Protein Family IF13704

Metagenome Isolate
433 Members
327 Samples
173 Scaffolds
390.28 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8021540981|8021545593|
Length
443 aa
Sequence
MVSRNYPLTVSWINQCTGTVCSLLRNMYGSRHECRHYWYNNFCEGIAMEQTWRWYGPNDPVSLDDVRQAGATGVVTALHHIANGQVWPVDEIKERQALLAAKGLTWSVVESIPVHEDIKTHSGQYTTWIANYQQSIRNLAACGIDTVCYNFMPILDWTRTDLEYELPDGSRALRFDQIAFAAFELHILKRPGAEADYSEEEQRQAEAYYKAMSEADIEKLTRNIIAGLPGAEEGYTLDQFRARLAEYDHIDKAQLRENMAYFLRAIVPVCEEVGIRLAVHPDDPPRPILGLPRIVSTIEDMQWLKETVDSINNGFTMCTGSYGVRADNDLVKMVETFGDRIHFTHLRSTCREANPKTFHEAAHLSGDVNMVAVVDAILREEQRRKQAGDLRPIPFRPDHGHQMLDDLRKKTNPGYSAIGRLKGMAEVRGVELALKMTKYPELL

📊 Sample Types

Isolate 59.8%
Metagenome 40.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 29.4%
Unclassified 20.9%
Anthocoridae 4.4%
Drosophilidae 3.8%
Muscidae 3.8%
Kalotermitidae 3.8%
Formicidae 3.8%
Curculionidae 3.5%
Culicidae 2.8%
Calliphoridae 2.5%
Termitidae 2.5%
Tenebrionidae 2.5%
Armadillidiidae 1.9%
Termopsidae 1.3%
Cerambycidae 1.3%
Talitridae 0.9%
Palinuridae 0.9%
Tephritidae 0.9%
Aphididae 0.6%
Sarcophagidae 0.6%
Daphniidae 0.6%
Rhinotermitidae 0.6%
Pentatomidae 0.6%
Plutellidae 0.6%
Elmidae 0.6%
Passalidae 0.6%
Acrididae 0.3%
Scarabaeidae 0.3%
Ceratophyllidae 0.3%
Nephropidae 0.3%
Thripidae 0.3%
Hodotermitidae 0.3%
Rhopalidae 0.3%
Penaeidae 0.3%
Carabidae 0.3%
Pteromalidae 0.3%
Majidae 0.3%
Crambidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 404
Eukaryota 0
Viruses 0
Unclassified 29

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2035265001 Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 Metagenome Acrididae
2 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
3 2645727860 Winslowiella iniecta B120 Isolate Aphididae
4 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
5 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
6 2703719240 Serratia marcescens ano2 Isolate Unclassified
7 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
8 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
9 2834098943 Gilliamella apis NO3 Isolate Apidae
10 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
11 2846480698 Gilliamella apis N-G4 Isolate Apidae
12 2849449383 Gilliamella apicola WF3-4 Isolate Apidae
13 2849458003 Gilliamella apicola HK7 Isolate Apidae
14 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
15 2857876020 Gilliamella apicola Nev6-6 Isolate Apidae
16 2857881114 Gilliamella apis N-G3 Isolate Apidae
17 2868494745 Gilliamella apis NO1 Isolate Apidae
18 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
19 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
20 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
21 2876016455 Gilliamella apicola N6 Isolate Apidae
22 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
23 2908136803 Vibrio owensii 1700302 Isolate Unclassified
24 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
25 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
26 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
27 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
28 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
29 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
30 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
31 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
35 640963010 Vibrio harveyi HY01 Isolate Unclassified
36 648276708 Pantoea sp. aB Isolate Unclassified
37 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
38 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
39 8022345672 Vibrio sp. 070316B Isolate Unclassified
40 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
41 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
42 8088486376 Gilliamella apis ESL0172 Isolate Apidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
46 2505679068 Isoptericola variabilis 225 Isolate Unclassified
47 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
48 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
49 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
50 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
51 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
52 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
53 2841195917 Gilliamella apicola wkB7 Isolate Apidae
54 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
55 2849452216 Gilliamella apicola AW11 Isolate Apidae
56 2849455045 Gilliamella apicola NO8 Isolate Apidae
57 2850895757 Vibrio campbellii 170502 Isolate Unclassified
58 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
59 2868504459 Gilliamella apis NO4 Isolate Apidae
60 2870917785 Gilliamella apis NO15 Isolate Apidae
61 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
62 2872471378 Vibrio owensii V180403 Isolate Unclassified
