001710 3300042625 Unclassified 9343
23 Ga0466697_068570 3300042611 Bacteria 5602
24 Ga0123357_10004068 3300009784 Bacteria 17034
25 Ga0123353_10027012 3300010167 Bacteria 8786
26 Ga0123353_10201826 3300010167 Bacteria 3128
27 Ga0466701_054223 3300042598 Bacteria 4770
28 Ga0466700_320808 3300042600 Bacteria 2069
29 Ga0466695_356182 3300042595 Bacteria 1251
30 Ga0466730_072545 3300042625 Bacteria 3240
31 Ga0466724_46828 3300042649 Unclassified 17089
32 Ga0466707_284362 3300042601 Bacteria 185230
33 Ga0466707_386736 3300042601 Bacteria 3557
34 Ga0466720_136251 3300042607 Bacteria 1221
35 Ga0247290_00221 3300035364 Unclassified 16089
36 Ga0466693_246506 3300042592 Bacteria 1418
37 Ga0466733_192391 3300042659 Bacteria 3546
38 Ga0123353_10022182 3300010167 Bacteria 9560
39 Ga0466706_125382 3300042599 Bacteria 59039
40 DPOL_contig00592 2035918003 Unclassified 36688
41 DPOL_contig00812 2035918003 Unclassified 17760
42 HBC_ctgsDRAFT_1003031 3300000333 Bacteria 3831
43 Ga0063521_1000039 3300003973 Bacteria 113027
44 Ga0160468_101083 3300012819 Bacteria 7801
45 Ga0247289_0567 3300035363 Unclassified 5172
46 Ga0247290_02366 3300035364 Unclassified 1739
47 Ga0123353_10002383 3300010167 Bacteria 23355
48 Ga0123353_10975973 3300010167 Bacteria 1142
49 Ga0466713_103812 3300042602 Bacteria 226548
50 HBC_ctgsDRAFT_1000804 3300000333 Bacteria 6939
51 Ga0104044_1147901 3300007136 Unclassified 1375
52 Ga0247289_0085 3300035363 Unclassified 27078
53 Ga0247289_0270 3300035363 Unclassified 10129
54 Ga0466696_177114 3300042596 Bacteria 2770
55 Ga0466718_165575 3300042617 Bacteria 14624
56 Ga0466723_058187 3300042618 Bacteria 3167
57 Ga0466729_277082 3300042621 Bacteria 3546
58 Ga0466730_024860 3300042625 Bacteria 4273
59 Ga0466708_231633 3300042652 Bacteria 19062
60 Ga0123357_10019256 3300009784 Bacteria 9090
61 Ga0123354_10189902 3300010882 Bacteria 2305
62 Ga0466713_117968 3300042602 Bacteria 408806
63 Ga0466714_027765 3300042603 Bacteria 4139
64 Ga0466717_022959 3300042604 Bacteria 1207
65 FGTW_contig11579 2065487013 Bacteria 1874
66 Ga0105008_1000297 3300007507 Bacteria 13442
67 Ga0247290_00566 3300035364 Unclassified 6240
68 Ga0466731_308042 3300042622 Bacteria 3228
69 Ga0466730_009344 3300042625 Bacteria 2668
70 Ga0466730_077351 3300042625 Unclassified 7115
71 Ga0466709_381806 3300042648 Bacteria 5035
72 Ga0466724_20936 3300042649 Bacteria 31695
73 SWWA_contig00913__length_13473___numreads_253 2100351016 Unclassified 13473
74 2227358542 2225789004 Bacteria 136224
75 Ga0160433_103943 3300012846 Bacteria 2491
76 Ga0466695_033631 3300042595 Bacteria 1855
77 Ga0466730_042960 3300042625 Bacteria 9347

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2537561600 2537924346 311
2 2035918003 DPOL_contig00812 DPOLB_1420900 324
3 3300042659 Ga0466733_192391 Ga0466733_192391_1077_2069 330
4 3300038395 Ga0415639_093781 Ga0415639_093781_1512_2507 331
