Protein Family IF13651
Metagenome
Metatranscriptome
Isolate
320
Members
149
Samples
238
Scaffolds
187.59
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8007211731|8007213873|
- Length
- 186 aa
- Sequence
- MSLIGKEVEEFAAKAYHNGEFIDVSSEDFKGKWNIVCFYPADFTFVCPTELEDLQEQYATLKDLGVEVYSVSTDTHFTHKAWHDHSDAIGKIEYIMIGDPSHKISQIFDVLDEEGLAQRGTFIIDPDGIVQTVEINADGIGRDASVLIDKIRAGQYVRKNPGEVCPAKWKETGETLKPSLDLVGKI
Sample Types
Isolate
25.6%
Metagenome
73.8%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
18.2%
Termitidae
17.5%
Blattidae
10.5%
Kalotermitidae
10.5%
Scarabaeidae
5.6%
Formicidae
4.9%
Apidae
4.2%
Pyralidae
4.2%
Tenebrionidae
4.2%
Drosophilidae
3.5%
Rhinotermitidae
2.1%
Passalidae
1.4%
Noctuidae
1.4%
Curculionidae
1.4%
Elmidae
1.4%
Bombycidae
1.4%
Termopsidae
1.4%
Hodotermitidae
0.7%
Portunidae
0.7%
Penaeidae
0.7%
Eresidae
0.7%
Culicidae
0.7%
Acrididae
0.7%
Euphausiidae
0.7%
Ocypodidae
0.7%
Armadillidiidae
0.7%
Taxonomy
Archaea
1
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
64
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 3 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 4 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 5 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 6 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 7 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 8 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 9 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 10 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 11 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 17 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 18 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 19 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 26 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 27 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 28 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 29 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 30 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 31 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 32 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 33 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 34 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 35 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 36 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 39 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 40 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 41 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 42 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 43 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 44 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 45 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 46 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 47 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 48 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 49 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 50 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 51 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 52 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 53 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 54 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 55 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 56 | 3300008519 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti | Metagenome | Formicidae |
| 57 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 58 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 59 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 64 | 2820098966 | Unclassified Proteobacteria Lab288P1bin49 | Isolate | Unclassified |
| 65 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 66 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 67 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 68 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 69 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 70 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 71 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 72 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 73 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 74 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 75 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 76 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 77 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 78 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 79 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 80 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 81 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 82 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 83 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 84 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 85 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 86 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 87 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 88 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 89 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 90 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 91 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 92 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 93 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 94 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 95 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 96 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 97 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 98 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 99 