63 2873636219 Gilliamella apicola App2-1 Isolate Apidae
64 2876033458 Gilliamella apicola AM6 Isolate Apidae
65 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
66 2878464769 Gilliamella apis ESL0169 Isolate Apidae
67 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
68 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
69 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
70 2958255616 Serratia marcescens TM Isolate
71 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
72 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
73 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
74 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
75 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
76 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
77 8022087107 Vibrio sp. OULL4 Isolate Unclassified
78 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
79 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
80 8071333649 Escherichia coli PN108 Isolate Calliphoridae
81 8071338694 Escherichia coli PN87 Isolate Calliphoridae
82 8102982778 Erwinia sp. S63 Isolate Curculionidae
83 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
84 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
85 2504756063 Isoptericola variabilis J5 Isolate Unclassified
86 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
87 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
88 2574179716 Serratia sp. DD3 Isolate Daphniidae
89 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
90 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
91 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
92 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
93 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
94 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
95 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
96 2718217944 Serratia marcescens AS1 Isolate Culicidae
97 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
98 2840795165 Gilliamella apicola N-22 Isolate Apidae
99 2846483029 Gilliamella apis AM1 Isolate Apidae
100 2849466174 Gilliamella apis P83G Isolate Apidae
101 2854134697 Gilliamella apicola Fer4-1 Isolate Apidae
102 2854144746 Gilliamella apicola NO6 Isolate Apidae
103 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
104 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
105 2857873190 Gilliamella apicola Nev5-1 Isolate Apidae
106 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
107 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
108 2876030618 Gilliamella apicola HK2 Isolate Apidae
109 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
110 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
111 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
112 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
113 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
114 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
115 3300000461 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 Metagenome Apidae
116 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
117 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
118 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
119 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
120 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
121 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
122 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
123 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
124 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
125 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
126 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
127 8100176769 Kosakonia sp. S57 Isolate Curculionidae
128 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
129 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
130 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
131 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
132 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
133 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
134 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
135 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
136 2684622551 Vibrio campbellii E1 Isolate Unclassified
137 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
138 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
139 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
140 2846472545 Gilliamella sp. N-W3 Isolate Apidae
141 2846475167 Gilliamella apicola N-G5 Isolate Apidae
142 2846493360 Gilliamella apis N-G1 Isolate Apidae
143 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
144 2854132136 Gilliamella apicola wkB292 Isolate Apidae
145 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
