Protein Family IF13512
Metagenome
Isolate
353
Members
315
Samples
101
Scaffolds
210.94
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|648861007|648921140|
- Length
- 258 aa
- Sequence
- MSMCRSAWVNQVIERLGAETMTSKDKMGLIGKKLGMTRVFTEEGVSIPVTVIEIEKNRVTQVKDIKTDGYCAVQVTTGQKKTSRLKKPQRGHFEGTKTIRSKRATLDNPEIIKEVLTSKDPVTAGRGLWEFRIAEDQKFLRGEEITVEIFADVKKVDVTGTSKGKGFAGVVKRWNFRTQDATHGNSLSHRAPGSIGQNQTPGKVFKGKKMAGHLGDERVTVQSLDVVRVDAKRNLLLVKGAVPGATGGNLIVKPAVKA
Sample Types
Isolate
71.4%
Metagenome
28.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
14.1%
Aphididae
12.4%
Chrysomelidae
7.7%
Drosophilidae
7.0%
Curculionidae
6.4%
Formicidae
5.0%
Elmidae
5.0%
Anthocoridae
4.7%
Muscidae
4.4%
Culicidae
3.7%
Tenebrionidae
3.0%
Calliphoridae
3.0%
Apidae
2.0%
Termitidae
2.0%
Tephritidae
1.7%
Pediculidae
1.7%
Pteromalidae
1.0%
Armadillidiidae
1.0%
Cerambycidae
1.0%
Glossinidae
0.7%
Cicadellidae
0.7%
Passalidae
0.7%
Kalotermitidae
0.7%
Aleyrodidae
0.7%
Pentatomidae
0.7%
Sarcophagidae
0.7%
Noctuidae
0.7%
Plutellidae
0.3%
Pseudococcidae
0.3%
Gryllidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Hippoboscidae
0.3%
Stratiomyidae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Aphalaridae
0.3%
Daphniidae
0.3%
Aphrophoridae
0.3%
Hormaphididae
0.3%
Hodotermitidae
0.3%
Majidae
0.3%
Rhopalidae
0.3%
Reduviidae
0.3%
Ixodidae
0.3%
Carabidae
0.3%
Triozidae
0.3%
Siricidae
0.3%
Crambidae
0.3%
Taxonomy
Archaea
0
Bacteria
310
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 2 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 3 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 4 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 5 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 6 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 7 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 8 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 9 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 10 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 11 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 12 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 13 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 14 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 15 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 16 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 17 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 18 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 19 | 2772190787 | Candidatus Riesia pediculicola HHAC | Isolate | Pediculidae |
| 20 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 21 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 22 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 23 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 24 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 25 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 26 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 29 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 30 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 31 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 32 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 33 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 38 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 39 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 40 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 41 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 42 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 43 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 44 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 45 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 46 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 47 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 48 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 49 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 50 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 51 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 52 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 53 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 54 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 55 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 56 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 57 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 58 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 59 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 60 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 61 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 62 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 63 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 64 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 65 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 66 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 67 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 68 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 69 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 70 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 71 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 72 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 73 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 74 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 75 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 76 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 77 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 78 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 79 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 80 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 81 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 82 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 83 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 84 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 85 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 86 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 87 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 88 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 89 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 90 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 91 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 92 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 93 | 2958255616 | Serratia marcescens TM | Isolate | |
| 94 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 95 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 96 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 97 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 98 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 99 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 100 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 101 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 102 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 103 | 2773858019 | Candidatus Riesia pediculicola HHBH | Isolate | Pediculidae |
| 104 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 105 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 106 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 107 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 108 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 109 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 110 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 111 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 112 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 113 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 114 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 115 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 116 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 117 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 118 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 119 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 120 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 121 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 122 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 123 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 124 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 125 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 126 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 127 | 2510065001 | Arsenophonus pediculi ArP | Isolate | Pediculidae |