5 3300038395 Ga0415639_039165 Ga0415639_039165_1402_2400 332
6 3300042600 Ga0466700_320808 Ga0466700_320808_443_1441 332
7 3300042601 Ga0466707_007431 Ga0466707_007431_115_1113 332
8 iso_pr_bacteria 3006461590 3006468726 332
9 3300042590 Ga0466690_122710 Ga0466690_122710_1404_2405 333
10 3300042590 Ga0466690_185031 Ga0466690_185031_1693_2694 333
11 3300042593 Ga0466691_024824 Ga0466691_024824_19005_20006 333
12 3300042593 Ga0466691_037510 Ga0466691_037510_1760_2761 333
13 3300042595 Ga0466695_033631 Ga0466695_033631_460_1461 333
14 3300042595 Ga0466695_356182 Ga0466695_356182_132_1133 333
15 3300042596 Ga0466696_177114 Ga0466696_177114_688_1689 333
16 3300042597 Ga0466699_414075 Ga0466699_414075_565_1566 333
17 3300042599 Ga0466706_125382 Ga0466706_125382_23308_24309 333
18 3300042604 Ga0466717_119711 Ga0466717_119711_35_1036 333
19 3300042607 Ga0466720_136251 Ga0466720_136251_152_1153 333
20 3300042618 Ga0466723_058187 Ga0466723_058187_1603_2604 333
21 3300042621 Ga0466729_277082 Ga0466729_277082_1283_2284 333
22 3300042622 Ga0466731_308042 Ga0466731_308042_432_1433 333
23 3300042652 Ga0466708_231633 Ga0466708_231633_7840_8841 333
24 iso_pr_bacteria 2820744581 2820745262 333
25 iso_pr_bacteria 8022116796 8022119296 333
26 iso_pr_bacteria 8022345672 8022347021 333
27 2065487013 FGTW_contig11579 FGTW_02004570 334
28 2225789004 2227358542 2227803368 334
29 3300010049 Ga0123356_10272487 Ga0123356_102724871 334
30 3300010049 Ga0123356_10574589 Ga0123356_105745892 334
31 3300010167 Ga0123353_10002383 Ga0123353_100023837 334
32 3300010167 Ga0123353_10022182 Ga0123353_100221826 334
33 3300010167 Ga0123353_10027012 Ga0123353_100270122 334
34 3300010167 Ga0123353_10201826 Ga0123353_102018264 334
35 3300010167 Ga0123353_10975973 Ga0123353_109759731 334
36 3300010882 Ga0123354_10189902 Ga0123354_101899022 334
37 3300024582 Ga0265387_1000038 Ga0265387_100003818 334
38 3300035363 Ga0247289_0079 Ga0247289_0079_22494_23498 334
39 3300035363 Ga0247289_0085 Ga0247289_0085_25968_26972 334
40 3300035363 Ga0247289_0270 Ga0247289_0270_3311_4315 334
41 3300035363 Ga0247289_0567 Ga0247289_0567_1911_2915 334
42 3300035364 Ga0247290_00221 Ga0247290_00221_13815_14819 334
43 3300035364 Ga0247290_00566 Ga0247290_00566_5193_6197 334
44 3300035364 Ga0247290_02366 Ga0247290_02366_225_1229 334
45 3300042598 Ga0466701_054223 Ga0466701_054223_2498_3502 334
46 3300042602 Ga0466713_045406 Ga0466713_045406_49659_50663 334
47 3300042602 Ga0466713_045406 Ga0466713_045406_61318_62322 334
48 3300042602 Ga0466713_117968 Ga0466713_117968_332125_333129 334
49 3300042625 Ga0466730_001710 Ga0466730_001710_1674_2678 334
50 3300042625 Ga0466730_001710 Ga0466730_001710_6149_7153 334
51 3300042625 Ga0466730_009344 Ga0466730_009344_1330_2334 334
52 3300042625 Ga0466730_024860 Ga0466730_024860_2190_3194 334
53 3300042625 Ga0466730_042960 Ga0466730_042960_4341_5345 334
54 3300042625 Ga0466730_072545 Ga0466730_072545_2081_3085 334