146 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
147 2870908367 Gilliamella apis NO13 Isolate Apidae
148 2873648542 Gilliamella apicola NO10 Isolate Apidae
149 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
150 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
151 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
152 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
153 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
154 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
155 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
156 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
157 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
158 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
159 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
160 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
161 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
162 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
163 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
164 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
165 8022096067 Vibrio sp. SALL6 Isolate Unclassified
166 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
167 8051461712 Vibrio vulnificus Vv002 Isolate
168 8060845732 Vibrio vulnificus Vv006 Isolate
169 8071343737 Escherichia coli PN119 Isolate Calliphoridae
170 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
171 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
172 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
173 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
174 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
175 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
176 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
177 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
178 2836714267 Shimwellia blattae NCTC10965 Isolate
179 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
180 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
181 2846485327 Gilliamella apicola AM4 Isolate Apidae
182 2849471304 Gilliamella apicola NO5 Isolate Apidae
183 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
184 2873643457 Gilliamella apis A-4-12 Isolate Apidae
185 2876011797 Gilliamella apis NO16 Isolate Apidae
186 2876022486 Gilliamella apicola A8 Isolate Apidae
187 2876027665 Gilliamella apicola P54G Isolate Apidae
188 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
189 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
190 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
191 2971189173 Yersinia pestis A-1249 Isolate Unclassified
192 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
193 2998907766 Penaeicola halotolerans LMIT005 Isolate
194 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
195 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
196 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
197 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
198 8021546568 Klebsiella sp. Kps Isolate Tephritidae
199 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
200 8071322446 Escherichia coli PN122 Isolate Calliphoridae
201 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
202 8100171289 Kosakonia sp. S42 Isolate Curculionidae
203 8103002986 Erwinia sp. S38 Isolate Curculionidae
204 8103008710 Erwinia sp. S43 Isolate Curculionidae
205 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
206 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
207 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
208 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
209 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
210 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
211 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
212 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
213 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
214 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
215 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
216 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
217 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
218 2791355473 Vibrio barjaei 3062 Isolate Unclassified
219 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
220 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
221 2846477985 Gilliamella apicola Fer1-1 Isolate Apidae
222 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
223 2857868033 Gilliamella apis P62G Isolate Apidae
224 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
225 2870905362 Gilliamella apicola Nev3-1 Isolate Apidae
226 2873645950 Gilliamella apicola Fer2-1 Isolate Apidae
227 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