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 100 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 101 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 102 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 103 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 104 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 105 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 106 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 107 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 108 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 109 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 110 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 111 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 112 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 113 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 114 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 115 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 116 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 117 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 118 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 119 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 120 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 121 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 122 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 123 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 124 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 125 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 126 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 127 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 128 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 129 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
| 130 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 131 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 132 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 133 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 134 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 135 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 136 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 137 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 138 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 139 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 140 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 141 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 142 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 143 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 144 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 145 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 146 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 147 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 148 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 149 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_1950 | 3300056856 | Bacteria | 25094 |
| 2 | Ga0123355_10226560 | 3300009826 | Unclassified | 2678 |
| 3 | Ga0466690_067230 | 3300042590 | Unclassified | 1979 |
| 4 | Ga0466690_232455 | 3300042590 | Unclassified | 2426 |
| 5 | Ga0466693_439873 | 3300042592 | Bacteria | 186295 |
| 6 | Ga0466691_054813 | 3300042593 | Bacteria | 7810 |
| 7 | Ga0466691_064952 | 3300042593 | Unclassified | 1077 |
| 8 | Ga0466691_080050 | 3300042593 | Unclassified | 5388 |
| 9 | Ga0466695_054508 | 3300042595 | Bacteria | 1296 |
| 10 | JGI24703J35330_11323900 | 3300002501 | Bacteria | 872 |
| 11 | Ga0052191_101901 | 3300003097 | Bacteria | 1531 |
| 12 | Ga0466711_202599 | 3300042615 | Unclassified | 2351 |
| 13 | Ga0466715_078096 | 3300042616 | Unclassified | 1345 |
| 14 | Ga0466715_407391 | 3300042616 | Unclassified | 1243 |
| 15 | Ga0466715_532619 | 3300042616 | Unclassified | 2739 |
| 16 | Ga0466723_155183 | 3300042618 | Bacteria | 3793 |
| 17 | Ga0466723_199404 | 3300042618 | Bacteria | 6944 |
| 18 | Ga0466728_194858 | 3300042620 | Unclassified | 2145 |
| 19 | Ga0466703_048437 | 3300042636 | Bacteria | 4916 |
| 20 | Ga0466704_526088 | 3300042643 | Bacteria | 7305 |
| 21 | Ga0466709_095443 | 3300042648 | Unclassified | 1504 |
| 22 | Ga0466709_152324 | 3300042648 | Bacteria | 4679 |
| 23 | Ga0466709_207912 | 3300042648 | Unclassified | 1056 |
| 24 | Ga0466709_279759 | 3300042648 | Bacteria | 128062 |
| 25 | Ga0466708_007005 | 3300042652 | Bacteria | 35340 |
| 26 | Ga0466708_295525 | 3300042652 | Bacteria | 2614 |
| 27 | Ga0466708_307168 | 3300042652 | Unclassified | 1448 |
| 28 | Ga0466708_318815 | 3300042652 | Bacteria | 9771 |
| 29 | Ga0466708_434301 | 3300042652 | Bacteria | 2747 |
| 30 | Ga0466719_445039 | 3300042606 | Bacteria | 15720 |
| 31 | Ga0466722_140701 | 3300042609 | Bacteria | 2378 |
| 32 | Ga0466732_065139 | 3300042656 | Bacteria | 2315 |
| 33 | Ga0123355_10263520 | 3300009826 | Unclassified | 2406 |
| 34 | Ga0160464_101467 | 3300012805 | Bacteria | 7941 |
| 35 | Ga0466690_370528 | 3300042590 | Bacteria | 3650 |
| 36 | Ga0466691_041667 | 3300042593 | Bacteria | 7756 |
| 37 | Ga0466691_143764 | 3300042593 | Bacteria | 7416 |
| 38 | Ga0466696_204676 | 3300042596 | Bacteria | 3426 |
| 39 | Ga0466696_274442 | 3300042596 | Unclassified | 6888 |
| 40 | GhopperDRAF_NODE_226858_len_1462_cov_5_935705 | 2035265001 | Unclassified | 1492 |
| 41 | 2227358563 | 2225789004 | Bacteria | 106790 |
| 42 | JGI24703J35330_11246835 | 3300002501 | Bacteria | 800 |
| 43 | Ga0063521_1000198 | 3300003973 | Bacteria | 43640 |
| 44 | Ga0466711_007516 | 3300042615 | Bacteria | 1833 |
| 45 | Ga0466711_039116 | 3300042615 | Bacteria | 12353 |
| 46 | Ga0466711_514329 | 3300042615 | Bacteria | 1422 |