55 3300042625 Ga0466730_077351 Ga0466730_077351_3803_4807 334
56 3300042649 Ga0466724_19270 Ga0466724_19270_338_1342 334
57 iso_pr_bacteria 2507262057 2507518674 334
58 iso_pr_bacteria 2511231129 2511732229 334
59 iso_pr_bacteria 2517487021 2517564586 334
60 iso_pr_bacteria 2519899623 2520396792 334
61 iso_pr_bacteria 2531839005 2531867584 334
62 iso_pr_bacteria 2547132185 2547709945 334
63 iso_pr_bacteria 2547132185 2547709954 334
64 iso_pr_bacteria 2551306507 2553349092 334
65 iso_pr_bacteria 2551306516 2553378203 334
66 iso_pr_bacteria 2551306516 2553378212 334
67 iso_pr_bacteria 2551306520 2553400678 334
68 iso_pr_bacteria 2551306531 2553450706 334
69 iso_pr_bacteria 2551306531 2553450715 334
70 iso_pr_bacteria 2565956518 2566027515 334
71 iso_pr_bacteria 2571042430 2572512989 334
72 iso_pr_bacteria 2571042554 2572926063 334
73 iso_pr_bacteria 2588253732 2588527442 334
74 iso_pr_bacteria 2600255074 2600848546 334
75 iso_pr_bacteria 2636415586 2637165731 334
76 iso_pr_bacteria 2648501158 2648751461 334
77 iso_pr_bacteria 2654587515 2654659982 334
78 iso_pr_bacteria 2663763317 2666536198 334
79 iso_pr_bacteria 2667527830 2669650693 334
80 iso_pr_bacteria 2667527887 2669886521 334
81 iso_pr_bacteria 2693429575 2693745387 334
82 iso_pr_bacteria 2700989396 2702443414 334
83 iso_pr_bacteria 2711768158 2712478433 334
84 iso_pr_bacteria 2731957638 2732530473 334
85 iso_pr_bacteria 2731957969 2734002028 334
86 iso_pr_bacteria 2756170277 2756799586 334
87 iso_pr_bacteria 2778261152 2779040544 334
88 iso_pr_bacteria 2778261153 2779042045 334
89 iso_pr_bacteria 2785510762 2785803541 334
90 iso_pr_bacteria 2791355471 2794374994 334
91 iso_pr_bacteria 2791355473 2794383349 334
92 iso_pr_bacteria 2822856742 2822860676 334
93 iso_pr_bacteria 2822856742 2822860685 334
94 iso_pr_bacteria 2850895757 2850898576 334
95 iso_pr_bacteria 2856068565 2856068734 334
96 iso_pr_bacteria 2856068565 2856068739 334
97 iso_pr_bacteria 2860776474 2860776786 334
98 iso_pr_bacteria 2864768727 2864772330 334
99 iso_pr_bacteria 2864777284 2864780541 334
100 iso_pr_bacteria 2864791955 2864795559 334
101 iso_pr_bacteria 2864796242 2864799805 334
102 iso_pr_bacteria 2872471378 2872474952 334
103 iso_pr_bacteria 2874880541 2874883151 334
104 iso_pr_bacteria 2874880541 2874883160 334
105 iso_pr_bacteria 2875320051 2875320541 334
106 iso_pr_bacteria 2876334352 2876335388 334
107 iso_pr_bacteria 2876334352 2876335393 334
108 iso_pr_bacteria 2876358570 2876359047 334
109 iso_pr_bacteria 2876358570 2876359052 334
110 iso_pr_bacteria 2877638525 2877640943 334
111 iso_pr_bacteria 2877647439 2877647775 334
112 iso_pr_bacteria 2880115952 2880119029 334
113 iso_pr_bacteria 2908136803 2908137245 334
114 iso_pr_bacteria 2912570088 2912572883 334
115 iso_pr_bacteria 2912636047 2912636779 334
116 iso_pr_bacteria 2912817845 2912822112 334
117 iso_pr_bacteria 2921816052 2921818588 334
