Protein Family IF13705

Metagenome Isolate
228 Members
198 Samples
85 Scaffolds
343.56 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8021546568|8021546799|
Length
387 aa
Sequence
VMKLSEDSPGNWGITEPGSDDTLTRLTLALDVMGGDFGPSVTVPAALQALNSNSQLTLLLVGDPDAITPLLAKADFEQRSRLQIIPAQSVIASDARPAQAIRSSRGSSMRVALELVKEGRAQACVSAGNTGALMGLAKLLLKPIEGIERPALVTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAVMGAVLAEEVVGIANPRVALLNIGEEEMKGLGSIRDAAAVLKTLPSLNYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLARRFSHLNPDQYNGACLLGLRGSVIKSHGAANQRAFSVAIEQAVQAVQRQIPQRIAARLESLYPAGFELPESDSDVNARQQSGTNGHD

📊 Sample Types

Isolate 62.7%
Metagenome 37.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.2%
Anthocoridae 10.4%
Drosophilidae 10.4%
Termitidae 9.8%
Muscidae 6.7%
Curculionidae 5.2%
Kalotermitidae 4.7%
Calliphoridae 4.7%
Tenebrionidae 3.1%
Culicidae 3.1%
Tephritidae 2.6%
Aphididae 2.6%
Cerambycidae 2.1%
Apidae 1.6%
Pteromalidae 1.6%
Pentatomidae 1.0%
Rhinotermitidae 1.0%
Sarcophagidae 1.0%
Passalidae 1.0%
Formicidae 1.0%
Armadillidiidae 1.0%
Hippoboscidae 0.5%
Thripidae 0.5%
Anthomyiidae 0.5%
Reduviidae 0.5%
Rhopalidae 0.5%
Glossinidae 0.5%
Carabidae 0.5%
Ceratophyllidae 0.5%
Crambidae 0.5%
Daphniidae 0.5%
Aphrophoridae 0.5%
Cicadellidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 220
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
2 2510065004 Arsenophonus melophagi ArM Isolate Hippoboscidae
3 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
4 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
5 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
6 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
7 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
8 2958255616 Serratia marcescens TM Isolate
9 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
12 651324086 Plautia crossota stali symbiont Isolate Unclassified
13 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
14 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
15 8071333649 Escherichia coli PN108 Isolate Calliphoridae
16 8071338694 Escherichia coli PN87 Isolate Calliphoridae
17 8102982778 Erwinia sp. S63 Isolate Curculionidae
18 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
26 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
27 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
28 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
29 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
30 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
31 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
32 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
33 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
34 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
35 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
36 8071343737 Escherichia coli PN119 Isolate Calliphoridae
37 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
38 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
39 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
40 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
41 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
42 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
47 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
48 2645727860 Winslowiella iniecta B120 Isolate Aphididae
49 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
50 2703719240 Serratia marcescens ano2 Isolate Unclassified
51 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
52 2871771314 Pantoea sp. Ae16 Isolate Culicidae
53 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
54 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
55 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
56 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
59 648276708 Pantoea sp. aB Isolate Unclassified
60 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
61 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