| 47 | Ga0466715_088714 | 3300042616 | Bacteria | 13892 |
| 48 | Ga0466715_265702 | 3300042616 | Bacteria | 1214 |
| 49 | Ga0466715_344314 | 3300042616 | Bacteria | 3168 |
| 50 | Ga0466723_116077 | 3300042618 | Bacteria | 6316 |
| 51 | Ga0466728_031851 | 3300042620 | Unclassified | 3089 |
| 52 | Ga0466704_378505 | 3300042643 | Bacteria | 7184 |
| 53 | Ga0466709_395361 | 3300042648 | Unclassified | 1306 |
| 54 | Ga0466709_395605 | 3300042648 | Unclassified | 1403 |
| 55 | Ga0466724_30151 | 3300042649 | Unclassified | 2328 |
| 56 | Ga0466708_182735 | 3300042652 | Unclassified | 2064 |
| 57 | Ga0466708_313605 | 3300042652 | Bacteria | 3586 |
| 58 | Ga0466725_444293 | 3300042654 | Unclassified | 4926 |
| 59 | Ga0466707_057594 | 3300042601 | Bacteria | 62127 |
| 60 | Ga0466707_293343 | 3300042601 | Bacteria | 5266 |
| 61 | Ga0466713_124729 | 3300042602 | Bacteria | 15630 |
| 62 | Ga0466713_127594 | 3300042602 | Unclassified | 2071 |
| 63 | Ga0466705_069843 | 3300042612 | Bacteria | 3514 |
| 64 | Ga0530661_000004 | 3300056564 | Bacteria | 460556 |
| 65 | Ga0562377_2345 | 3300056842 | Bacteria | 14592 |
| 66 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 67 | Ga0123355_10011817 | 3300009826 | Bacteria | 13489 |
| 68 | Ga0255572_1003062 | 3300026175 | Bacteria | 13299 |
| 69 | Ga0466690_003579 | 3300042590 | Bacteria | 2921 |
| 70 | Ga0466690_381299 | 3300042590 | Unclassified | 2357 |
| 71 | Ga0466691_207462 | 3300042593 | Bacteria | 8152 |
| 72 | AustNasuHG_c1018279 | 3300000089 | Bacteria | 2317 |
| 73 | JGI24700J35501_10539610 | 3300002508 | Bacteria | 846 |
| 74 | Ga0104048_1170189 | 3300007143 | Unclassified | 1744 |
| 75 | Ga0466711_042794 | 3300042615 | Bacteria | 1876 |
| 76 | Ga0466715_122821 | 3300042616 | Bacteria | 43920 |
| 77 | Ga0466715_177008 | 3300042616 | Bacteria | 1151 |
| 78 | Ga0466715_461844 | 3300042616 | Bacteria | 52164 |
| 79 | Ga0466715_492277 | 3300042616 | Bacteria | 10414 |
| 80 | Ga0466715_549358 | 3300042616 | Bacteria | 3334 |
| 81 | Ga0466723_044774 | 3300042618 | Unclassified | 2794 |
| 82 | Ga0466723_050844 | 3300042618 | Unclassified | 1597 |
| 83 | Ga0466723_062305 | 3300042618 | Bacteria | 2743 |
| 84 | Ga0466723_230233 | 3300042618 | Unclassified | 1008 |
| 85 | Ga0466728_090378 | 3300042620 | Bacteria | 4178 |
| 86 | Ga0466728_214843 | 3300042620 | Bacteria | 1571 |
| 87 | Ga0466709_034985 | 3300042648 | Bacteria | 42238 |
| 88 | Ga0466709_143213 | 3300042648 | Unclassified | 182374 |
| 89 | Ga0466708_057934 | 3300042652 | Bacteria | 7226 |
| 90 | Ga0466708_106772 | 3300042652 | Bacteria | 2729 |
| 91 | Ga0466701_023809 | 3300042598 | Bacteria | 61408 |
| 92 | Ga0466714_068344 | 3300042603 | Bacteria | 2576 |
| 93 | Ga0466719_113688 | 3300042606 | Bacteria | 4402 |
| 94 | Ga0466721_271612 | 3300042608 | Unclassified | 2559 |
| 95 | Ga0466722_145830 | 3300042609 | Bacteria | 3502 |
| 96 | Ga0466697_126234 | 3300042611 | Bacteria | 1426 |
| 97 | Ga0466705_295729 | 3300042612 | Unclassified | 2309 |
| 98 | Ga0466733_048629 | 3300042659 | Bacteria | 2013 |
| 99 | Ga0562378_0589 | 3300056814 | Bacteria | 58112 |
| 100 | Ga0123355_10054843 | 3300009826 | Bacteria | 6457 |
| 101 | Ga0123355_10090024 | 3300009826 | Bacteria | 4868 |
| 102 | Ga0160464_101469 | 3300012805 | Bacteria | 7916 |
| 103 | Ga0255576_1000001 | 3300026558 | Bacteria | 687723 |
| 104 | Ga0255575_1000007 | 3300026559 | Bacteria | 308135 |
| 105 | Ga0466691_177002 | 3300042593 | Bacteria | 59641 |
| 106 | Ga0466691_215845 | 3300042593 | Bacteria | 2668 |
| 107 | Ga0466696_031099 | 3300042596 | Bacteria | 39724 |
| 108 | Ga0466696_247145 | 3300042596 | Bacteria | 1271 |
| 109 | JGI24700J35501_10705233 | 3300002508 | Bacteria | 1171 |
| 110 | JGI24700J35501_10930819 | 3300002508 | Bacteria | 25533 |
| 111 | Ga0466715_270932 | 3300042616 | Unclassified | 4266 |
| 112 | Ga0466723_142753 | 3300042618 | Unclassified | 1953 |
| 113 | Ga0466728_317197 | 3300042620 | Bacteria | 2593 |
| 114 | Ga0466703_153134 | 3300042636 | Unclassified | 1946 |
| 115 | Ga0466709_036176 | 3300042648 | Unclassified | 1944 |
| 116 | Ga0466709_133774 | 3300042648 | Bacteria | 6177 |
| 117 | Ga0466708_033305 | 3300042652 | Bacteria | 3515 |
| 118 | Ga0466708_326963 | 3300042652 | Bacteria | 20997 |
| 119 | Ga0466717_067061 | 3300042604 | Bacteria | 4033 |
| 120 | Ga0466716_271617 | 3300042605 | Unclassified | 1698 |
| 121 | Ga0466716_341917 | 3300042605 | Bacteria | 2979 |
| 122 | Ga0466719_047987 | 3300042606 | Unclassified | 2599 |
| 123 | Ga0466719_200818 | 3300042606 | Bacteria | 11176 |
| 124 | Ga0466719_294874 | 3300042606 | Bacteria | 11089 |
| 125 | Ga0466719_368322 | 3300042606 | Bacteria | 38753 |
| 126 | Ga0466722_208751 | 3300042609 | Bacteria | 2082 |
| 127 | Ga0466705_383538 | 3300042612 | Archaea | 6691 |
| 128 | Ga0562379_0033 | 3300056790 | Bacteria | 743383 |
| 129 | Ga0123355_10206287 | 3300009826 | Bacteria | 2859 |
| 130 | Ga0466656_227635 | 3300042550 | Bacteria | 5525 |
| 131 | Ga0466690_135193 | 3300042590 | Unclassified | 1097 |
| 132 | Ga0466691_038422 | 3300042593 | Bacteria | 17419 |
| 133 | Ga0466691_092350 | 3300042593 | Bacteria | 6980 |
| 134 | Ga0466691_139270 | 3300042593 | Bacteria | 3911 |
| 135 | Ga0466691_194184 | 3300042593 | Bacteria | 15293 |
| 136 | Ga0466696_489232 | 3300042596 | Bacteria | 2610 |
| 137 | 2211957116 | 2209111004 | Bacteria | 28671 |
| 138 | JGI24700J35501_10929765 | 3300002508 | Bacteria | 10110 |
| 139 | Ga0111035_100541 | 3300007901 | Bacteria | 46982 |
| 140 | Ga0111037_111095 | 3300008519 | Bacteria | 2989 |
| 141 | Ga0466711_191999 | 3300042615 | Bacteria | 2891 |