118 iso_pr_bacteria 2921816052 2921818593 334
119 iso_pr_bacteria 2921842437 2921843351 334
120 iso_pr_bacteria 2921842437 2921847046 334
121 iso_pr_bacteria 2937387794 2937389594 334
122 iso_pr_bacteria 2937387794 2937391868 334
123 iso_pr_bacteria 2937427229 2937428840 334
124 iso_pr_bacteria 2937427229 2937428844 334
125 iso_pr_bacteria 2957730672 2957730959 334
126 iso_pr_bacteria 2957730672 2957730963 334
127 iso_pr_bacteria 2964846109 2964849949 334
128 iso_pr_bacteria 2964846109 2964849954 334
129 iso_pr_bacteria 2964859436 2964862067 334
130 iso_pr_bacteria 2964859436 2964862072 334
131 iso_pr_bacteria 2967915117 2967915990 334
132 iso_pr_bacteria 2967915117 2967915995 334
133 iso_pr_bacteria 2967924226 2967924270 334
134 iso_pr_bacteria 2967924226 2967924274 334
135 iso_pr_bacteria 2970322301 2970325506 334
136 iso_pr_bacteria 2970322301 2970325511 334
137 iso_pr_bacteria 2970335472 2970338942 334
138 iso_pr_bacteria 2970335472 2970338946 334
139 iso_pr_bacteria 2977691992 2977696334 334
140 iso_pr_bacteria 2977691992 2977696338 334
141 iso_pr_bacteria 2977727922 2977729234 334
142 iso_pr_bacteria 2977727922 2977729239 334
143 iso_pr_bacteria 2977745872 2977746333 334
144 iso_pr_bacteria 2977745872 2977746338 334
145 iso_pr_bacteria 2979682021 2979684842 334
146 iso_pr_bacteria 2979682021 2979684846 334
147 iso_pr_bacteria 2989793055 2989796883 334
148 iso_pr_bacteria 2997380424 2997380982 334
149 iso_pr_bacteria 3004364956 3004367739 334
150 iso_pr_bacteria 3004364956 3004367744 334
151 iso_pr_bacteria 3006225627 3006229661 334
152 iso_pr_bacteria 3006242587 3006243885 334
153 iso_pr_bacteria 640963010 641029540 334
154 iso_pr_bacteria 647000328 647325277 334
155 iso_pr_bacteria 648276708 648768418 334
156 iso_pr_bacteria 8004118532 8004118871 334
157 iso_pr_bacteria 8008122225 8008125351 334
158 iso_pr_bacteria 8018312681 8018313543 334
159 iso_pr_bacteria 8018312681 8018313552 334
160 iso_pr_bacteria 8021540981 8021541603 334
161 iso_pr_bacteria 8021546568 8021546938 334
162 iso_pr_bacteria 8022087107 8022089612 334
163 iso_pr_bacteria 8022096067 8022096448 334
164 iso_pr_bacteria 8028002147 8028007718 334
165 iso_pr_bacteria 8033364368 8033368753 334
166 iso_pr_bacteria 8033368880 8033369890 334
167 iso_pr_bacteria 8042061949 8042066119 334
168 iso_pr_bacteria 8051461712 8051462616 334
169 iso_pr_bacteria 8051534459 8051534754 334
170 iso_pr_bacteria 8051551332 8051554927 334
171 iso_pr_bacteria 8060845732 8060846296 334
172 iso_pr_bacteria 8071322446 8071324035 334
173 iso_pr_bacteria 8071333649 8071335206 334
174 iso_pr_bacteria 8071338694 8071340229 334
175 iso_pr_bacteria 8071343737 8071345275 334
176 iso_pr_bacteria 8073124432 8073125747 334
177 iso_pr_bacteria 8100171289 8100174377 334
178 iso_pr_bacteria 8100176769 8100181211 334
179 iso_pr_bacteria 8100181737 8100181941 334
180 iso_pr_bacteria 8116627632 8116630541 334
