Protein Family IF13714
Metagenome
Isolate
303
Members
276
Samples
71
Scaffolds
668.38
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8022345672|8022348259|
- Length
- 716 aa
- Sequence
- MVSFPRNSYNPYQHIASNHKMIDFMTSITNAELEWNESGTPVSDQFDDVYFSNVNGLEETRYVFLKQNHLPERWLEHDQRRFVIAETGFGTGLNFLAVWQWFDAFLKDNPQAITKELHFISFEKYPLNKEDLIKAHQAWPELAEYATQLQEHYPIALPECHRIVLGDGTITLDLWFGDIKDCMPSVPTPKKGLVDAWFLDGFAPSKNPEMWNQNLFNGMAKLAKQDCSCATFTAAGFVRRGLIEAGFEMKKVKGFGTKREMIAGRLGEKHAHTNIKPWYGLSEHSDSQDIAIIGGGVASAALAKTLSRRGKNITLYCEHPQAAGNASGNNQGAIYPLLSEATSNVSRIFGPGLLFARQFINQAAKSIEFDHNWCGVNILMWDEGSTKKLNRMLEGNFHTDLIQRLSPEQANEKVGLPVDKESVYFPLGGWLSPLQLTQRLIGQLEETNKVSTHYQHQVTQLEWLEAEQQWQLTIETPRGEIQTKHDQVVVANGHKFTQFEQTQPVPLTPVKGQVSHIPTTENLNKLKTVLCFDGYLTPQNPNNGHHCIGANYDKTNIDQEFDIEVQQHNGERLHGSLPDQEWTKEVDTSGNLARQGIRSVSRDHLPFVGNVGDFEAIKEQYQNLHNFNPQRDSVDDVQTVTSFPNLFCFIGLGSRGLSSAPLLAEVLASQICGDPLPLPADVLEAIHPSRMWVRRLRKGKALTAGWVADKQANANQ
Sample Types
Isolate
76.6%
Metagenome
23.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.9%
Anthocoridae
8.1%
Drosophilidae
7.7%
Muscidae
4.6%
Curculionidae
4.6%
Tenebrionidae
4.2%
Elmidae
3.8%
Formicidae
3.5%
Calliphoridae
3.1%
Culicidae
2.3%
Termitidae
2.3%
Armadillidiidae
1.9%
Apidae
1.9%
Cerambycidae
1.5%
Palinuridae
1.2%
Talitridae
1.2%
Pteromalidae
1.2%
Tephritidae
1.2%
Majidae
0.8%
Aphididae
0.8%
Pentatomidae
0.8%
Daphniidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Artemiidae
0.4%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Trigoniulidae
0.4%
Nephropidae
0.4%
Rhinotermitidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Carabidae
0.4%
Siricidae
0.4%
Passalidae
0.4%
Crambidae
0.4%
Gryllidae
0.4%
Sarcophagidae
0.4%
Taxonomy
Archaea
0
Bacteria
291
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 2 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 3 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 4 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 5 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 6 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 7 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 8 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 9 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 10 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 11 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 12 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 13 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 14 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 15 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 16 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 17 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 18 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 19 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 20 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 21 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 22 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 23 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 24 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 25 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 26 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 27 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 28 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 31 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 32 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 33 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 34 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 35 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 36 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 40 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 41 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 42 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 43 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 44 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 45 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 46 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 47 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 48 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 49 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 50 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 51 | 2958255616 | Serratia marcescens TM | Isolate | |
| 52 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 53 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 54 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 55 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 56 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 57 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 58 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 59 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 60 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 61 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 62 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 63 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 64 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 65 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 66 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 67 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 68 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 69 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 70 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 71 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 72 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 73 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 74 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 75 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 76 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 77 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 78 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 79 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 80 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 81 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 82 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 83 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 84 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 85 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 86 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 87 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 88 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 89 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 90 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 91 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 92 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 93 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 94 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 95 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 96 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 97 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 98 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 99 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 100 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 101 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 102 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 103 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 