| 142 | Ga0466711_401048 | 3300042615 | Bacteria | 13916 |
| 143 | Ga0466715_468179 | 3300042616 | Bacteria | 11028 |
| 144 | Ga0466715_487343 | 3300042616 | Bacteria | 3254 |
| 145 | Ga0466715_594374 | 3300042616 | Unclassified | 5018 |
| 146 | Ga0466723_078918 | 3300042618 | Unclassified | 5633 |
| 147 | Ga0466723_083405 | 3300042618 | Bacteria | 10383 |
| 148 | Ga0466728_262485 | 3300042620 | Unclassified | 7433 |
| 149 | Ga0466730_027783 | 3300042625 | Bacteria | 6028 |
| 150 | Ga0466703_060149 | 3300042636 | Bacteria | 10152 |
| 151 | Ga0466704_123958 | 3300042643 | Unclassified | 4106 |
| 152 | Ga0466709_264022 | 3300042648 | Bacteria | 1807 |
| 153 | Ga0466709_367185 | 3300042648 | Bacteria | 3283 |
| 154 | Ga0466708_011830 | 3300042652 | Unclassified | 1164 |
| 155 | Ga0466708_124173 | 3300042652 | Bacteria | 7083 |
| 156 | Ga0466725_066022 | 3300042654 | Bacteria | 1499 |
| 157 | Ga0466706_003833 | 3300042599 | Bacteria | 3039 |
| 158 | Ga0466713_077142 | 3300042602 | Unclassified | 20891 |
| 159 | Ga0123355_10085270 | 3300009826 | Bacteria | 5027 |
| 160 | Ga0123356_10445257 | 3300010049 | Bacteria | 1442 |
| 161 | Ga0160466_100797 | 3300012809 | Bacteria | 12260 |
| 162 | Ga0160443_100644 | 3300012848 | Bacteria | 20016 |
| 163 | Ga0466690_238379 | 3300042590 | Bacteria | 3233 |
| 164 | Ga0466690_380759 | 3300042590 | Unclassified | 2631 |
| 165 | Ga0466696_036384 | 3300042596 | Bacteria | 2658 |
| 166 | Ga0466696_501002 | 3300042596 | Bacteria | 1320 |
| 167 | CVPL010W_10000096 | 3300002931 | Bacteria | 62459 |
| 168 | Ga0466711_111312 | 3300042615 | Bacteria | 2004 |
| 169 | Ga0466715_278419 | 3300042616 | Bacteria | 7670 |
| 170 | Ga0466715_482087 | 3300042616 | Unclassified | 3115 |
| 171 | Ga0466715_616302 | 3300042616 | Bacteria | 4162 |
| 172 | Ga0466723_002097 | 3300042618 | Bacteria | 2708 |
| 173 | Ga0466723_088740 | 3300042618 | Bacteria | 9932 |
| 174 | Ga0466723_119374 | 3300042618 | Unclassified | 4371 |
| 175 | Ga0466723_129172 | 3300042618 | Bacteria | 33143 |
| 176 | Ga0466723_250384 | 3300042618 | Bacteria | 7542 |
| 177 | Ga0466728_066235 | 3300042620 | Bacteria | 12417 |
| 178 | Ga0466728_326385 | 3300042620 | Bacteria | 5158 |
| 179 | Ga0466709_246205 | 3300042648 | Bacteria | 4805 |
| 180 | Ga0466708_142223 | 3300042652 | Bacteria | 6109 |
| 181 | Ga0466708_187482 | 3300042652 | Bacteria | 15879 |
| 182 | Ga0466708_297083 | 3300042652 | Bacteria | 1638 |
| 183 | Ga0466725_192157 | 3300042654 | Bacteria | 5606 |
| 184 | Ga0466716_287289 | 3300042605 | Unclassified | 1214 |
| 185 | Ga0466719_093426 | 3300042606 | Unclassified | 1709 |
| 186 | Ga0466705_169623 | 3300042612 | Bacteria | 12588 |
| 187 | Ga0466705_222538 | 3300042612 | Bacteria | 10577 |
| 188 | Ga0562378_1719 | 3300056814 | Unclassified | 22024 |
| 189 | Ga0562374_0662 | 3300057007 | Bacteria | 52127 |
| 190 | Ga0123355_10009046 | 3300009826 | Bacteria | 15096 |
| 191 | Ga0123355_10152060 | 3300009826 | Bacteria | 3513 |
| 192 | Ga0223688_1027273 | 3300021227 | Bacteria | 1072 |
| 193 | Ga0233288_1006150 | 3300022232 | Bacteria | 1010 |
| 194 | Ga0466691_052421 | 3300042593 | Unclassified | 4253 |
| 195 | Ga0466691_060394 | 3300042593 | Unclassified | 6269 |
| 196 | Ga0466696_139886 | 3300042596 | Unclassified | 1543 |
| 197 | JGI24703J35330_11458043 | 3300002501 | Bacteria | 1043 |
| 198 | Ga0068305_10001588 | 3300005083 | Bacteria | 82211 |
| 199 | Ga0104019_1003441 | 3300007150 | Bacteria | 3932 |
| 200 | Ga0466715_357753 | 3300042616 | Unclassified | 1906 |
| 201 | Ga0466715_486240 | 3300042616 | Bacteria | 3805 |
| 202 | Ga0466715_564753 | 3300042616 | Bacteria | 10818 |
| 203 | Ga0466723_012081 | 3300042618 | Bacteria | 14979 |
| 204 | Ga0466723_060659 | 3300042618 | Bacteria | 8869 |
| 205 | Ga0466723_164212 | 3300042618 | Bacteria | 2943 |
| 206 | Ga0466723_174220 | 3300042618 | Bacteria | 3204 |
| 207 | Ga0466726_296355 | 3300042619 | Bacteria | 4626 |
| 208 | Ga0466728_044437 | 3300042620 | Bacteria | 10881 |
| 209 | Ga0466734_134398 | 3300042623 | Bacteria | 6224 |
| 210 | Ga0466735_005251 | 3300042624 | Unclassified | 2617 |
| 211 | Ga0466703_149944 | 3300042636 | Unclassified | 1023 |
| 212 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 213 | Ga0466708_027573 | 3300042652 | Bacteria | 9997 |
| 214 | Ga0466708_113557 | 3300042652 | Unclassified | 1939 |
| 215 | Ga0466708_177522 | 3300042652 | Bacteria | 22673 |
| 216 | Ga0466716_194953 | 3300042605 | Bacteria | 17653 |
| 217 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 218 | Ga0562379_0397 | 3300056790 | Bacteria | 98115 |
| 219 | Ga0562378_0017 | 3300056814 | Unclassified | 870363 |
| 220 | Ga0562375_0583 | 3300056856 | Bacteria | 71499 |
| 221 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 222 | Ga0466691_082702 | 3300042593 | Unclassified | 3729 |
| 223 | Ga0466696_036578 | 3300042596 | Unclassified | 3061 |
| 224 | Ga0466696_064640 | 3300042596 | Unclassified | 1191 |
| 225 | IMNBL1DRAFT_c0000525 | 3300000062 | Bacteria | 31405 |
| 226 | JGI24703J35330_11746990 | 3300002501 | Bacteria | 5951 |
| 227 | Ga0074306_1119875 | 3300005309 | Bacteria | 1288 |
| 228 | Ga0123357_10000853 | 3300009784 | Bacteria | 31026 |
| 229 | Ga0466715_038044 | 3300042616 | Bacteria | 2878 |
| 230 | Ga0466715_569730 | 3300042616 | Bacteria | 37569 |
| 231 | Ga0466723_101048 | 3300042618 | Unclassified | 2967 |
| 232 | Ga0466729_178277 | 3300042621 | Bacteria | 1181 |
| 233 | Ga0466709_086043 | 3300042648 | Unclassified | 1155 |
| 234 | Ga0466709_160810 | 3300042648 | Unclassified | 1804 |
| 235 | Ga0466724_36022 | 3300042649 | Bacteria | 5189 |
| 236 | Ga0466719_056135 | 3300042606 | Bacteria | 9124 |