62 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
63 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
64 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
65 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
66 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
67 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
70 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
71 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
72 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
73 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
74 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
75 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
76 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
77 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
78 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
79 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
80 2937735258 Serratia marcescens KZ11 Isolate Apidae
81 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
82 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
83 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
84 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
85 8100181737 Kosakonia sp. S58 Isolate Curculionidae
86 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
87 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
88 2978102237 Serratia fonticola AeS1 Isolate Culicidae
89 3007994558 Escherichia alba B35 Isolate Tenebrionidae
90 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
91 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
92 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
93 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
94 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
95 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
96 2574179716 Serratia sp. DD3 Isolate Daphniidae
97 2585428135 Sodalis-like symbiont of Philaenus spumarius PSPU Isolate Aphrophoridae
98 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
99 2718217944 Serratia marcescens AS1 Isolate Culicidae
100 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
101 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
102 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
103 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
104 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
105 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
106 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
107 8100176769 Kosakonia sp. S57 Isolate Curculionidae
108 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
109 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
110 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
111 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
112 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
113 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
114 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
115 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
116 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
117 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
118 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
119 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
120 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
121 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
122 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
123 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
124 2836714267 Shimwellia blattae NCTC10965 Isolate
125 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
126 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
127 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
128 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
129 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
130 8021546568 Klebsiella sp. Kps Isolate Tephritidae
131 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
132 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
