Protein Family IF13568

Metagenome Isolate
151 Members
52 Samples
136 Scaffolds
490.34 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|650716102|650883049|
Length
546 aa
Sequence
MSDKTPLTRQFPDPVPVDPVLDKLSRWVENALGIKAGEDALQKLREYMEKQFNPNIFQFPGAFEWSLSSREERFKIARFLTINETYFFREEPHFYLLLKELLPRFARLNRPLRVCSAACSAGCEAYSLAMLMDHYSRTTAFLDFKIEAFDISQDMIEVAKQGRYTSNTFRDDGNHWKYILDEYLTEKDGEYMVNNKLKEKIHFFPHNIMDGLDQASFDLILFRNALIYFSAESRVKLLDSLTKSLTEGGVLLFGIAETPSVSHPLLRNKNAQGAFYFQKDSTPPSEEDRRNSDRQASDRRDQDRRSTDRRVLNMKASELNFPDRRVQDRRAQERRTLDRRFPDIRSEQAAGTAAPKPQPPPNSEAPGKAGLTVNMKTISALIEQGESLQAAERLLMVLKEPAAGPADLPASGRAAVTEEETIAAVISLLSLEDFAGANLVLSLMEKKPKSAFTKFLRGEYNYHLNKVKEAEAGYKEASSLNSAFWPAFYRMSLLAAGGNRTRYEYKIKKALESIDMGKDMYYECLIGGFSPDYYRRILEKRLSAEV

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Unclassified 30.0%
Kalotermitidae 24.0%
Termopsidae 8.0%
Rhinotermitidae 4.0%

🌳 Taxonomy

Archaea 1
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
16 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
28 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
29 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
32 650716102 Treponema primitia ZAS-2 Isolate Unclassified
33 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
34 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
47 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_151806 3300042612 Bacteria 13756
2 AustNasuHG_c1001349 3300000089 Bacteria 8801
3 JGI24695J34938_10000016 3300002450 Bacteria 116336
4 Ga0072941_1035939 3300005201 Bacteria 13220
5 Ga0466702_135825 3300042635 Bacteria 3760
6 Ga0466704_411971 3300042643 Bacteria 19295
7 Ga0466708_025661 3300042652 Bacteria 42065
8 Ga0466708_091225 3300042652 Bacteria 16006
9 Ga0466726_043084 3300042619 Bacteria 5167
10 Ga0264413_101607 3300024493 Unclassified 6402
11 Ga0264413_139379 3300024493 Bacteria 5592
12 Ga0466693_060383 3300042592 Bacteria 8217
13 Ga0466694_063835 3300042594 Bacteria 37589
14 Ga0466699_026292 3300042597 Bacteria 3639
15 Ga0466716_062337 3300042605 Bacteria 44297
16 Ga0466716_383735 3300042605 Bacteria 4906
17 Ga0466705_231320 3300042612 Bacteria 18145
18 JGI24698J34947_10000583 3300002449 Unclassified 17389
19 JGI24698J34947_10013420 3300002449 Bacteria 4474
20 JGI24695J34938_10000186 3300002450 Bacteria 58319
21 JGI24695J34938_10002400 3300002450 Bacteria 14388
22 JGI24695J34938_10006546 3300002450 Bacteria 6967
23 Ga0072940_1016998 3300005200 Bacteria 2268
24 Ga0466704_393069 3300042643 Bacteria 10459
25 Ga0466704_572658 3300042643 Bacteria 6918
26 Ga0466723_071252 3300042618 Bacteria 58514
27 Ga0466726_287420 3300042619 Bacteria 15009
28 Ga0466728_224245 3300042620 Bacteria 10061
29 Ga0264413_101847 3300024493 Bacteria 86591
30 Ga0466694_105932 3300042594 Bacteria 49364
31 Ga0466696_099585 3300042596 Bacteria 10860
32 Ga0123353_10236956 3300010167 Bacteria 2839
33 JGI24698J34947_10004146 3300002449 Bacteria 7865