| 237 | Ga0466719_178756 | 3300042606 | Bacteria | 3950 |
| 238 | Ga0466719_567775 | 3300042606 | Bacteria | 1270 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042616 | Ga0466715_344314 | Ga0466715_344314_2368_2925 | 180 |
| 2 | 3300042616 | Ga0466715_532619 | Ga0466715_532619_2115_2672 | 180 |
| 3 | 3300042590 | Ga0466690_067230 | Ga0466690_067230_1230_1787 | 185 |
| 4 | 3300042590 | Ga0466690_135193 | Ga0466690_135193_15_572 | 185 |
| 5 | 3300042590 | Ga0466690_381299 | Ga0466690_381299_1721_2278 | 185 |
| 6 | 3300042593 | Ga0466691_052421 | Ga0466691_052421_2026_2583 | 185 |
| 7 | 3300042593 | Ga0466691_054813 | Ga0466691_054813_5804_6361 | 185 |
| 8 | 3300042593 | Ga0466691_060394 | Ga0466691_060394_504_1061 | 185 |
| 9 | 3300042593 | Ga0466691_064952 | Ga0466691_064952_87_644 | 185 |
| 10 | 3300042593 | Ga0466691_082702 | Ga0466691_082702_1015_1572 | 185 |
| 11 | 3300042593 | Ga0466691_143764 | Ga0466691_143764_2593_3150 | 185 |
| 12 | 3300042593 | Ga0466691_194184 | Ga0466691_194184_13687_14244 | 185 |
| 13 | 3300042593 | Ga0466691_207462 | Ga0466691_207462_3613_4170 | 185 |
| 14 | 3300042596 | Ga0466696_064640 | Ga0466696_064640_488_1045 | 185 |
| 15 | 3300042596 | Ga0466696_139886 | Ga0466696_139886_741_1298 | 185 |
| 16 | 3300042596 | Ga0466696_274442 | Ga0466696_274442_2421_2978 | 185 |
| 17 | 3300042605 | Ga0466716_194953 | Ga0466716_194953_4236_4793 | 185 |
| 18 | 3300042605 | Ga0466716_271617 | Ga0466716_271617_1067_1624 | 185 |
| 19 | 3300042605 | Ga0466716_287289 | Ga0466716_287289_403_960 | 185 |
| 20 | 3300042605 | Ga0466716_341917 | Ga0466716_341917_1749_2306 | 185 |
| 21 | 3300042606 | Ga0466719_047987 | Ga0466719_047987_654_1211 | 185 |
| 22 | 3300042606 | Ga0466719_056135 | Ga0466719_056135_2923_3480 | 185 |
| 23 | 3300042606 | Ga0466719_093426 | Ga0466719_093426_784_1341 | 185 |
| 24 | 3300042606 | Ga0466719_113688 | Ga0466719_113688_139_696 | 185 |
| 25 | 3300042606 | Ga0466719_178756 | Ga0466719_178756_1965_2522 | 185 |
| 26 | 3300042606 | Ga0466719_200818 | Ga0466719_200818_755_1312 | 185 |
| 27 | 3300042606 | Ga0466719_445039 | Ga0466719_445039_14559_15116 | 185 |
| 28 | 3300042612 | Ga0466705_069843 | Ga0466705_069843_2172_2729 | 185 |
| 29 | 3300042612 | Ga0466705_169623 | Ga0466705_169623_8706_9263 | 185 |
| 30 | 3300042612 | Ga0466705_295729 | Ga0466705_295729_282_839 | 185 |
| 31 | 3300042616 | Ga0466715_270932 | Ga0466715_270932_198_755 | 185 |
| 32 | 3300042616 | Ga0466715_357753 | Ga0466715_357753_748_1305 | 185 |
| 33 | 3300042616 | Ga0466715_407391 | Ga0466715_407391_635_1192 | 185 |
| 34 | 3300042616 | Ga0466715_468179 | Ga0466715_468179_4613_5170 | 185 |
| 35 | 3300042616 | Ga0466715_482087 | Ga0466715_482087_1468_2025 | 185 |
| 36 | 3300042616 | Ga0466715_486240 | Ga0466715_486240_156_713 | 185 |
| 37 | 3300042616 | Ga0466715_492277 | Ga0466715_492277_2470_3027 | 185 |
| 38 | 3300042616 | Ga0466715_549358 | Ga0466715_549358_476_1033 | 185 |
| 39 | 3300042616 | Ga0466715_594374 | Ga0466715_594374_3677_4234 | 185 |
| 40 | 3300042616 | Ga0466715_616302 | Ga0466715_616302_3210_3767 | 185 |
| 41 | 3300042618 | Ga0466723_050844 | Ga0466723_050844_109_666 | 185 |
| 42 | 3300042618 | Ga0466723_078918 | Ga0466723_078918_3952_4509 | 185 |
| 43 | 3300042618 | Ga0466723_101048 | Ga0466723_101048_955_1512 | 185 |
| 44 | 3300042618 | Ga0466723_116077 | Ga0466723_116077_2244_2801 | 185 |
| 45 | 3300042618 | Ga0466723_119374 | Ga0466723_119374_1636_2193 | 185 |
| 46 | 3300042618 | Ga0466723_155183 | Ga0466723_155183_1901_2458 | 185 |
| 47 | 3300042618 | Ga0466723_199404 | Ga0466723_199404_2319_2876 | 185 |
| 48 | 3300042618 | Ga0466723_230233 | Ga0466723_230233_243_800 | 185 |
| 49 | 3300042620 | Ga0466728_031851 | Ga0466728_031851_1418_1975 | 185 |
| 50 | 3300042620 | Ga0466728_194858 | Ga0466728_194858_528_1085 | 185 |
| 51 | 3300042620 | Ga0466728_317197 | Ga0466728_317197_53_610 | 185 |
| 52 | 3300042636 | Ga0466703_048437 | Ga0466703_048437_1942_2499 | 185 |
| 53 | 3300042636 | Ga0466703_149944 | Ga0466703_149944_230_787 | 185 |
| 54 | 3300042636 | Ga0466703_153134 | Ga0466703_153134_1091_1648 | 185 |
| 55 | 3300042643 | Ga0466704_123958 | Ga0466704_123958_1598_2155 | 185 |
| 56 | 3300042643 | Ga0466704_378505 | Ga0466704_378505_3610_4167 | 185 |
| 57 | 3300042648 | Ga0466709_036176 | Ga0466709_036176_1021_1578 | 185 |
| 58 | 3300042648 | Ga0466709_095443 | Ga0466709_095443_799_1356 | 185 |
| 59 | 3300042648 | Ga0466709_133774 | Ga0466709_133774_3580_4137 | 185 |
| 60 | 3300042648 | Ga0466709_152324 | Ga0466709_152324_3458_4015 | 185 |
| 61 | 3300042648 | Ga0466709_160810 | Ga0466709_160810_679_1236 | 185 |
| 62 | 3300042648 | Ga0466709_207912 | Ga0466709_207912_218_775 | 185 |
| 63 | 3300042648 | Ga0466709_395361 | Ga0466709_395361_484_1041 | 185 |
| 64 | 3300042648 | Ga0466709_395605 | Ga0466709_395605_251_808 | 185 |
| 65 | 3300042652 | Ga0466708_007005 | Ga0466708_007005_31613_32170 | 185 |
| 66 | 3300042652 | Ga0466708_011830 | Ga0466708_011830_244_801 | 185 |
| 67 | 3300042652 | Ga0466708_113557 | Ga0466708_113557_1027_1584 | 185 |
| 68 | 3300042652 | Ga0466708_124173 | Ga0466708_124173_2003_2560 | 185 |
| 69 | 3300042652 | Ga0466708_142223 | Ga0466708_142223_463_1020 | 185 |
| 70 | 3300042652 | Ga0466708_182735 | Ga0466708_182735_1408_1965 | 185 |
| 71 | 3300042652 | Ga0466708_187482 | Ga0466708_187482_14287_14844 | 185 |
| 72 | 3300042652 | Ga0466708_307168 | Ga0466708_307168_469_1026 | 185 |
| 73 | 3300042652 | Ga0466708_313605 | Ga0466708_313605_1035_1592 | 185 |
| 74 | 3300042654 | Ga0466725_444293 | Ga0466725_444293_54_611 | 185 |