133 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
134 8071322446 Escherichia coli PN122 Isolate Calliphoridae
135 8100171289 Kosakonia sp. S42 Isolate Curculionidae
136 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
137 8103002986 Erwinia sp. S38 Isolate Curculionidae
138 8103008710 Erwinia sp. S43 Isolate Curculionidae
139 2971189173 Yersinia pestis A-1249 Isolate Unclassified
140 2984883310 Serratia symbiotica SCifornacula/2912 Isolate Aphididae
141 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
142 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
143 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
144 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
145 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
146 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
147 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
148 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
149 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
150 2648501209 Winslowiella iniecta B149 Isolate Aphididae
151 2703719239 Serratia marcescens ano1 Isolate Unclassified
152 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
153 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
154 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
155 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
156 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
157 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
158 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
159 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
160 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
161 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
162 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
163 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
164 651285005 Serratia symbiotica Tuscon Isolate Aphididae
165 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
166 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
167 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
168 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
169 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
170 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
171 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
172 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
173 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
174 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
175 2528768011 Serratia symbiotica SCt-VLC Isolate Aphididae
176 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
177 2648501856 Candidatus Baumannia cicadellinicola BGSS Isolate Cicadellidae
178 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
179 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
180 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
181 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
182 2898975184 Erwinia dacicola IL Isolate Tephritidae
183 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
184 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
185 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
186 8018312681 Enterobacter sp. OLF Isolate Tephritidae
187 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
188 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
189 8099192374 Erwinia typographi IC4 Isolate Curculionidae
190 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
191 2978161719 Serratia marcescens KZ2 Isolate Apidae
192 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
193 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
194 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
195 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
196 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
197 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
198 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0001 3300056842 Bacteria 5082480