228 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
229 2978161719 Serratia marcescens KZ2 Isolate Apidae
230 3000861951 Budvicia diplopodorum D9 Isolate
231 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
232 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
233 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
234 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
235 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
236 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
237 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
238 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
239 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
240 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
241 8018312681 Enterobacter sp. OLF Isolate Tephritidae
242 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
243 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
244 8051534459 Vibrio vulnificus Vv004 Isolate
245 8088488961 Gilliamella apis ESL0169 Isolate Apidae
246 8099192374 Erwinia typographi IC4 Isolate Curculionidae
247 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
248 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
249 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
250 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
251 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
252 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
253 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
254 2648501209 Winslowiella iniecta B149 Isolate Aphididae
255 2703719239 Serratia marcescens ano1 Isolate Unclassified
256 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
257 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
258 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
259 2854147632 Gilliamella apicola wkB195 Isolate Apidae
260 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
261 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
262 2868489326 Gilliamella apicola N10 Isolate Apidae
263 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
264 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
265 2873633977 Gilliamella apicola wkB178 Isolate Apidae
266 2873638493 Gilliamella apicola wkB72 Isolate Apidae
267 2876025319 Gilliamella apis NO12 Isolate Apidae
268 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
269 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
270 2912570088 Vibrio parahaemolyticus CHN25 Isolate
271 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
272 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
273 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
274 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
275 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
276 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
277 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
278 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
279 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
280 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
281 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
282 8004541719 Serratia marcescens KZ19 Isolate Apidae
283 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
284 8051551332 Vibrio vulnificus Vv003 Isolate
285 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
286 8088493931 Gilliamella apis K-MP18 Isolate Apidae
287 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
288 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
289 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
290 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
291 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
292 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
293 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
294 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
295 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
296 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
297 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
298 2846490831 Gilliamella apis ESL0172 Isolate Apidae
299 2849468476 Gilliamella apicola N-28 Isolate Apidae
300 2854129949 Gilliamella apis M1-2G Isolate Apidae
301 2854137290 Gilliamella apicola Imp1-6 Isolate Apidae
302 2857883421 Gilliamella apicola N2 Isolate Apidae
303 2857891623 Gilliamella apicola wkB171 Isolate Apidae
304 2864836148 Arcicella rosea S00070 Isolate Elmidae
305 2868486652 Gilliamella sp. N-G2 Isolate Apidae
306 2868506828 Gilliamella apicola App4-10 Isolate Apidae
307 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
308 2870900452 Gilliamella apis NO14 Isolate Apidae
309 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
310 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