| 75 | iso_pr_bacteria | 8007211731 | 8007213873 | 186 |
| 76 | iso_pr_bacteria | 8007215774 | 8007217175 | 186 |
| 77 | iso_pr_bacteria | 8114544644 | 8114548282 | 186 |
| 78 | 2035265001 | GhopperDRAF_NODE_226858_len_1462_cov_5_935705 | GhopperDRAFT_174000 | 187 |
| 79 | 2209111004 | 2211957116 | 2211986422 | 187 |
| 80 | 2225789004 | 2227358563 | 2227805886 | 187 |
| 81 | 3300026175 | Ga0255572_1003062 | Ga0255572_10030628 | 187 |
| 82 | 3300026558 | Ga0255576_1000001 | Ga0255576_1000001260 | 187 |
| 83 | 3300026559 | Ga0255575_1000007 | Ga0255575_100000774 | 187 |
| 84 | 3300042590 | Ga0466690_003579 | Ga0466690_003579_1380_1943 | 187 |
| 85 | 3300042590 | Ga0466690_232455 | Ga0466690_232455_845_1408 | 187 |
| 86 | 3300042590 | Ga0466690_238379 | Ga0466690_238379_901_1464 | 187 |
| 87 | 3300042590 | Ga0466690_370528 | Ga0466690_370528_2169_2732 | 187 |
| 88 | 3300042590 | Ga0466690_380759 | Ga0466690_380759_400_963 | 187 |
| 89 | 3300042593 | Ga0466691_038422 | Ga0466691_038422_308_871 | 187 |
| 90 | 3300042593 | Ga0466691_041667 | Ga0466691_041667_3332_3895 | 187 |
| 91 | 3300042593 | Ga0466691_080050 | Ga0466691_080050_2734_3297 | 187 |
| 92 | 3300042593 | Ga0466691_092350 | Ga0466691_092350_2964_3527 | 187 |
| 93 | 3300042593 | Ga0466691_139270 | Ga0466691_139270_3055_3618 | 187 |
| 94 | 3300042593 | Ga0466691_177002 | Ga0466691_177002_2352_2915 | 187 |
| 95 | 3300042596 | Ga0466696_031099 | Ga0466696_031099_32960_33523 | 187 |
| 96 | 3300042596 | Ga0466696_204676 | Ga0466696_204676_275_838 | 187 |
| 97 | 3300042596 | Ga0466696_247145 | Ga0466696_247145_103_666 | 187 |
| 98 | 3300042596 | Ga0466696_501002 | Ga0466696_501002_140_703 | 187 |
| 99 | 3300042598 | Ga0466701_023809 | Ga0466701_023809_47344_47907 | 187 |
| 100 | 3300042601 | Ga0466707_057594 | Ga0466707_057594_17199_17762 | 187 |
| 101 | 3300042601 | Ga0466707_293343 | Ga0466707_293343_427_990 | 187 |
| 102 | 3300042602 | Ga0466713_077142 | Ga0466713_077142_1883_2446 | 187 |
| 103 | 3300042602 | Ga0466713_124729 | Ga0466713_124729_13684_14247 | 187 |
| 104 | 3300042602 | Ga0466713_127594 | Ga0466713_127594_737_1300 | 187 |
| 105 | 3300042606 | Ga0466719_294874 | Ga0466719_294874_3136_3699 | 187 |
| 106 | 3300042606 | Ga0466719_368322 | Ga0466719_368322_16812_17375 | 187 |
| 107 | 3300042606 | Ga0466719_567775 | Ga0466719_567775_44_607 | 187 |
| 108 | 3300042609 | Ga0466722_140701 | Ga0466722_140701_543_1106 | 187 |
| 109 | 3300042609 | Ga0466722_145830 | Ga0466722_145830_927_1490 | 187 |
| 110 | 3300042609 | Ga0466722_208751 | Ga0466722_208751_76_639 | 187 |
| 111 | 3300042612 | Ga0466705_222538 | Ga0466705_222538_4603_5166 | 187 |
| 112 | 3300042612 | Ga0466705_383538 | Ga0466705_383538_1255_1818 | 187 |
| 113 | 3300042615 | Ga0466711_007516 | Ga0466711_007516_242_805 | 187 |
| 114 | 3300042615 | Ga0466711_039116 | Ga0466711_039116_2792_3355 | 187 |
| 115 | 3300042615 | Ga0466711_042794 | Ga0466711_042794_128_691 | 187 |
| 116 | 3300042615 | Ga0466711_111312 | Ga0466711_111312_800_1363 | 187 |
| 117 | 3300042615 | Ga0466711_191999 | Ga0466711_191999_902_1465 | 187 |
| 118 | 3300042615 | Ga0466711_202599 | Ga0466711_202599_1661_2224 | 187 |
| 119 | 3300042615 | Ga0466711_514329 | Ga0466711_514329_504_1067 | 187 |
| 120 | 3300042616 | Ga0466715_078096 | Ga0466715_078096_634_1197 | 187 |
| 121 | 3300042616 | Ga0466715_088714 | Ga0466715_088714_800_1363 | 187 |
| 122 | 3300042616 | Ga0466715_122821 | Ga0466715_122821_27297_27860 | 187 |
| 123 | 3300042616 | Ga0466715_177008 | Ga0466715_177008_424_987 | 187 |
| 124 | 3300042616 | Ga0466715_278419 | Ga0466715_278419_3982_4545 | 187 |
| 125 | 3300042616 | Ga0466715_461844 | Ga0466715_461844_48437_49000 | 187 |
| 126 | 3300042616 | Ga0466715_487343 | Ga0466715_487343_410_973 | 187 |
| 127 | 3300042616 | Ga0466715_564753 | Ga0466715_564753_5206_5769 | 187 |
| 128 | 3300042616 | Ga0466715_569730 | Ga0466715_569730_16040_16603 | 187 |
| 129 | 3300042618 | Ga0466723_002097 | Ga0466723_002097_363_926 | 187 |
| 130 | 3300042618 | Ga0466723_012081 | Ga0466723_012081_10293_10856 | 187 |
| 131 | 3300042618 | Ga0466723_044774 | Ga0466723_044774_1770_2333 | 187 |
| 132 | 3300042618 | Ga0466723_060659 | Ga0466723_060659_7916_8479 | 187 |
| 133 | 3300042618 | Ga0466723_062305 | Ga0466723_062305_1891_2454 | 187 |
| 134 | 3300042618 | Ga0466723_088740 | Ga0466723_088740_4605_5168 | 187 |
| 135 | 3300042618 | Ga0466723_129172 | Ga0466723_129172_29745_30308 | 187 |
| 136 | 3300042618 | Ga0466723_142753 | Ga0466723_142753_929_1492 | 187 |
| 137 | 3300042618 | Ga0466723_164212 | Ga0466723_164212_1338_1901 | 187 |
| 138 | 3300042618 | Ga0466723_174220 | Ga0466723_174220_352_915 | 187 |
| 139 | 3300042618 | Ga0466723_250384 | Ga0466723_250384_800_1363 | 187 |
| 140 | 3300042619 | Ga0466726_296355 | Ga0466726_296355_3254_3817 | 187 |
| 141 | 3300042620 | Ga0466728_044437 | Ga0466728_044437_9662_10225 | 187 |
| 142 | 3300042620 | Ga0466728_066235 | Ga0466728_066235_11277_11840 | 187 |
| 143 | 3300042620 | Ga0466728_090378 | Ga0466728_090378_1915_2478 | 187 |
| 144 | 3300042620 | Ga0466728_214843 | Ga0466728_214843_230_793 | 187 |
| 145 | 3300042620 | Ga0466728_262485 | Ga0466728_262485_640_1203 | 187 |
| 146 | 3300042620 | Ga0466728_326385 | Ga0466728_326385_441_1004 | 187 |
| 147 | 3300042623 | Ga0466734_134398 | Ga0466734_134398_3240_3803 | 187 |
| 148 | 3300042625 | Ga0466730_027783 | Ga0466730_027783_257_820 | 187 |
| 149 | 3300042636 | Ga0466703_060149 | Ga0466703_060149_5306_5869 | 187 |
| 150 | 3300042643 | Ga0466704_439686 | Ga0466704_439686_3744_4307 | 187 |
| 151 | 3300042648 | Ga0466709_086043 | Ga0466709_086043_345_908 | 187 |