2 Ga0123355_10293071 3300009826 Bacteria 2230
3 Ga0123356_10118328 3300010049 Bacteria 2572
4 Ga0123354_10001850 3300010882 Bacteria 26748
5 Ga0316159_12546 3300030930 Unclassified 1903
6 Ga0466717_072676 3300042604 Bacteria 7069
7 Ga0466730_090888 3300042625 Bacteria 3594
8 HBC_ctgsDRAFT_1003172 3300000333 Bacteria 3762
9 CVPL010L_1001065 3300002932 Bacteria 4427
10 Ga0074188_1000239 3300005318 Bacteria 35603
11 Ga0123356_10013626 3300010049 Bacteria 7837
12 Ga0466715_210466 3300042616 Bacteria 34126
13 Ga0160444_103682 3300012841 Unclassified 2156
14 Ga0466692_114364 3300042591 Bacteria 16144
15 IMNBL1DRAFT_c0000200 3300000062 Bacteria 52540
16 JGI24702J35022_10002832 3300002462 Bacteria 10504
17 JGI24702J35022_10016024 3300002462 Bacteria 4116
18 Ga0127645_101894 3300009461 Bacteria 19040
19 Ga0562379_0001 3300056790 Bacteria 4904077
20 Ga0123353_10634081 3300010167 Bacteria 1518
21 Ga0466723_136822 3300042618 Bacteria 12504
22 Ga0265387_1002360 3300024582 Bacteria 2669
23 Ga0466657_010114 3300042582 Bacteria 4381
24 Ga0466701_009809 3300042598 Bacteria 41352
25 Ga0466703_280493 3300042636 Bacteria 7782
26 Ga0466724_05253 3300042649 Bacteria 37771
27 Ga0466724_50619 3300042649 Bacteria 61999
28 DPOL_contig05772 2035918003 Bacteria 3787
29 Ga0104049_1131393 3300007103 Unclassified 2595
30 Ga0562374_0136 3300057007 Bacteria 182707
31 Ga0466710_108458 3300042613 Bacteria 43285
32 Ga0466728_274894 3300042620 Bacteria 1982
33 Ga0466725_275200 3300042654 Bacteria 66856
34 Ga0063521_1000002 3300003973 Bacteria 391466
35 Ga0063521_1000023 3300003973 Bacteria 132266
36 Ga0063521_1000098 3300003973 Bacteria 69691
37 Ga0105553_1074911 3300007767 Bacteria 8072
38 Ga0123357_10000219 3300009784 Bacteria 54155
39 Ga0466697_263855 3300042611 Bacteria 4542
40 Ga0466711_335248 3300042615 Bacteria 29031
41 Ga0265387_1000029 3300024582 Bacteria 55272
42 Ga0466719_008199 3300042606 Bacteria 1834
43 Ga0063521_1000381 3300003973 Bacteria 25187
44 Ga0466705_405999 3300042612 Unclassified 2066
45 Ga0466707_183043 3300042601 Bacteria 46436
46 Ga0466722_095779 3300042609 Bacteria 12603
47 Ga0466730_029967 3300042625 Bacteria 3861
48 Ga0466703_227153 3300042636 Bacteria 10801
49 Ga0466704_077709 3300042643 Bacteria 3493
50 Ga0466708_011361 3300042652 Unclassified 4257
51 FGTW_contig05376 2065487013 Bacteria 3872
52 2227080787 2225789004 Bacteria 142991
53 HBC_ctgsDRAFT_1005390 3300000333 Bacteria 2993
54 JGI24695J34938_10062745 3300002450 Bacteria 1577
55 Meta3P_1001095 3300002464 Bacteria 32510
56 Ga0104147_1012804 3300007224 Bacteria 10917
57 Ga0562377_0082 3300056842 Bacteria 346138
58 Ga0123355_10010093 3300009826 Bacteria 14431
59 Ga0123353_10327474 3300010167 Bacteria 2321
60 Ga0466728_197039 3300042620 Bacteria 33942
61 Ga0160456_102651 3300012820 Bacteria 3141
62 Ga0466657_010966 3300042582 Bacteria 29326
63 Ga0466713_089586 3300042602 Bacteria 4495
64 Ga0466719_494823 3300042606 Bacteria 7576
65 Ga0466734_097305 3300042623 Bacteria 4866
66 Ga0466730_041266 3300042625 Unclassified 4065
67 Ga0466730_099822 3300042625 Bacteria 30039
68 Ga0466704_116057 3300042643 Bacteria 7019
69 Ga0466724_47330 3300042649 Bacteria 4384
70 Ga0466724_52552 3300042649 Bacteria 241703
71 JGI24705J35276_12234976 3300002504 Bacteria 6048
72 CVPL010L_1001722 3300002932 Unclassified 4897
73 Ga0105005_1082070 3300007505 Bacteria 8423
74 Ga0466705_199363 3300042612 Bacteria 11967
75 Ga0466733_175091 3300042659 Bacteria 58462
76 Ga0562377_0215 3300056842 Bacteria 144945
77 Ga0562374_0001 3300057007 Bacteria 4762007
78 Ga0123355_10511368 3300009826 Bacteria 1475
79 Ga0123353_10166843 3300010167 Bacteria 3499
80 Ga0466712_233056 3300042614 Unclassified 1325
81 Ga0466723_078994 3300042618 Bacteria 4277
82 Ga0160436_1007795 3300012861 Bacteria 2434
83 Ga0466713_052057 3300042602 Bacteria 69837
84 Ga0466724_37450 3300042649 Bacteria 2797
85 Ga0104050_1026234 3300007153 Bacteria 5213