181 2035918003 DPOL_contig00592 DPOLB_390980 335
182 3300007767 Ga0105553_1041827 Ga0105553_10418272 335
183 3300012819 Ga0160468_101083 Ga0160468_1010835 335
184 3300042617 Ga0466718_165575 Ga0466718_165575_1477_2484 335
185 iso_pr_bacteria 2513020017 2513102142 335
186 iso_pr_bacteria 2515154106 2515601023 335
187 iso_pr_bacteria 2531839602 2534152970 335
188 iso_pr_bacteria 2835335304 2835335599 335
189 iso_pr_bacteria 2836714267 2836717931 335
190 iso_pr_bacteria 2837516909 2837520031 335
191 iso_pr_bacteria 2846386538 2846388697 335
192 iso_pr_bacteria 2862784999 2862788716 335
193 iso_pr_bacteria 2871760914 2871764468 335
194 iso_pr_bacteria 2873196663 2873198326 335
195 iso_pr_bacteria 2938192669 2938194303 335
196 iso_pr_bacteria 2971189173 2971193521 335
197 iso_pr_bacteria 651324086 651695374 335
198 iso_pr_bacteria 8006199443 8006203254 335
199 iso_pr_bacteria 8046957834 8046966983 335
200 iso_pr_bacteria 8102982778 8102983348 335
201 iso_pr_bacteria 8103002986 8103003830 335
202 iso_pr_bacteria 8103008710 8103009629 335
203 3300003973 Ga0063521_1000039 Ga0063521_100003963 336
204 3300003973 Ga0063521_1000438 Ga0063521_100043820 336
205 3300012846 Ga0160433_103943 Ga0160433_1039432 336
206 3300042601 Ga0466707_284362 Ga0466707_284362_166557_167567 336
207 3300042601 Ga0466707_386736 Ga0466707_386736_223_1233 336
208 iso_pr_bacteria 2565956518 2566027344 336
209 iso_pr_bacteria 2600255074 2600848956 336
210 iso_pr_bacteria 2648501158 2648750877 336
211 iso_pr_bacteria 2791355471 2794375124 336
212 iso_pr_bacteria 2791355473 2794383617 336
213 iso_pr_bacteria 2844251356 2844252419 336
214 iso_pr_bacteria 2858407585 2858409101 336
215 iso_pr_bacteria 2868883784 2868884794 336
216 iso_pr_bacteria 2873884416 2873888809 336
217 iso_pr_bacteria 2898975184 2898977970 336
218 iso_pr_bacteria 2898991528 2898994379 336
219 iso_pr_bacteria 2900349738 2900350390 336
220 iso_pr_bacteria 2901296437 2901297575 336
221 iso_pr_bacteria 2902438364 2902440260 336
222 iso_pr_bacteria 2902451016 2902451937 336
223 iso_pr_bacteria 2902469402 2902472835 336
224 iso_pr_bacteria 2908241010 2908246567 336
225 iso_pr_bacteria 2989793055 2989797047 336
226 iso_pr_bacteria 3006225627 3006226625 336
227 iso_pr_bacteria 3006242587 3006243719 336
228 iso_pr_bacteria 648276708 648768422 336
229 iso_pr_bacteria 8048923410 8048926450 336
230 iso_pr_bacteria 8048928574 8048931608 336
231 3300000333 HBC_ctgsDRAFT_1000804 HBC_ctgsDRAFT_10008044 337
232 3300000333 HBC_ctgsDRAFT_1003031 HBC_ctgsDRAFT_10030314 337
233 3300007130 Ga0104042_1122350 Ga0104042_11223502 337
234 3300007136 Ga0104044_1147901 Ga0104044_11479012 337
235 3300007507 Ga0105008_1000297 Ga0105008_100029714 337
236 iso_pr_bacteria 2651870110 2653796594 337
237 iso_pr_bacteria 2885043073 2885045854 337
238 iso_pr_bacteria 2885046828 2885050123 337
239 iso_pr_bacteria 2885050628 2885053979 337
240 iso_pr_bacteria 2885054481 2885057658 337