| 128 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 129 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 130 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 131 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 132 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 133 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 134 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 135 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 136 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 137 | 2999135268 | Enterobacteriaceae endosymbiont of Plateumaris sericea PserSym | Isolate | Chrysomelidae |
| 138 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 139 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 140 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 141 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 142 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 143 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 144 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 145 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 146 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 147 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 148 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 149 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 150 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 151 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 152 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 153 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 154 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 155 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 156 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 157 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 158 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 159 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 160 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 161 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 162 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 163 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 164 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 165 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 166 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 167 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 168 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 169 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 170 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 171 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 172 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 173 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 174 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 175 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 176 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 177 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 178 | 2999135777 | Enterobacteriaceae endosymbiont of Donacia tomentosa DtomSym | Isolate | Chrysomelidae |
| 179 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 180 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 181 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 182 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 183 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 184 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 185 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 186 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 187 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 188 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 189 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 190 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 191 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 192 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 193 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 194 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 195 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 196 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 197 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 198 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 199 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 200 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 201 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 202 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 203 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 204 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 205 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 206 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 207 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 208 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 209 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 210 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 211 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 212 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 213 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 214 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 215 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 216 | 2998827396 | Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym | Isolate | Chrysomelidae |
| 217 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 218 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 219 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 220 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 221 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 222 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 223 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 224 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 225 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 226 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 227 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 228 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 229 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 230 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 231 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 232 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 233 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 234 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 235 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 236 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 237 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 238 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 239 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 240 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 241 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 242 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 243 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 244 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 245 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 246 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 247 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 248 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 249 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 250 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 251 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 252 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 253 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 254 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 255 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 256 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 257 | 2998830186 | Enterobacteriaceae endosymbiont of Plateumaris pusilla PpusSym | Isolate | Chrysomelidae |