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2921816052 2921817727 311
2 3300042609 Ga0466722_095779 Ga0466722_095779_11233_12276 318
3 iso_pr_bacteria 2874504452 2874506739 320
4 iso_pr_bacteria 8103008710 8103013757 320
5 3300003973 Ga0063521_1000023 Ga0063521_100002387 325
6 3300042601 Ga0466707_183043 Ga0466707_183043_19095_20105 326
7 3300042625 Ga0466730_029967 Ga0466730_029967_16_996 326
8 3300007153 Ga0104050_1026234 Ga0104050_10262343 327
9 3300042643 Ga0466704_116057 Ga0466704_116057_3071_4054 327
10 3300002932 CVPL010L_1001722 CVPL010L_10017226 328
11 3300010167 Ga0123353_10166843 Ga0123353_101668432 330
12 3300042612 Ga0466705_199363 Ga0466705_199363_4501_5496 331
13 3300010167 Ga0123353_10634081 Ga0123353_106340812 332
14 3300042618 Ga0466723_078994 Ga0466723_078994_2242_3240 332
15 2035918003 DPOL_contig05772 DPOLB_947240 334
16 3300042602 Ga0466713_052057 Ga0466713_052057_336_1340 334
17 3300042625 Ga0466730_041266 Ga0466730_041266_2839_3843 334
18 3300042625 Ga0466730_090888 Ga0466730_090888_2368_3372 334
19 3300042649 Ga0466724_47330 Ga0466724_47330_506_1510 334
20 3300042649 Ga0466724_50619 Ga0466724_50619_10328_11332 334
21 3300042649 Ga0466724_52552 Ga0466724_52552_237466_238470 334
22 3300056842 Ga0562377_0215 Ga0562377_0215_116591_117595 334
23 iso_pr_bacteria 2574179716 2574245755 334
24 iso_pr_bacteria 2588253791 2588731605 334
25 iso_pr_bacteria 2703719239 2706050264 334
26 iso_pr_bacteria 2703719240 2706055542 334
27 iso_pr_bacteria 2718217944 2719462258 334
28 iso_pr_bacteria 2820483401 2820484925 334
29 iso_pr_bacteria 2874434233 2874434882 334
30 iso_pr_bacteria 2937735258 2937736172 334
31 iso_pr_bacteria 2937751072 2937751591 334
32 iso_pr_bacteria 2958255616 2958257176 334
33 iso_pr_bacteria 2961206375 2961206849 334
34 iso_pr_bacteria 2961232173 2961232217 334
35 iso_pr_bacteria 2961247850 2961249029 334
36 iso_pr_bacteria 2965197371 2965200995 334
37 iso_pr_bacteria 2970791725 2970793831 334
38 iso_pr_bacteria 2978161719 2978163415 334
39 iso_pr_bacteria 2996406003 2996407530 334
40 iso_pr_bacteria 2996467878 2996468806 334
41 iso_pr_bacteria 651285005 651302713 334
42 iso_pr_bacteria 8004285568 8004286312 334
43 iso_pr_bacteria 8004307473 8004308417 334
44 iso_pr_bacteria 8004571736 8004574628 334
45 iso_pr_bacteria 8004582426 8004583148 334
46 3300002464 Meta3P_1001095 Meta3P_10010952 335
47 3300003973 Ga0063521_1000098 Ga0063521_10000984 335
48 3300003973 Ga0063521_1000381 Ga0063521_100038121 335
49 3300007224 Ga0104147_1012804 Ga0104147_10128042 335
50 3300007767 Ga0105553_1074911 Ga0105553_10749119 335
51 3300042598 Ga0466701_009809 Ga0466701_009809_31998_33005 335
52 3300042606 Ga0466719_008199 Ga0466719_008199_816_1823 335
53 iso_pr_bacteria 2518285522 2518345774 335
54 iso_pr_bacteria 2731957969 2734005065 335
55 3300042620 Ga0466728_197039 Ga0466728_197039_19803_20849 336
56 3300042649 Ga0466724_05253 Ga0466724_05253_12521_13531 336
57 3300042649 Ga0466724_37450 Ga0466724_37450_233_1243 336
58 iso_pr_bacteria 2597489902 2597921344 336
59 iso_pr_bacteria 2597489903 2597925555 336
60 3300003973 Ga0063521_1000002 Ga0063521_1000002184 337
61 3300030930 Ga0316159_12546 Ga0316159_125462 338
62 iso_pr_bacteria 2648501856 2651561292 338
63 3300002450 JGI24695J34938_10062745 JGI24695J34938_100627451 340
64 3300009826 Ga0123355_10293071 Ga0123355_102930712 340
65 3300042582 Ga0466657_010114 Ga0466657_010114_3044_4069 341
66 3300042582 Ga0466657_010966 Ga0466657_010966_9787_10812 341
67 3300042604 Ga0466717_072676 Ga0466717_072676_2365_3390 341
68 3300042611 Ga0466697_263855 Ga0466697_263855_1522_2547 341
69 3300042613 Ga0466710_108458 Ga0466710_108458_4091_5116 341
70 3300042615 Ga0466711_335248 Ga0466711_335248_13126_14181 341
71 3300042616 Ga0466715_210466 Ga0466715_210466_1770_2825 341
72 3300042618 Ga0466723_136822 Ga0466723_136822_9644_10669 341
73 3300042623 Ga0466734_097305 Ga0466734_097305_944_1969 341