34 JGI24698J34947_10043597 3300002449 Bacteria 2299
35 JGI24695J34938_10001854 3300002450 Bacteria 17177
36 JGI24695J34938_10003503 3300002450 Bacteria 10904
37 JGI24695J34938_10011603 3300002450 Unclassified 4737
38 Ga0466731_160741 3300042622 Archaea 4710
39 Ga0466735_062955 3300042624 Bacteria 25771
40 Ga0466703_131167 3300042636 Bacteria 8698
41 Ga0466703_289965 3300042636 Bacteria 2702
42 Ga0466727_002127 3300042655 Bacteria 5499
43 Ga0466718_008891 3300042617 Bacteria 16206
44 Ga0466718_017117 3300042617 Bacteria 6410
45 Ga0466718_057705 3300042617 Bacteria 6059
46 Ga0466728_056427 3300042620 Bacteria 11598
47 Ga0466691_158437 3300042593 Bacteria 18080
48 Ga0466694_173720 3300042594 Bacteria 25304
49 Ga0123356_10169674 3300010049 Bacteria 2191
50 Ga0466720_134808 3300042607 Bacteria 3999
51 JGI24698J34947_10000632 3300002449 Bacteria 16952
52 JGI24699J35502_11091118 3300002509 Unclassified 2139
53 Ga0072941_1047264 3300005201 Bacteria 11760
54 Ga0466727_322795 3300042655 Bacteria 13243
55 Ga0466712_017533 3300042614 Bacteria 21563
56 Ga0466693_075896 3300042592 Bacteria 53125
57 Ga0466693_085701 3300042592 Bacteria 5281
58 Ga0466691_074225 3300042593 Bacteria 14412
59 Ga0466696_063812 3300042596 Bacteria 17398
60 Ga0466699_158308 3300042597 Bacteria 2534
61 Ga0123356_10000007 3300010049 Bacteria 240704
62 Ga0466716_020105 3300042605 Bacteria 4483
63 Ga0466716_320412 3300042605 Bacteria 5216
64 Ga0466719_312216 3300042606 Bacteria 6308
65 Ga0466720_032626 3300042607 Bacteria 13895
66 Ga0466722_112483 3300042609 Bacteria 2865
67 Ga0466705_028310 3300042612 Bacteria 12285
68 JGI24698J34947_10033330 3300002449 Unclassified 2703
69 JGI24695J34938_10043045 3300002450 Bacteria 2017
70 Ga0072941_1077300 3300005201 Bacteria 6820
71 Ga0072941_1102810 3300005201 Bacteria 4857
72 Ga0466703_047320 3300042636 Bacteria 4048
73 Ga0466712_009154 3300042614 Bacteria 12593
74 Ga0466712_112533 3300042614 Bacteria 5724
75 Ga0466712_139157 3300042614 Bacteria 70891
76 Ga0466692_067669 3300042591 Bacteria 7313
77 Ga0123356_10020801 3300010049 Bacteria 6206
78 Ga0466716_091280 3300042605 Bacteria 15463
79 Ga0466719_126169 3300042606 Bacteria 4100
80 Ga0466720_065463 3300042607 Bacteria 6065
81 Ga0466721_224720 3300042608 Bacteria 20051
82 Ga0466722_007779 3300042609 Bacteria 11833
83 Ga0466722_038012 3300042609 Bacteria 18975
84 JGI24698J34947_10011455 3300002449 Bacteria 4869
85 JGI24698J34947_10015903 3300002449 Bacteria 4091
86 JGI24695J34938_10000017 3300002450 Bacteria 115659
87 JGI24695J34938_10018211 3300002450 Bacteria 3518
88 JGI24702J35022_10052913 3300002462 Bacteria 2165
89 Ga0072941_1008776 3300005201 Bacteria 26268
90 Ga0072941_1151441 3300005201 Bacteria 3004
91 Ga0072941_1490828 3300005201 Bacteria 2267
92 Ga0466703_121105 3300042636 Bacteria 28007
93 Ga0466704_016389 3300042643 Unclassified 2958