311 2937735258 Serratia marcescens KZ11 Isolate Apidae
312 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
313 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
314 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
315 2978102237 Serratia fonticola AeS1 Isolate Culicidae
316 3007994558 Escherichia alba B35 Isolate Tenebrionidae
317 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
318 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
319 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
320 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
321 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
322 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
323 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
324 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
325 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
326 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
327 8100181737 Kosakonia sp. S58 Isolate Curculionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0001 3300056842 Bacteria 5082480
2 Ga0466714_078883 3300042603 Bacteria 3393
3 Ga0123355_10166864 3300009826 Bacteria 3301
4 Ga0123356_10216159 3300010049 Bacteria 1970
5 Ga0466728_177231 3300042620 Bacteria 3298
6 Ga0160446_100265 3300012835 Bacteria 32629
7 Ga0160455_100616 3300012837 Unclassified 15513
8 Ga0160433_100127 3300012846 Bacteria 68773
9 Ga0466690_147187 3300042590 Bacteria 19575
10 Ga0466692_099715 3300042591 Bacteria 2244
11 Ga0466734_087919 3300042623 Bacteria 2032
12 Ga0466730_009517 3300042625 Bacteria 72332
13 Ga0466730_033506 3300042625 Bacteria 40067
14 Ga0466703_353799 3300042636 Bacteria 98308
15 Ga0466724_62278 3300042649 Bacteria 2981
16 FGTW_contig06820 2065487013 Unclassified 1743
17 IMNBL1DRAFT_c0002869 3300000062 Bacteria 11558
18 SCG598L16_135900 3300000490 Bacteria 90439
19 CVPL010W_10005429 3300002931 Bacteria 13640
20 CVPL010L_1003405 3300002932 Unclassified 1822
21 Ga0068302_10029072 3300005071 Bacteria 5258
22 Ga0074302_1136717 3300005316 Unclassified 1725
23 Ga0103268_1000493 3300007192 Bacteria 11934
24 Ga0466733_140515 3300042659 Bacteria 6065
25 Ga0562374_0001 3300057007 Bacteria 4762007
26 Ga0123353_10135808 3300010167 Bacteria 3944
27 Ga0123353_10225099 3300010167 Bacteria 2929
28 Ga0466711_093700 3300042615 Bacteria 2912
29 Ga0466728_065730 3300042620 Bacteria 16851
30 Ga0160448_104662 3300012854 Unclassified 3762
31 Ga0247290_00600 3300035364 Unclassified 5937
32 Ga0466691_009899 3300042593 Bacteria 3783
33 Ga0466696_189901 3300042596 Bacteria 10950
34 Ga0466730_003235 3300042625 Unclassified 1468
35 Ga0466730_048631 3300042625 Bacteria 90164
36 Ga0466724_37455 3300042649 Bacteria 30532
37 Ga0063521_1000009 3300003973 Bacteria 190208
38 Ga0104051_1101869 3300007078 Bacteria 2900
39 Ga0104041_1032490 3300007106 Bacteria 5743
40 Ga0104040_1142036 3300007149 Unclassified 4661
41 Ga0104040_1142291 3300007149 Bacteria 3075
42 Ga0105553_1075025 3300007767 Bacteria 5413
43 Ga0466707_037111 3300042601 Unclassified 4075
44 Ga0466707_382688 3300042601 Bacteria 19671
45 Ga0466713_129978 3300042602 Bacteria 70140
46 Ga0466713_135258 3300042602 Bacteria 7268
47 Ga0466713_140012 3300042602 Bacteria 490520
48 Ga0466715_119024 3300042616 Bacteria 12209
49 Ga0160467_100029 3300012829 Bacteria 258610
50 Ga0160433_100012 3300012846 Bacteria 265415
51 Ga0160433_100240 3300012846 Bacteria 39651
52 Ga0160445_100114 3300012847 Bacteria 71378
53 Ga0160448_100016 3300012854 Bacteria 240625
54 Ga0265387_1000398 3300024582 Bacteria 6932
55 Ga0316159_10001 3300030930 Bacteria 1642808
56 Ga0466690_018538 3300042590 Bacteria 3986
57 Ga0466735_090852 3300042624 Bacteria 7986
58 Ga0466730_025729 3300042625 Bacteria 20513
59 FGTW_contig30559 2065487013 Bacteria 16349
60 HBC_ctgsDRAFT_1000306 3300000333 Bacteria 11173
61 CVPL010L_1000009 3300002932 Bacteria 129286
62 Ga0063521_1000068 3300003973 Bacteria 87932
63 Ga0063521_1003237 3300003973 Bacteria 3886
64 Ga0063521_1009412 3300003973 Unclassified 2339
65 Ga0074278_137551 3300005721 Unclassified 8092
66 Ga0103261_1000191 3300007083 Unclassified 10298
67 Ga0102740_1000767 3300007140 Bacteria 9617
68 Ga0103264_1000386 3300007188 Bacteria 23118
69 Ga0104147_1012875 3300007224 Bacteria 13297
70 Ga0562377_0037 3300056842 Bacteria 656123
71 Ga0466706_206411 3300042599 Bacteria 2620
72 Ga0466707_286262 3300042601 Unclassified 1985
73 Ga0466722_111166 3300042609 Bacteria 17794
74 Ga0160471_100661 3300012812 Bacteria 8669
75 Ga0466723_217097 3300042618 Bacteria 2443
76 Ga0160444_103073 3300012841 Bacteria 2441
77 Ga0160435_1000045 3300012857 Bacteria 92320
78 Ga0466727_007031 3300042655 Bacteria 10843
79 DPOL_contig16210 2035918003 Bacteria 5896