| 152 | 3300042648 | Ga0466709_143213 | Ga0466709_143213_148492_149055 | 187 |
| 153 | 3300042648 | Ga0466709_246205 | Ga0466709_246205_385_948 | 187 |
| 154 | 3300042648 | Ga0466709_264022 | Ga0466709_264022_151_714 | 187 |
| 155 | 3300042648 | Ga0466709_279759 | Ga0466709_279759_82122_82685 | 187 |
| 156 | 3300042648 | Ga0466709_367185 | Ga0466709_367185_642_1205 | 187 |
| 157 | 3300042649 | Ga0466724_30151 | Ga0466724_30151_845_1408 | 187 |
| 158 | 3300042652 | Ga0466708_027573 | Ga0466708_027573_4251_4814 | 187 |
| 159 | 3300042652 | Ga0466708_057934 | Ga0466708_057934_2460_3023 | 187 |
| 160 | 3300042652 | Ga0466708_106772 | Ga0466708_106772_461_1024 | 187 |
| 161 | 3300042652 | Ga0466708_177522 | Ga0466708_177522_13544_14107 | 187 |
| 162 | 3300042652 | Ga0466708_295525 | Ga0466708_295525_1113_1676 | 187 |
| 163 | 3300042652 | Ga0466708_297083 | Ga0466708_297083_917_1480 | 187 |
| 164 | 3300042652 | Ga0466708_326963 | Ga0466708_326963_18347_18910 | 187 |
| 165 | 3300042652 | Ga0466708_434301 | Ga0466708_434301_1618_2181 | 187 |
| 166 | 3300042659 | Ga0466733_048629 | Ga0466733_048629_99_662 | 187 |
| 167 | 3300056790 | Ga0562379_0005 | Ga0562379_0005_1701410_1701973 | 187 |
| 168 | 3300056790 | Ga0562379_0033 | Ga0562379_0033_153241_153804 | 187 |
| 169 | 3300056790 | Ga0562379_0397 | Ga0562379_0397_82937_83500 | 187 |
| 170 | 3300056814 | Ga0562378_0017 | Ga0562378_0017_490703_491266 | 187 |
| 171 | 3300056814 | Ga0562378_0589 | Ga0562378_0589_53542_54105 | 187 |
| 172 | 3300056814 | Ga0562378_1719 | Ga0562378_1719_6443_7006 | 187 |
| 173 | 3300056842 | Ga0562377_2345 | Ga0562377_2345_1779_2342 | 187 |
| 174 | 3300056856 | Ga0562375_0005 | Ga0562375_0005_964860_965423 | 187 |
| 175 | 3300056856 | Ga0562375_1950 | Ga0562375_1950_23198_23761 | 187 |
| 176 | 3300057007 | Ga0562374_0006 | Ga0562374_0006_1869059_1869622 | 187 |
| 177 | 3300057007 | Ga0562374_0662 | Ga0562374_0662_7446_8009 | 187 |
| 178 | iso_pr_bacteria | 2537562000 | 2539438527 | 187 |
| 179 | iso_pr_bacteria | 2563367190 | 2565788077 | 187 |
| 180 | iso_pr_bacteria | 2585428141 | 2588055577 | 187 |
| 181 | iso_pr_bacteria | 2590828840 | 2593258080 | 187 |
| 182 | iso_pr_bacteria | 2593339125 | 2595066962 | 187 |
| 183 | iso_pr_bacteria | 2636416028 | 2638995381 | 187 |
| 184 | iso_pr_bacteria | 2681813507 | 2684382801 | 187 |
| 185 | iso_pr_bacteria | 2731957677 | 2732687219 | 187 |
| 186 | iso_pr_bacteria | 2767802234 | 2769328964 | 187 |
| 187 | iso_pr_bacteria | 2781125681 | 2781408093 | 187 |
| 188 | iso_pr_bacteria | 2791355481 | 2794426014 | 187 |
| 189 | iso_pr_bacteria | 2820236043 | 2820236614 | 187 |
| 190 | iso_pr_bacteria | 2820309449 | 2820311145 | 187 |
| 191 | iso_pr_bacteria | 2822232166 | 2822234083 | 187 |
| 192 | iso_pr_bacteria | 2822450720 | 2822450922 | 187 |
| 193 | iso_pr_bacteria | 2827179085 | 2827181314 | 187 |
| 194 | iso_pr_bacteria | 2836667214 | 2836671917 | 187 |
| 195 | iso_pr_bacteria | 2849099867 | 2849103200 | 187 |
| 196 | iso_pr_bacteria | 2849104611 | 2849108498 | 187 |
| 197 | iso_pr_bacteria | 2850695442 | 2850696877 | 187 |
| 198 | iso_pr_bacteria | 2850744690 | 2850745773 | 187 |
| 199 | iso_pr_bacteria | 2864782175 | 2864787392 | 187 |
| 200 | iso_pr_bacteria | 2864909992 | 2864912439 | 187 |
| 201 | iso_pr_bacteria | 2873597894 | 2873599910 | 187 |
| 202 | iso_pr_bacteria | 2878857142 | 2878858362 | 187 |
| 203 | iso_pr_bacteria | 2900804455 | 2900806368 | 187 |
| 204 | iso_pr_bacteria | 2912849059 | 2912849289 | 187 |
| 205 | iso_pr_bacteria | 2916858470 | 2916858673 | 187 |
| 206 | iso_pr_bacteria | 2916873227 | 2916877665 | 187 |
| 207 | iso_pr_bacteria | 2940218408 | 2940219298 | 187 |
| 208 | iso_pr_bacteria | 2940221333 | 2940225669 | 187 |
| 209 | iso_pr_bacteria | 2940236825 | 2940238343 | 187 |
| 210 | iso_pr_bacteria | 2940261461 | 2940262259 | 187 |
| 211 | iso_pr_bacteria | 2940339133 | 2940340740 | 187 |
| 212 | iso_pr_bacteria | 2940341480 | 2940342909 | 187 |
| 213 | iso_pr_bacteria | 2940343849 | 2940345207 | 187 |
| 214 | iso_pr_bacteria | 2940380068 | 2940381341 | 187 |
| 215 | iso_pr_bacteria | 2940386776 | 2940388443 | 187 |
| 216 | iso_pr_bacteria | 2940393498 | 2940395164 | 187 |
| 217 | iso_pr_bacteria | 2940400224 | 2940401891 | 187 |
| 218 | iso_pr_bacteria | 2940406939 | 2940408329 | 187 |
| 219 | iso_pr_bacteria | 2940413413 | 2940418627 | 187 |
| 220 | iso_pr_bacteria | 2940419646 | 2940425284 | 187 |
| 221 | iso_pr_bacteria | 2940425923 | 2940430981 | 187 |
| 222 | iso_pr_bacteria | 2956928875 | 2956929705 | 187 |
| 223 | iso_pr_bacteria | 2969145278 | 2969147692 | 187 |
| 224 | iso_pr_bacteria | 2978778678 | 2978783605 | 187 |
| 225 | iso_pr_bacteria | 2989309576 | 2989313915 | 187 |
| 226 | iso_pr_bacteria | 3006190525 | 3006191603 | 187 |
| 227 | iso_pr_bacteria | 641736255 | 641742796 | 187 |
| 228 | iso_pr_bacteria | 643886085 | 644677877 | 187 |
| 229 | iso_pr_bacteria | 643886087 | 644665679 | 187 |
| 230 | iso_pr_bacteria | 643886090 | 644659578 | 187 |
| 231 | iso_pr_bacteria | 643886091 | 644646523 | 187 |
| 232 | iso_pr_bacteria | 651324002 | 651578460 | 187 |
| 233 | iso_pr_bacteria | 8007220153 | 8007221199 | 187 |
| 234 | iso_pr_bacteria | 8018750880 | 8018751009 | 187 |
| 235 | iso_pr_bacteria | 8018754795 | 8018757367 | 187 |
| 236 | iso_pr_bacteria | 8022725327 | 8022730923 | 187 |
| 237 | iso_pr_bacteria | 8022781829 | 8022784785 | 187 |
| 238 | iso_pr_bacteria | 8061039349 | 8061040900 | 187 |
| 239 | iso_pr_bacteria | 8061045771 | 8061052748 | 187 |
| 240 | iso_pr_bacteria | 8061100935 | 8061104062 | 187 |
| 241 | iso_pr_bacteria | 8064008355 | 8064013807 | 187 |
| 242 | iso_pr_bacteria | 8082023105 | 8082028132 | 187 |