94 Ga0466709_011536 3300042648 Bacteria 10676
95 Ga0466708_396359 3300042652 Bacteria 10107
96 Ga0466712_019495 3300042614 Bacteria 40574
97 Ga0466711_135718 3300042615 Bacteria 16582
98 Ga0466723_014513 3300042618 Bacteria 9794
99 Ga0264413_132084 3300024493 Bacteria 2641
100 Ga0466699_402771 3300042597 Bacteria 21868
101 AustNasuHG_c1016456 3300000089 Bacteria 2474
102 JGI24698J34947_10012523 3300002449 Bacteria 4648
103 JGI24695J34938_10000021 3300002450 Bacteria 112419
104 JGI24695J34938_10030713 3300002450 Bacteria 2499
105 JGI24702J35022_10000805 3300002462 Bacteria 19405
106 Ga0068302_10084876 3300005071 Bacteria 7972
107 Ga0466703_001584 3300042636 Bacteria 18580
108 Ga0466703_118937 3300042636 Bacteria 14662
109 Ga0466708_038004 3300042652 Bacteria 4450
110 Ga0466711_343333 3300042615 Bacteria 5945
111 Ga0466726_432681 3300042619 Bacteria 4616
112 Ga0466694_113637 3300042594 Bacteria 10355
113 Ga0466696_221959 3300042596 Bacteria 15679
114 Ga0466699_259307 3300042597 Bacteria 2202
115 Ga0123356_10000085 3300010049 Bacteria 98249
116 Ga0466719_038092 3300042606 Bacteria 12135
117 Ga0466722_087893 3300042609 Bacteria 1722
118 Ga0466705_050312 3300042612 Bacteria 3788
119 AustNasuHG_c1000947 3300000089 Bacteria 10494
120 JGI24698J34947_10018305 3300002449 Bacteria 3787
121 JGI24695J34938_10000352 3300002450 Bacteria 45395
122 JGI24695J34938_10000661 3300002450 Bacteria 32544
123 JGI24695J34938_10000788 3300002450 Bacteria 29542
124 JGI24695J34938_10007621 3300002450 Bacteria 6292
125 Ga0466704_150819 3300042643 Bacteria 8238
126 Ga0466708_107150 3300042652 Bacteria 15681
127 Ga0466712_039302 3300042614 Bacteria 20252
128 Ga0466712_107945 3300042614 Unclassified 4929
129 Ga0466718_037157 3300042617 Bacteria 10500
130 Ga0466723_095605 3300042618 Bacteria 14842
131 Ga0466723_294328 3300042618 Bacteria 3841
132 Ga0466726_012780 3300042619 Bacteria 3511
133 Ga0466728_051506 3300042620 Bacteria 15989
134 Ga0466696_202776 3300042596 Bacteria 2132
135 Ga0123356_10000079 3300010049 Bacteria 103173
136 Ga0123356_10000767 3300010049 Bacteria 35460

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_131167 Ga0466703_131167_5253_6704 440
2 3300042655 Ga0466727_002127 Ga0466727_002127_2296_3636 446
3 3300000089 AustNasuHG_c1016456 AustNasuHG_10164562 447
4 3300042609 Ga0466722_038012 Ga0466722_038012_9266_10783 447
5 3300042619 Ga0466726_012780 Ga0466726_012780_2087_3454 448
6 3300042612 Ga0466705_151806 Ga0466705_151806_3346_4974 453
7 3300042619 Ga0466726_287420 Ga0466726_287420_7585_8976 453
8 iso_pr_bacteria 2820013017 2820013429 453
9 3300042596 Ga0466696_202776 Ga0466696_202776_204_1625 454
10 iso_pr_bacteria 2772190978 2773730685 454
11 3300042636 Ga0466703_289965 Ga0466703_289965_969_2435 455
12 3300042593 Ga0466691_074225 Ga0466691_074225_7793_9346 456
13 3300010049 Ga0123356_10020801 Ga0123356_100208012 461