241 iso_pr_bacteria 2885061987 2885065657 337
242 iso_pr_bacteria 2885065815 2885069378 337
243 3300042603 Ga0466714_027765 Ga0466714_027765_3003_4019 338
244 iso_pr_bacteria 3006468911 3006477362 338
245 2100351016 SWWA_contig00913__length_13473___numreads_253 SWWA_02882390 339
246 3300042592 Ga0466693_246506 Ga0466693_246506_334_1353 339
247 3300042649 Ga0466724_46828 Ga0466724_46828_7775_8794 339
248 iso_pr_bacteria 2703719239 2706052315 339
249 iso_pr_bacteria 2703719240 2706057801 339
250 iso_pr_bacteria 2718217944 2719460696 339
251 iso_pr_bacteria 2847708326 2847708645 339
252 iso_pr_bacteria 2859315706 2859320576 339
253 iso_pr_bacteria 2874434233 2874438860 339
254 iso_pr_bacteria 2874504452 2874504938 339
255 iso_pr_bacteria 2878947168 2878952116 339
256 iso_pr_bacteria 2922113941 2922114291 339
257 iso_pr_bacteria 2937735258 2937739742 339
258 iso_pr_bacteria 2937751072 2937756197 339
259 iso_pr_bacteria 2958255616 2958260163 339
260 iso_pr_bacteria 2961206375 2961206395 339
261 iso_pr_bacteria 2961232173 2961236821 339
262 iso_pr_bacteria 2961247850 2961250860 339
263 iso_pr_bacteria 2965197371 2965200323 339
264 iso_pr_bacteria 2970791725 2970794632 339
265 iso_pr_bacteria 2978102237 2978103495 339
266 iso_pr_bacteria 2978161719 2978164500 339
267 iso_pr_bacteria 2996406003 2996409560 339
268 iso_pr_bacteria 2996467878 2996473165 339
269 iso_pr_bacteria 8004285568 8004285797 339
270 iso_pr_bacteria 8004307473 8004312330 339
271 iso_pr_bacteria 8004541719 8004543092 339
272 iso_pr_bacteria 8004571736 8004576432 339
273 iso_pr_bacteria 8004582426 8004582450 339
274 3300002464 Meta3P_1001056 Meta3P_100105610 340
275 3300042602 Ga0466713_103812 Ga0466713_103812_22022_23044 340
276 3300042649 Ga0466724_20936 Ga0466724_20936_14564_15589 341
277 iso_pr_bacteria 2529292851 2530234836 341
278 iso_pr_bacteria 2597489902 2597923288 341
279 iso_pr_bacteria 2597489903 2597926705 341
280 iso_pr_bacteria 2841260384 2841262642 341
281 iso_pr_bacteria 2850131454 2850134167 341
282 iso_pr_bacteria 2896187957 2896190546 341
283 iso_pr_bacteria 8101676404 8101678642 341
284 iso_pr_bacteria 8101680043 8101682992 341
285 iso_pr_bacteria 8101683685 8101685155 341
286 iso_pr_bacteria 2896955351 2896960658 342
287 3300009784 Ga0123357_10004068 Ga0123357_100040682 343
288 3300042604 Ga0466717_022959 Ga0466717_022959_38_1069 343
289 3300042648 Ga0466709_381806 Ga0466709_381806_2577_3611 344
290 3300042599 Ga0466706_123047 Ga0466706_123047_316767_317804 345
291 3300042601 Ga0466707_086697 Ga0466707_086697_777_1823 348
292 3300042611 Ga0466697_068570 Ga0466697_068570_1637_2707 356
293 iso_pr_bacteria 8022439116 8022441285 370
294 3300009784 Ga0123357_10019256 Ga0123357_100192569 417

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 44 184 0.98
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 193 366 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.