80 gam1t_NODE_680599_length=8012_GC=33_9_Contigs=9 2189573031 Unclassified 8092
81 IMNBL1DRAFT_c0005354 3300000062 Bacteria 7366
82 SCG598P17_11240 3300000461 Bacteria 36996
83 CVPL010L_1000130 3300002932 Bacteria 22349
84 Ga0063521_1008583 3300003973 Unclassified 2440
85 Ga0074188_1155755 3300005318 Unclassified 1991
86 Ga0103266_1000989 3300007067 Bacteria 5339
87 Ga0103265_1000088 3300007068 Unclassified 13654
88 Ga0104040_1000680 3300007149 Bacteria 5004
89 Ga0466705_307273 3300042612 Bacteria 3111
90 Ga0562377_0004 3300056842 Bacteria 3525959
91 Ga0466707_154277 3300042601 Bacteria 12010
92 Ga0466707_300943 3300042601 Bacteria 7115
93 Ga0466713_109231 3300042602 Bacteria 188899
94 Ga0466714_131109 3300042603 Bacteria 2980
95 Ga0466716_208958 3300042605 Bacteria 2034
96 Ga0466711_382674 3300042615 Bacteria 10110
97 Ga0160433_101599 3300012846 Unclassified 5928
98 Ga0316159_10755 3300030930 Bacteria 4690
99 Ga0466690_121026 3300042590 Bacteria 3618
100 Ga0466735_037453 3300042624 Bacteria 5588
101 Ga0466735_112259 3300042624 Bacteria 12703
102 Ga0466730_008632 3300042625 Bacteria 30892
103 Ga0466704_458428 3300042643 Bacteria 21257
104 Ga0466727_300761 3300042655 Bacteria 2237
105 2227507941 2225789004 Bacteria 76739
106 Ga0074278_129590 3300005721 Bacteria 100971
107 Ga0104051_1103221 3300007078 Unclassified 1608
108 Ga0102738_1001992 3300007141 Bacteria 3087
109 Ga0466733_124706 3300042659 Bacteria 3381
110 Ga0562379_0001 3300056790 Bacteria 4904077
111 Ga0466707_372205 3300042601 Bacteria 11183
112 Ga0123355_10019058 3300009826 Bacteria 10916
113 Ga0123355_10061261 3300009826 Bacteria 6076
114 Ga0466723_340821 3300042618 Bacteria 6319
115 Ga0160468_100081 3300012819 Bacteria 123596
116 Ga0160468_106367 3300012819 Bacteria 1282
117 Ga0160455_100069 3300012837 Bacteria 184978
118 Ga0466690_041750 3300042590 Bacteria 12537
119 Ga0466690_093759 3300042590 Bacteria 4343
120 Ga0466691_051100 3300042593 Bacteria 8242
121 Ga0466703_290973 3300042636 Bacteria 1717
122 Ga0466724_45304 3300042649 Bacteria 38049
123 2227100826 2225789004 Unclassified 1792
124 IMNBL1DRAFT_c0001464 3300000062 Bacteria 17646
125 SCG598I20_11690 3300000473 Bacteria 50215
126 Ga0063521_1000137 3300003973 Bacteria 54669
127 Ga0074311_1143457 3300005317 Bacteria 1584
128 Ga0103264_1000161 3300007188 Bacteria 55153
129 Ga0105008_1017997 3300007507 Unclassified 3812
130 Ga0562377_0016 3300056842 Bacteria 1202354
131 Ga0466707_126289 3300042601 Unclassified 4159
132 Ga0466713_098270 3300042602 Bacteria 331235
133 Ga0466713_122291 3300042602 Bacteria 25380
134 Ga0466726_003449 3300042619 Bacteria 4084
135 Ga0160448_103017 3300012854 Bacteria 5038
136 Ga0466696_337848 3300042596 Bacteria 1264
137 Ga0466735_071698 3300042624 Bacteria 4273
138 Ga0466735_114761 3300042624 Bacteria 3857
139 Ga0466703_043626 3300042636 Bacteria 13742
140 GhopperDRAF_NODE_365295_len_1505_cov_6_616611 2035265001 Bacteria 1535
141 FGTW_contig31104 2065487013 Bacteria 6095
142 gam1t_NODE_193726_length=9665_GC=33_4_Contigs=1 2189573031 Unclassified 9665
143 Ga0074278_110845 3300005721 Bacteria 9665
144 Ga0102736_1000494 3300007052 Bacteria 7959
145 Ga0466705_110916 3300042612 Bacteria 65673
146 Ga0562378_0401 3300056814 Bacteria 79876
147 Ga0466713_038994 3300042602 Bacteria 1331
148 Ga0466713_054440 3300042602 Unclassified 2376
149 Ga0466713_081773 3300042602 Bacteria 94516
150 Ga0466714_154944 3300042603 Bacteria 103066
151 Ga0466715_093005 3300042616 Bacteria 8882
152 Ga0466723_034132 3300042618 Bacteria 4364
153 Ga0466726_062467 3300042619 Bacteria 4896
154 Ga0160433_101657 3300012846 Bacteria 5770
155 Ga0265387_1000021 3300024582 Bacteria 68555
156 Ga0247289_0005 3300035363 Bacteria 82561
157 Ga0247289_0008 3300035363 Unclassified 74200
158 Ga0247290_00008 3300035364 Bacteria 91582
159 Ga0466690_198094 3300042590 Bacteria 1749
160 Ga0466696_171399 3300042596 Bacteria 3327
161 Ga0466730_049373 3300042625 Unclassified 2612
162 Ga0466704_583464 3300042643 Bacteria 34188
163 Ga0466709_279016 3300042648 Bacteria 4006
164 Ga0466724_67748 3300042649 Unclassified 22717
165 DPOL_contig15617 2035918003 Unclassified 63688
166 FGTW_contig31625 2065487013 Bacteria 3862
167 gam1t_NODE_10840_length=100971_GC=34_2_Contigs=1 2189573031 Bacteria 100971
168 gam1t_NODE_660665_length=13869_GC=34_7_Contigs=2 2189573031 Bacteria 13879
169 Meta3P_1000921 3300002464 Bacteria 16122
170 Ga0063521_1000484 3300003973 Bacteria 19204
171 Ga0074278_104671 3300005721 Bacteria 13879
172 Ga0104042_1119862 3300007130 Unclassified 2609
173 Ga0102738_1000248 3300007141 Bacteria 10734

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03786 UxuA D-mannonate dehydratase (UxuA) 48 435 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.