14 3300042615 Ga0466711_135718 Ga0466711_135718_3112_4599 461
15 3300010049 Ga0123356_10000079 Ga0123356_1000007924 464
16 3300042606 Ga0466719_312216 Ga0466719_312216_2913_4364 464
17 3300042652 Ga0466708_091225 Ga0466708_091225_7798_9297 465
18 3300042606 Ga0466719_038092 Ga0466719_038092_10553_12088 466
19 3300042643 Ga0466704_393069 Ga0466704_393069_8047_9513 466
20 3300024493 Ga0264413_132084 Ga0264413_1320842 467
21 3300042596 Ga0466696_099585 Ga0466696_099585_5406_7025 468
22 3300042608 Ga0466721_224720 Ga0466721_224720_18300_19802 468
23 iso_pr_bacteria 2781125658 2781324837 468
24 3300010049 Ga0123356_10000767 Ga0123356_1000076712 469
25 3300042605 Ga0466716_020105 Ga0466716_020105_854_2371 469
26 3300042609 Ga0466722_087893 Ga0466722_087893_13_1515 469
27 3300042620 Ga0466728_224245 Ga0466728_224245_6515_7987 469
28 3300042648 Ga0466709_011536 Ga0466709_011536_5464_7008 469
29 3300002450 JGI24695J34938_10030713 JGI24695J34938_100307132 471
30 3300042620 Ga0466728_056427 Ga0466728_056427_7858_9306 471
31 3300042643 Ga0466704_150819 Ga0466704_150819_1939_3558 471
32 3300005201 Ga0072941_1077300 Ga0072941_10773004 473
33 3300005201 Ga0072941_1151441 Ga0072941_11514412 473
34 3300042635 Ga0466702_135825 Ga0466702_135825_1985_3475 473
35 3300042607 Ga0466720_032626 Ga0466720_032626_10740_12227 474
36 3300042619 Ga0466726_043084 Ga0466726_043084_2277_3701 474
37 3300042612 Ga0466705_050312 Ga0466705_050312_1827_3674 475
38 3300042617 Ga0466718_008891 Ga0466718_008891_11859_13352 475
39 3300042655 Ga0466727_322795 Ga0466727_322795_5749_7176 475
40 3300042612 Ga0466705_231320 Ga0466705_231320_5039_6706 476
41 3300042636 Ga0466703_047320 Ga0466703_047320_2381_3811 476
42 3300042609 Ga0466722_112483 Ga0466722_112483_969_2498 477
43 3300042652 Ga0466708_107150 Ga0466708_107150_7763_9364 477
44 3300010049 Ga0123356_10169674 Ga0123356_101696742 480
45 3300042592 Ga0466693_075896 Ga0466693_075896_22650_24146 480
46 3300042643 Ga0466704_411971 Ga0466704_411971_14261_15967 480
47 3300042597 Ga0466699_259307 Ga0466699_259307_623_2101 481
48 3300042596 Ga0466696_063812 Ga0466696_063812_3924_5417 482
49 3300042624 Ga0466735_062955 Ga0466735_062955_3457_5148 482
50 3300010049 Ga0123356_10000007 Ga0123356_1000000726 483
51 3300042617 Ga0466718_037157 Ga0466718_037157_5946_7439 483
52 3300024493 Ga0264413_101847 Ga0264413_10184729 484
53 3300042605 Ga0466716_383735 Ga0466716_383735_3239_4870 484
54 3300005201 Ga0072941_1047264 Ga0072941_10472646 487
55 iso_pr_bacteria 2781125657 2781322819 487
56 3300042612 Ga0466705_028310 Ga0466705_028310_2807_4342 488
57 3300042643 Ga0466704_572658 Ga0466704_572658_1146_2693 488
58 iso_pr_bacteria 2781125683 2781412058 488
59 3300002450 JGI24695J34938_10002400 JGI24695J34938_100024002 489
60 3300010049 Ga0123356_10000085 Ga0123356_100000856 489
61 3300042591 Ga0466692_067669 Ga0466692_067669_3366_4868 489