104 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 105 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 106 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 107 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 108 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 109 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 110 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 111 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 112 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 113 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 114 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 115 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 116 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 117 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 118 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 119 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 120 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 121 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 122 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 123 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 124 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 125 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 126 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 127 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 128 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 129 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 130 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 131 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 132 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 133 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 134 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 135 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 136 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 137 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 138 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 139 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 140 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 141 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 142 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 143 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 144 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 145 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 146 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 147 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 148 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 149 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 150 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 151 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 152 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 153 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 154 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 155 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 156 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 157 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 158 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 159 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 160 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 161 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 162 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 163 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 164 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 165 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 166 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 167 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 168 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 169 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 170 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 171 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 172 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 173 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 174 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 175 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 176 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 177 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 178 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 179 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 180 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 181 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 182 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 183 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 184 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 185 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 186 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 187 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 188 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 189 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 190 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 191 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 192 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 193 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 194 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 195 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 196 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 197 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 198 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 199 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 200 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 201 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 202 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 203 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 204 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 205 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 206 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 207 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 208 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 209 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 210 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 211 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 212 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 213 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 214 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 215 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 216 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 217 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 218 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 219 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 220 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 221 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 222 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 223 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 224 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 225 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 226 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 227 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 228 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 229 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 230 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 231 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 232 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 233 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 234 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 235 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 236 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 237 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 238 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 239 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 240 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 241 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 242 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 243 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 244 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 245 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 246 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 247 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 248 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 249 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 250 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 251 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 252 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 253 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 254 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 255 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 256 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 257 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 258 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 259 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 260 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 261 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 262 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 263 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 264 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 265 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 266 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 267 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 268 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 269 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 270 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 271 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 272 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 273 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 274 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 275 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 276 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_175091 | 3300042659 | Bacteria | 58462 |
| 2 | Ga0466722_035155 | 3300042609 | Bacteria | 7117 |
| 3 | Ga0466724_06979 | 3300042649 | Bacteria | 72487 |
| 4 | Ga0466724_08705 | 3300042649 | Unclassified | 13447 |
| 5 | Ga0466724_23023 | 3300042649 | Bacteria | 116535 |
| 6 | Ga0466724_29917 | 3300042649 | Unclassified | 3016 |
| 7 | CVPL005W_1000891 | 3300002934 | Unclassified | 9635 |
| 8 | Ga0562377_0037 | 3300056842 | Bacteria | 656123 |
| 9 | Ga0160453_100700 | 3300012814 | Bacteria | 20137 |
| 10 | Ga0466707_165434 | 3300042601 | Bacteria | 3051 |
| 11 | Ga0466734_129637 | 3300042623 | Bacteria | 4462 |
| 12 | Ga0466730_092823 | 3300042625 | Bacteria | 6644 |
| 13 | Ga0466724_20429 | 3300042649 | Bacteria | 10275 |
| 14 | Ga0466724_41873 | 3300042649 | Bacteria | 54938 |
| 15 | FGTW_contig31883 | 2065487013 | Bacteria | 3220 |
| 16 | HBC_ctgsDRAFT_1000224 | 3300000333 | Bacteria | 13196 |
| 17 | Ga0063521_1000166 | 3300003973 | Bacteria | 49372 |
| 18 | Ga0103266_1000009 | 3300007067 | Bacteria | 102792 |
| 19 | Ga0102739_1000300 | 3300007095 | Bacteria | 11327 |
| 20 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 21 | Ga0562375_5828 | 3300056856 | Unclassified | 6588 |
| 22 | Ga0466701_022173 | 3300042598 | Bacteria | 77061 |
| 23 | SWWA_contig06911__length_4094___numreads_63 | 2100351016 | Unclassified | 4094 |
| 24 | Ga0102737_1001292 | 3300007142 | Bacteria | 7131 |
| 25 | Ga0103267_1000118 | 3300007190 | Bacteria | 31936 |
| 26 | Ga0562378_0018 | 3300056814 | Bacteria | 860182 |
| 27 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 28 | Ga0160455_100106 | 3300012837 | Bacteria | 123068 |
| 29 | Ga0160472_100019 | 3300012839 | Bacteria | 338828 |
| 30 | Ga0160444_100919 | 3300012841 | Unclassified | 7687 |
| 31 | Ga0160454_100228 | 3300012798 | Unclassified | 56494 |
| 32 | FGTW_contig30407 | 2065487013 | Bacteria | 95704 |
| 33 | SWWA_contig31705__length_14536___numreads_728 | 2100351016 | Bacteria | 14536 |
| 34 | 2227080778 | 2225789004 | Bacteria | 173705 |
| 35 | HBC_ctgsDRAFT_1004572 | 3300000333 | Bacteria | 3215 |
| 36 | Ga0063521_1001002 | 3300003973 | Unclassified | 9057 |
| 37 | Ga0104041_1002914 | 3300007106 | Bacteria | 9509 |
| 38 | Ga0160433_100403 | 3300012846 | Bacteria | 23537 |
| 39 | Ga0466724_67921 | 3300042649 | Bacteria | 67072 |
| 40 | DPOL_contig03866 | 2035918003 | Unclassified | 16500 |
| 41 | CVPL010L_1000111 | 3300002932 | Bacteria | 91591 |
| 42 | Ga0063521_1000204 | 3300003973 | Bacteria | 42441 |
| 43 | Ga0074188_1039638 | 3300005318 | Bacteria | 3342 |
| 44 | Ga0103268_1000364 | 3300007192 | Bacteria | 14489 |
| 45 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 46 | Ga0160443_102119 | 3300012848 | Bacteria | 4891 |
| 47 | Ga0466701_097606 | 3300042598 | Bacteria | 26639 |
| 48 | Ga0466730_039382 | 3300042625 | Unclassified | 43249 |
| 49 | Ga0466724_38338 | 3300042649 | Bacteria | 3178 |
| 50 | Ga0103264_1000099 | 3300007188 | Bacteria | 118917 |
| 51 | Ga0562375_0004 | 3300056856 | Bacteria | 3010592 |
| 52 | Ga0562374_0253 | 3300057007 | Bacteria | 106738 |
| 53 | Ga0466710_325543 | 3300042613 | Bacteria | 69248 |
| 54 | Ga0160445_100560 | 3300012847 | Unclassified | 17234 |
| 55 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 56 | Ga0466730_028713 | 3300042625 | Bacteria | 31522 |
| 57 | CVPL010L_1000410 | 3300002932 | Bacteria | 13809 |
| 58 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 59 | Ga0063521_1000026 | 3300003973 | Bacteria | 128736 |
| 60 | Ga0104147_1005879 | 3300007224 | Bacteria | 12324 |
| 61 | Ga0105008_1016739 | 3300007507 | Bacteria | 4189 |
| 62 | Ga0562375_2057 | 3300056856 | Unclassified | 23898 |
| 63 | Ga0265387_1000111 | 3300024582 | Bacteria | 18015 |
| 64 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 65 | Ga0466730_025937 | 3300042625 | Bacteria | 4853 |
| 66 | Ga0466724_56116 | 3300042649 | Bacteria | 64041 |
| 67 | Ga0160465_100488 | 3300012803 | Bacteria | 19065 |
| 68 | Ga0160466_100236 | 3300012809 | Bacteria | 38723 |
| 69 | DPOL_contig12646 | 2035918003 | Bacteria | 137161 |
| 70 | Ga0102736_1001570 | 3300007052 | Bacteria | 3951 |
| 71 | Ga0105005_1032721 | 3300007505 | Bacteria | 6584 |
Family Sequences
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05430 | GO:0016645 | oxidoreductase activity, acting on the CH-NH group of donors | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.92 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.