74 3300042636 Ga0466703_227153 Ga0466703_227153_8666_9721 341
75 3300042636 Ga0466703_280493 Ga0466703_280493_1820_2875 341
76 3300042652 Ga0466708_011361 Ga0466708_011361_1198_2253 341
77 3300042654 Ga0466725_275200 Ga0466725_275200_47480_48505 341
78 3300042659 Ga0466733_175091 Ga0466733_175091_24238_25263 341
79 iso_pr_bacteria 2524614573 2524997547 341
80 iso_pr_bacteria 2820042117 2820043845 341
81 iso_pr_bacteria 2820062699 2820063320 341
82 iso_pr_bacteria 2820065746 2820066651 341
83 iso_pr_bacteria 2820089333 2820090051 341
84 iso_pr_bacteria 2820121232 2820121574 341
85 iso_pr_bacteria 2820131053 2820132655 341
86 3300002462 JGI24702J35022_10002832 JGI24702J35022_100028325 342
87 3300002462 JGI24702J35022_10016024 JGI24702J35022_100160243 342
88 3300002504 JGI24705J35276_12234976 JGI24705J35276_122349766 342
89 3300009784 Ga0123357_10000219 Ga0123357_1000021950 342
90 3300009826 Ga0123355_10010093 Ga0123355_100100933 342
91 3300010049 Ga0123356_10013626 Ga0123356_100136265 342
92 3300010049 Ga0123356_10118328 Ga0123356_101183282 342
93 3300010167 Ga0123353_10327474 Ga0123353_103274744 342
94 3300010882 Ga0123354_10001850 Ga0123354_1000185010 342
95 3300042591 Ga0466692_114364 Ga0466692_114364_8240_9268 342
96 3300042620 Ga0466728_274894 Ga0466728_274894_618_1646 342
97 iso_pr_bacteria 2507262057 2507517350 342
98 iso_pr_bacteria 2820504582 2820505433 343
99 3300000062 IMNBL1DRAFT_c0000200 IMNBL1DRAFT_000020034 344
100 3300009826 Ga0123355_10511368 Ga0123355_105113682 344
101 3300012861 Ga0160436_1007795 Ga0160436_10077952 344
102 3300056790 Ga0562379_0001 Ga0562379_0001_3215577_3216611 344
103 3300056842 Ga0562377_0001 Ga0562377_0001_1723447_1724481 344
104 3300056842 Ga0562377_0082 Ga0562377_0082_282231_283265 344
105 3300057007 Ga0562374_0136 Ga0562374_0136_25001_26035 344
106 iso_pr_bacteria 2519899623 2520392978 344
107 iso_pr_bacteria 2528768011 2528815165 344
108 iso_pr_bacteria 2531839602 2534151855 344
109 iso_pr_bacteria 2645727860 2647286561 344
110 iso_pr_bacteria 2648501209 2648983158 344
111 iso_pr_bacteria 2651870110 2653795226 344
112 iso_pr_bacteria 2822856742 2822859530 344
113 iso_pr_bacteria 2824588292 2824588778 344
114 iso_pr_bacteria 2833053935 2833055058 344
115 iso_pr_bacteria 2835335304 2835339362 344
116 iso_pr_bacteria 2836714267 2836716802 344
117 iso_pr_bacteria 2837516909 2837517295 344
118 iso_pr_bacteria 2846386538 2846387118 344
119 iso_pr_bacteria 2847708326 2847710275 344
120 iso_pr_bacteria 2856068565 2856069533 344
121 iso_pr_bacteria 2859315706 2859316734 344
122 iso_pr_bacteria 2874880541 2874882008 344
123 iso_pr_bacteria 2876334352 2876337602 344
124 iso_pr_bacteria 2876358570 2876363073 344
125 iso_pr_bacteria 2885043073 2885046622 344
126 iso_pr_bacteria 2885046828 2885047198 344
127 iso_pr_bacteria 2885050628 2885051084 344
128 iso_pr_bacteria 2885054481 2885054774 344
129 iso_pr_bacteria 2885058212 2885061921 344
130 iso_pr_bacteria 2885061987 2885062389 344
131 iso_pr_bacteria 2885065815 2885066144 344
132 iso_pr_bacteria 2898975184 2898977401 344
133 iso_pr_bacteria 2898991528 2898991938 344
134 iso_pr_bacteria 2901296437 2901298034 344
135 iso_pr_bacteria 2921842437 2921843572 344
136 iso_pr_bacteria 2937387794 2937388239 344
137 iso_pr_bacteria 2937427229 2937430434 344
138 iso_pr_bacteria 2957730672 2957734990 344
139 iso_pr_bacteria 2964846109 2964850541 344
140 iso_pr_bacteria 2964859436 2964863510 344
141 iso_pr_bacteria 2967915117 2967915208 344
142 iso_pr_bacteria 2967924226 2967928290 344
143 iso_pr_bacteria 2970322301 2970325441 344
144 iso_pr_bacteria 2970335472 2970339467 344
145 iso_pr_bacteria 2977691992 2977693824 344
146 iso_pr_bacteria 2977727922 2977732303 344
147 iso_pr_bacteria 2977745872 2977748536 344
148 iso_pr_bacteria 2978102237 2978102407 344
149 iso_pr_bacteria 2979682021 2979684060 344
150 iso_pr_bacteria 2984883310 2984883875 344
151 iso_pr_bacteria 3004364956 3004368906 344