62 3300042614 Ga0466712_019495 Ga0466712_019495_22627_24096 489
63 3300005201 Ga0072941_1035939 Ga0072941_10359395 490
64 3300042607 Ga0466720_134808 Ga0466720_134808_251_1723 490
65 3300002509 JGI24699J35502_11091118 JGI24699J35502_110911182 491
66 3300042617 Ga0466718_017117 Ga0466718_017117_709_2184 491
67 3300042617 Ga0466718_057705 Ga0466718_057705_4215_5690 491
68 3300042622 Ga0466731_160741 Ga0466731_160741_358_1833 491
69 3300000089 AustNasuHG_c1000947 AustNasuHG_10009474 492
70 3300002450 JGI24695J34938_10000186 JGI24695J34938_1000018623 492
71 3300042597 Ga0466699_158308 Ga0466699_158308_518_1996 492
72 3300042618 Ga0466723_294328 Ga0466723_294328_1870_3399 492
73 3300042652 Ga0466708_396359 Ga0466708_396359_6164_7720 492
74 3300002450 JGI24695J34938_10003503 JGI24695J34938_100035033 493
75 3300005201 Ga0072941_1008776 Ga0072941_100877620 493
76 iso_pr_bacteria 2781125640 2781288449 493
77 3300005201 Ga0072941_1490828 Ga0072941_14908282 494
78 3300042594 Ga0466694_063835 Ga0466694_063835_6593_8077 494
79 3300042597 Ga0466699_026292 Ga0466699_026292_242_1726 494
80 3300042597 Ga0466699_402771 Ga0466699_402771_10303_11790 495
81 3300002450 JGI24695J34938_10011603 JGI24695J34938_100116032 496
82 3300002462 JGI24702J35022_10000805 JGI24702J35022_100008057 496
83 3300024493 Ga0264413_101607 Ga0264413_1016075 496
84 3300042607 Ga0466720_065463 Ga0466720_065463_3272_4762 496
85 3300042614 Ga0466712_112533 Ga0466712_112533_1561_3051 496
86 3300002450 JGI24695J34938_10000352 JGI24695J34938_1000035221 497
87 3300002450 JGI24695J34938_10000661 JGI24695J34938_1000066116 497
88 3300002450 JGI24695J34938_10000788 JGI24695J34938_1000078814 497
89 3300002450 JGI24695J34938_10001854 JGI24695J34938_1000185414 497
90 3300002450 JGI24695J34938_10018211 JGI24695J34938_100182111 497
91 3300002450 JGI24695J34938_10043045 JGI24695J34938_100430452 497
92 3300024493 Ga0264413_139379 Ga0264413_1393792 497
93 3300042592 Ga0466693_085701 Ga0466693_085701_2684_4177 497
94 3300042594 Ga0466694_105932 Ga0466694_105932_24732_26225 497
95 3300042594 Ga0466694_173720 Ga0466694_173720_3010_4503 497
96 3300042596 Ga0466696_221959 Ga0466696_221959_12041_13627 497
97 3300042614 Ga0466712_017533 Ga0466712_017533_10291_11784 497
98 3300042614 Ga0466712_139157 Ga0466712_139157_7728_9221 497
99 iso_pr_bacteria 2781125638 2781283209 497
100 3300002450 JGI24695J34938_10000017 JGI24695J34938_1000001721 498
101 3300005200 Ga0072940_1016998 Ga0072940_10169982 498
102 3300042614 Ga0466712_009154 Ga0466712_009154_7975_9471 498
103 3300042614 Ga0466712_039302 Ga0466712_039302_15448_16944 498
104 3300042614 Ga0466712_107945 Ga0466712_107945_18_1514 498
105 3300002449 JGI24698J34947_10000583 JGI24698J34947_1000058310 499
106 3300002449 JGI24698J34947_10000632 JGI24698J34947_100006322 499
107 3300002449 JGI24698J34947_10004146 JGI24698J34947_100041466 499
108 3300002449 JGI24698J34947_10011455 JGI24698J34947_100114555 499