| 243 | 3300000062 | IMNBL1DRAFT_c0000525 | IMNBL1DRAFT_000052518 | 188 |
| 244 | 3300002508 | JGI24700J35501_10539610 | JGI24700J35501_105396101 | 188 |
| 245 | 3300002508 | JGI24700J35501_10930819 | JGI24700J35501_109308198 | 188 |
| 246 | 3300003097 | Ga0052191_101901 | Ga0052191_1019012 | 188 |
| 247 | 3300003973 | Ga0063521_1000198 | Ga0063521_100019832 | 188 |
| 248 | 3300005083 | Ga0068305_10001588 | Ga0068305_1000158866 | 188 |
| 249 | 3300005309 | Ga0074306_1119875 | Ga0074306_11198751 | 188 |
| 250 | 3300007143 | Ga0104048_1170189 | Ga0104048_11701892 | 188 |
| 251 | 3300007150 | Ga0104019_1003441 | Ga0104019_10034412 | 188 |
| 252 | 3300007901 | Ga0111035_100541 | Ga0111035_10054136 | 188 |
| 253 | 3300008519 | Ga0111037_111095 | Ga0111037_1110953 | 188 |
| 254 | 3300012805 | Ga0160464_101467 | Ga0160464_1014674 | 188 |
| 255 | 3300012805 | Ga0160464_101469 | Ga0160464_1014692 | 188 |
| 256 | 3300012809 | Ga0160466_100797 | Ga0160466_1007977 | 188 |
| 257 | 3300012848 | Ga0160443_100644 | Ga0160443_10064411 | 188 |
| 258 | 3300022232 | Ga0233288_1006150 | Ga0233288_10061501 | 188 |
| 259 | 3300042596 | Ga0466696_489232 | Ga0466696_489232_1580_2146 | 188 |
| 260 | 3300042599 | Ga0466706_003833 | Ga0466706_003833_404_970 | 188 |
| 261 | 3300042608 | Ga0466721_271612 | Ga0466721_271612_996_1562 | 188 |
| 262 | 3300042611 | Ga0466697_126234 | Ga0466697_126234_278_844 | 188 |
| 263 | 3300042643 | Ga0466704_526088 | Ga0466704_526088_5133_5699 | 188 |
| 264 | iso_pr_bacteria | 2820301196 | 2820301393 | 188 |
| 265 | iso_pr_bacteria | 2820518089 | 2820518157 | 188 |
| 266 | iso_pr_bacteria | 2820535361 | 2820536727 | 188 |
| 267 | 3300002501 | JGI24703J35330_11246835 | JGI24703J35330_112468352 | 189 |
| 268 | 3300002501 | JGI24703J35330_11323900 | JGI24703J35330_113239001 | 189 |
| 269 | 3300002501 | JGI24703J35330_11458043 | JGI24703J35330_114580432 | 189 |
| 270 | 3300002501 | JGI24703J35330_11746990 | JGI24703J35330_117469904 | 189 |
| 271 | 3300002508 | JGI24700J35501_10705233 | JGI24700J35501_107052332 | 189 |
| 272 | 3300002508 | JGI24700J35501_10929765 | JGI24700J35501_109297656 | 189 |
| 273 | 3300009826 | Ga0123355_10009046 | Ga0123355_1000904613 | 189 |
| 274 | 3300009826 | Ga0123355_10011817 | Ga0123355_100118175 | 189 |
| 275 | 3300009826 | Ga0123355_10085270 | Ga0123355_100852702 | 189 |
| 276 | 3300009826 | Ga0123355_10090024 | Ga0123355_100900244 | 189 |
| 277 | 3300009826 | Ga0123355_10152060 | Ga0123355_101520604 | 189 |
| 278 | 3300009826 | Ga0123355_10206287 | Ga0123355_102062873 | 189 |
| 279 | 3300009826 | Ga0123355_10226560 | Ga0123355_102265603 | 189 |
| 280 | 3300009826 | Ga0123355_10263520 | Ga0123355_102635202 | 189 |
| 281 | 3300021227 | Ga0223688_1027273 | Ga0223688_10272732 | 189 |
| 282 | 3300042592 | Ga0466693_439873 | Ga0466693_439873_60023_60592 | 189 |
| 283 | 3300042595 | Ga0466695_054508 | Ga0466695_054508_699_1268 | 189 |
| 284 | 3300042596 | Ga0466696_036384 | Ga0466696_036384_1739_2308 | 189 |
| 285 | 3300042596 | Ga0466696_036578 | Ga0466696_036578_2136_2705 | 189 |
| 286 | 3300042604 | Ga0466717_067061 | Ga0466717_067061_3442_4011 | 189 |
| 287 | 3300042616 | Ga0466715_038044 | Ga0466715_038044_1749_2318 | 189 |
| 288 | 3300042618 | Ga0466723_083405 | Ga0466723_083405_5679_6248 | 189 |
| 289 | 3300042621 | Ga0466729_178277 | Ga0466729_178277_160_729 | 189 |
| 290 | 3300042624 | Ga0466735_005251 | Ga0466735_005251_1484_2053 | 189 |
| 291 | 3300042656 | Ga0466732_065139 | Ga0466732_065139_115_684 | 189 |
| 292 | iso_pr_bacteria | 2523231078 | 2523494184 | 189 |
| 293 | iso_pr_bacteria | 2820025825 | 2820027179 | 189 |
| 294 | iso_pr_bacteria | 2820062699 | 2820063375 | 189 |
| 295 | iso_pr_bacteria | 2820098966 | 2820099548 | 189 |
| 296 | iso_pr_bacteria | 2820121232 | 2820122298 | 189 |
| 297 | iso_pr_bacteria | 2820483401 | 2820483740 | 189 |
| 298 | iso_pr_bacteria | 2820492969 | 2820494174 | 189 |
| 299 | iso_pr_bacteria | 2820504582 | 2820505492 | 189 |
| 300 | iso_pr_bacteria | 2890957088 | 2890959825 | 189 |
| 301 | iso_pr_bacteria | 8002519755 | 8002523467 | 189 |
| 302 | 3300000089 | AustNasuHG_c1018279 | AustNasuHG_10182792 | 190 |
| 303 | 3300009784 | Ga0123357_10000853 | Ga0123357_1000085318 | 190 |
| 304 | 3300009826 | Ga0123355_10054843 | Ga0123355_1005484310 | 190 |
| 305 | 3300010049 | Ga0123356_10445257 | Ga0123356_104452572 | 190 |
| 306 | iso_pr_bacteria | 651324002 | 651577292 | 190 |
| 307 | 3300042593 | Ga0466691_215845 | Ga0466691_215845_536_1111 | 191 |
| 308 | 3300042652 | Ga0466708_033305 | Ga0466708_033305_2902_3477 | 191 |
| 309 | 3300056856 | Ga0562375_0583 | Ga0562375_0583_25480_26058 | 192 |
| 310 | 3300042648 | Ga0466709_034985 | Ga0466709_034985_12823_13407 | 194 |
| 311 | 3300042603 | Ga0466714_068344 | Ga0466714_068344_1000_1587 | 195 |
| 312 | 3300042616 | Ga0466715_265702 | Ga0466715_265702_461_1048 | 195 |
| 313 | 3300042649 | Ga0466724_36022 | Ga0466724_36022_290_877 | 195 |
| 314 | 3300042550 | Ga0466656_227635 | Ga0466656_227635_3187_3780 | 197 |
| 315 | 3300056564 | Ga0530661_000004 | Ga0530661_000004_84452_85054 | 200 |
| 316 | 3300042615 | Ga0466711_401048 | Ga0466711_401048_13005_13610 | 201 |
| 317 | 3300042654 | Ga0466725_066022 | Ga0466725_066022_645_1271 | 208 |
| 318 | 3300042654 | Ga0466725_192157 | Ga0466725_192157_3627_4262 | 211 |
| 319 | 3300042652 | Ga0466708_318815 | Ga0466708_318815_3315_3983 | 222 |
| 320 | 3300002931 | CVPL010W_10000096 | CVPL010W_100000966 | 266 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08534 | GO:0016491 | oxidoreductase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.