152 iso_pr_bacteria 637000270 637853007 344
153 iso_pr_bacteria 8001059720 8001061689 344
154 iso_pr_bacteria 8006199443 8006203145 344
155 iso_pr_bacteria 8018312681 8018313037 344
156 iso_pr_bacteria 8062647588 8062651946 344
157 iso_pr_bacteria 8099192374 8099195040 344
158 iso_pr_bacteria 8103002986 8103004214 344
159 iso_pr_bacteria 8110023836 8110026299 344
160 3300005318 Ga0074188_1000239 Ga0074188_10002395 345
161 3300007103 Ga0104049_1131393 Ga0104049_11313932 345
162 iso_pr_bacteria 2510065002 2510071139 345
163 iso_pr_bacteria 2510065003 2510074200 345
164 iso_pr_bacteria 2524614872 2526111992 345
165 iso_pr_bacteria 2744054871 2745950073 345
166 iso_pr_bacteria 2836755666 2836758294 345
167 3300009461 Ga0127645_101894 Ga0127645_10189413 346
168 iso_pr_bacteria 2529292851 2530233293 346
169 iso_pr_bacteria 2619619082 2620610289 346
170 iso_pr_bacteria 2778261152 2779038220 346
171 iso_pr_bacteria 2778261153 2779043420 346
172 iso_pr_bacteria 2841260384 2841261074 346
173 iso_pr_bacteria 2850131454 2850133114 346
174 iso_pr_bacteria 2871760914 2871762662 346
175 iso_pr_bacteria 2896187957 2896190183 346
176 iso_pr_bacteria 3001459110 3001459984 346
177 iso_pr_bacteria 3001462594 3001463572 346
178 iso_pr_bacteria 648276708 648769269 346
179 iso_pr_bacteria 651324086 651696693 346
180 iso_pr_bacteria 8065462725 8065462868 346
181 iso_pr_bacteria 8065466226 8065467348 346
182 iso_pr_bacteria 8065469765 8065471101 346
183 iso_pr_bacteria 8074288691 8074288938 346
184 iso_pr_bacteria 8074292191 8074292763 346
185 iso_pr_bacteria 8101676404 8101677612 346
186 iso_pr_bacteria 8101680043 8101681478 346
187 iso_pr_bacteria 8101683685 8101686350 346
188 iso_pr_bacteria 8102982778 8102986120 346
189 iso_pr_bacteria 2971189173 2971193254 347
190 3300000333 HBC_ctgsDRAFT_1003172 HBC_ctgsDRAFT_10031726 348
191 3300042602 Ga0466713_089586 Ga0466713_089586_433_1479 348
192 iso_pr_bacteria 2510065004 2510075964 348
193 iso_pr_bacteria 2585428135 2588036228 348
194 iso_pr_bacteria 2871771314 2871773271 348
195 3300057007 Ga0562374_0001 Ga0562374_0001_904788_905837 349
196 iso_pr_bacteria 2537561600 2537926050 349
197 3300007505 Ga0105005_1082070 Ga0105005_10820709 350
198 iso_pr_bacteria 2756170277 2756796332 350
199 2225789004 2227080787 2227453669 352
200 3300024582 Ga0265387_1002360 Ga0265387_10023601 352
201 3300042614 Ga0466712_233056 Ga0466712_233056_94_1152 352
202 3300042612 Ga0466705_405999 Ga0466705_405999_579_1673 354
203 3300042643 Ga0466704_077709 Ga0466704_077709_2309_3403 354
204 2065487013 FGTW_contig05376 FGTW_02411530 356
205 3300042606 Ga0466719_494823 Ga0466719_494823_5502_6572 356
206 iso_pr_bacteria 8071322446 8071323798 356
207 iso_pr_bacteria 8071333649 8071334836 356
208 iso_pr_bacteria 8071338694 8071339939 356
209 iso_pr_bacteria 8071343737 8071348798 356
210 iso_pr_bacteria 8073124432 8073127848 356
211 3300000333 HBC_ctgsDRAFT_1005390 HBC_ctgsDRAFT_10053902 357
212 iso_pr_bacteria 2938192669 2938196018 359
213 iso_pr_bacteria 3007994558 3007995097 359
214 iso_pr_bacteria 2513020017 2513101051 360
215 iso_pr_bacteria 8100171289 8100172656 362
216 iso_pr_bacteria 8100176769 8100179144 362
217 iso_pr_bacteria 8100181737 8100184061 362
218 3300012820 Ga0160456_102651 Ga0160456_1026515 363
219 3300012841 Ga0160444_103682 Ga0160444_1036823 363
220 iso_pr_bacteria 8028002147 8028003832 365
221 iso_pr_bacteria 8004118532 8004119725 371
222 3300024582 Ga0265387_1000029 Ga0265387_10000296 380
223 iso_pr_bacteria 8021535516 8021539699 383
224 3300042625 Ga0466730_099822 Ga0466730_099822_25944_27098 384
225 iso_pr_bacteria 2588253732 2588528729 386
226 3300002932 CVPL010L_1001065 CVPL010L_10010654 387
227 iso_pr_bacteria 8021540981 8021543794 387
228 iso_pr_bacteria 8021546568 8021546799 387

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02504 FA_synthesis Fatty acid synthesis protein 27 353 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.