109 3300002449 JGI24698J34947_10012523 JGI24698J34947_100125233 499
110 3300002449 JGI24698J34947_10013420 JGI24698J34947_100134202 499
111 3300002449 JGI24698J34947_10015903 JGI24698J34947_100159032 499
112 3300002449 JGI24698J34947_10033330 JGI24698J34947_100333302 499
113 3300002449 JGI24698J34947_10043597 JGI24698J34947_100435973 499
114 3300042592 Ga0466693_060383 Ga0466693_060383_55_1554 499
115 3300005201 Ga0072941_1102810 Ga0072941_11028103 500
116 iso_pr_bacteria 2781125661 2781332104 500
117 3300042636 Ga0466703_001584 Ga0466703_001584_2503_4101 501
118 iso_pr_bacteria 2781125660 2781329510 501
119 3300002449 JGI24698J34947_10018305 JGI24698J34947_100183052 502
120 3300010167 Ga0123353_10236956 Ga0123353_102369561 502
121 3300042643 Ga0466704_016389 Ga0466704_016389_1125_2636 503
122 3300042594 Ga0466694_113637 Ga0466694_113637_6107_7621 504
123 3300042605 Ga0466716_320412 Ga0466716_320412_953_2467 504
124 3300042618 Ga0466723_095605 Ga0466723_095605_11602_13158 504
125 3300042636 Ga0466703_118937 Ga0466703_118937_11331_12845 504
126 3300002462 JGI24702J35022_10052913 JGI24702J35022_100529132 505
127 3300042615 Ga0466711_343333 Ga0466711_343333_1969_3486 505
128 3300042605 Ga0466716_062337 Ga0466716_062337_2391_3947 506
129 3300042606 Ga0466719_126169 Ga0466719_126169_1146_2702 506
130 3300042618 Ga0466723_071252 Ga0466723_071252_9483_11063 513
131 iso_pr_bacteria 2781125644 2781295152 513
132 3300002450 JGI24695J34938_10000021 JGI24695J34938_1000002138 514
133 3300042605 Ga0466716_091280 Ga0466716_091280_6388_7959 515
134 3300042593 Ga0466691_158437 Ga0466691_158437_13932_15482 516
135 3300042652 Ga0466708_038004 Ga0466708_038004_526_2076 516
136 3300042619 Ga0466726_432681 Ga0466726_432681_333_1916 517
137 3300000089 AustNasuHG_c1001349 AustNasuHG_10013494 518
138 3300042652 Ga0466708_025661 Ga0466708_025661_3166_4722 518
139 3300042636 Ga0466703_121105 Ga0466703_121105_13264_14880 519
140 iso_pr_bacteria 2781125646 2781300264 519
141 3300002450 JGI24695J34938_10000016 JGI24695J34938_1000001671 520
142 iso_pr_bacteria 2781125635 2781277972 520
143 iso_pr_bacteria 2781125645 2781299416 520
144 iso_pr_bacteria 2781125643 2781293798 521
145 3300002450 JGI24695J34938_10006546 JGI24695J34938_100065465 522
146 3300042620 Ga0466728_051506 Ga0466728_051506_9629_11239 536
147 3300005071 Ga0068302_10084876 Ga0068302_100848765 538
148 3300042609 Ga0466722_007779 Ga0466722_007779_2091_3713 540
149 3300002450 JGI24695J34938_10007621 JGI24695J34938_100076213 541
150 3300042618 Ga0466723_014513 Ga0466723_014513_4846_6474 542
151 iso_pr_bacteria 650716102 650883049 546

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01739 CheR CheR methyltransferase, SAM binding domain 83 258 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.57 0.67 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.