| 258 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 259 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 260 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 261 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 262 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 263 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 264 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 265 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 266 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 267 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 268 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 269 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 270 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 271 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 272 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 273 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 274 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 275 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 276 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 277 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 278 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 279 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 280 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 281 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 282 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 283 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 284 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 285 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 286 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 287 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 288 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 289 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 290 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 291 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 292 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 293 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 294 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 295 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 296 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 297 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 298 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 299 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 300 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 301 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 302 | 2998833461 | Enterobacteriaceae endosymbiont of Donacia marginata DmarSym | Isolate | Chrysomelidae |
| 303 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 304 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 305 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 306 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 307 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 308 | 646564517 | Candidatus Riesia pediculicola USDA | Isolate | Pediculidae |
| 309 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 310 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 311 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 312 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 313 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 314 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 315 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 2 | Ga0160453_104081 | 3300012814 | Unclassified | 2794 |
| 3 | Ga0160472_100501 | 3300012839 | Bacteria | 26044 |
| 4 | Ga0466657_026248 | 3300042582 | Unclassified | 1912 |
| 5 | IMNBL1DRAFT_c0003348 | 3300000062 | Bacteria | 10396 |
| 6 | Meta3P_1000450 | 3300002464 | Unclassified | 37605 |
| 7 | WW0001_100293 | 3300002732 | Bacteria | 110843 |
| 8 | Ga0063521_1004265 | 3300003973 | Unclassified | 3386 |
| 9 | Ga0103263_107103 | 3300007042 | Unclassified | 1214 |
| 10 | Ga0102734_1000264 | 3300007129 | Bacteria | 17175 |
| 11 | Ga0103264_1030822 | 3300007188 | Bacteria | 2468 |
| 12 | Ga0127645_118501 | 3300009461 | Bacteria | 24318 |
| 13 | Ga0466709_223582 | 3300042648 | Bacteria | 16493 |
| 14 | Ga0466724_17456 | 3300042649 | Unclassified | 1648 |
| 15 | Ga0466724_46186 | 3300042649 | Bacteria | 43782 |
| 16 | Ga0160459_101639 | 3300012831 | Bacteria | 4483 |
| 17 | Ga0160460_101558 | 3300012845 | Bacteria | 7266 |
| 18 | DPOL_contig20807 | 2035918003 | Unclassified | 5359 |
| 19 | HBC_ctgsDRAFT_1007204 | 3300000333 | Bacteria | 2615 |
| 20 | Ga0063521_1008799 | 3300003973 | Bacteria | 2411 |
| 21 | Ga0102734_1000503 | 3300007129 | Bacteria | 11120 |
| 22 | Ga0102737_1000003 | 3300007142 | Bacteria | 215134 |
| 23 | Ga0104019_1036129 | 3300007150 | Unclassified | 2317 |
| 24 | Ga0103267_1000266 | 3300007190 | Bacteria | 19495 |
| 25 | Ga0105005_1033507 | 3300007505 | Bacteria | 5802 |
| 26 | Ga0466707_054342 | 3300042601 | Unclassified | 2076 |
| 27 | Ga0466713_007763 | 3300042602 | Unclassified | 4160 |
| 28 | Ga0466730_060930 | 3300042625 | Unclassified | 14835 |
| 29 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 30 | Ga0136159_1000014 | 3300010217 | Bacteria | 131100 |
| 31 | Ga0160444_101989 | 3300012841 | Unclassified | 3305 |
| 32 | Ga0265387_1001376 | 3300024582 | Unclassified | 3557 |
| 33 | FGTW_contig30471 | 2065487013 | Unclassified | 25652 |
| 34 | SWWA_contig00534__length_9584___numreads_244 | 2100351016 | Unclassified | 9584 |
| 35 | HBC_ctgsDRAFT_1000172 | 3300000333 | Bacteria | 15812 |
| 36 | Ga0103265_1005149 | 3300007068 | Unclassified | 1823 |
| 37 | Ga0105005_1039252 | 3300007505 | Unclassified | 4009 |
| 38 | Ga0127656_101091 | 3300009453 | Bacteria | 53130 |
| 39 | Ga0127653_100120 | 3300009471 | Bacteria | 188812 |
| 40 | Ga0466701_024295 | 3300042598 | Unclassified | 2286 |
| 41 | DPO_contig00034 | 2032320009 | Bacteria | 1364 |
| 42 | DPOL_contig00412 | 2035918003 | Unclassified | 2629 |
| 43 | 2227414137 | 2225789004 | Bacteria | 26288 |
| 44 | CVPL010L_1001490 | 3300002932 | Unclassified | 5323 |
| 45 | CVPL005W_1000150 | 3300002934 | Bacteria | 30047 |
| 46 | Ga0102736_1000294 | 3300007052 | Bacteria | 10862 |
| 47 | Ga0103265_1017937 | 3300007068 | Unclassified | 929 |
| 48 | Ga0103267_1118950 | 3300007190 | Bacteria | 1333 |
| 49 | Ga0127656_110275 | 3300009453 | Bacteria | 5902 |
| 50 | Ga0127651_100078 | 3300009483 | Bacteria | 210306 |
| 51 | Ga0466701_035904 | 3300042598 | Bacteria | 25732 |
| 52 | Ga0466706_017752 | 3300042599 | Bacteria | 2044 |
| 53 | Ga0466724_51932 | 3300042649 | Unclassified | 7389 |
| 54 | Ga0562378_0149 | 3300056814 | Bacteria | 174727 |
| 55 | Ga0160472_101385 | 3300012839 | Bacteria | 7272 |
| 56 | Ga0105005_1278935 | 3300007505 | Unclassified | 2286 |
| 57 | Ga0127655_1001118 | 3300009459 | Bacteria | 97824 |
| 58 | Ga0466730_059466 | 3300042625 | Bacteria | 59728 |
| 59 | Ga0247290_00231 | 3300035364 | Unclassified | 15387 |
| 60 | HBC_ctgsDRAFT_1003725 | 3300000333 | Bacteria | 3503 |
| 61 | HBC_ctgsDRAFT_1037593 | 3300000333 | Bacteria | 1187 |
| 62 | Ga0052191_102227 | 3300003097 | Unclassified | 1534 |
| 63 | Ga0063521_1002360 | 3300003973 | Unclassified | 4674 |
| 64 | Ga0074188_1000429 | 3300005318 | Bacteria | 5581 |
| 65 | Ga0103260_1002225 | 3300007139 | Unclassified | 3324 |
| 66 | Ga0104019_1029049 | 3300007150 | Unclassified | 4905 |
| 67 | Ga0103264_1000195 | 3300007188 | Bacteria | 65205 |
| 68 | Ga0127657_100003 | 3300009457 | Bacteria | 550482 |
| 69 | Ga0466701_048540 | 3300042598 | Bacteria | 1339 |
| 70 | Ga0466701_051557 | 3300042598 | Bacteria | 2285 |
| 71 | Ga0466724_02139 | 3300042649 | Unclassified | 6025 |
| 72 | Ga0466725_167598 | 3300042654 | Bacteria | 15022 |
| 73 | Ga0160436_1008965 | 3300012861 | Unclassified | 2232 |
| 74 | Ga0466657_162090 | 3300042582 | Bacteria | 2908 |
| 75 | FGTW_contig25208 | 2065487013 | Unclassified | 957 |
| 76 | SWWA_contig31789__length_7190___numreads_750 | 2100351016 | Unclassified | 7190 |
| 77 | Ga0063521_1002916 | 3300003973 | Unclassified | 4116 |
| 78 | Ga0074188_1161938 | 3300005318 | Bacteria | 1060 |
| 79 | Ga0074304_1138902 | 3300005319 | Unclassified | 2372 |
| 80 | Ga0103266_1006161 | 3300007067 | Unclassified | 2302 |
| 81 | Ga0102739_1000431 | 3300007095 | Unclassified | 8741 |
| 82 | Ga0466701_045249 | 3300042598 | Unclassified | 102024 |
| 83 | Ga0466730_041124 | 3300042625 | Bacteria | 14089 |
| 84 | Ga0466724_45820 | 3300042649 | Unclassified | 1145 |
| 85 | Ga0466705_144704 | 3300042612 | Bacteria | 26960 |
| 86 | Ga0562378_0083 | 3300056814 | Bacteria | 261378 |
| 87 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 88 | Ga0136160_1000088 | 3300010225 | Bacteria | 78768 |
| 89 | Ga0160431_104198 | 3300012828 | Bacteria | 2705 |
| 90 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 91 | SPBB_contig11660 | 2044078006 | Bacteria | 5420 |
| 92 | SPBB_contig11676 | 2044078006 | Unclassified | 3111 |
| 93 | FGTW_contig12790 | 2065487013 | Bacteria | 8321 |
| 94 | Ga0103266_1000946 | 3300007067 | Bacteria | 7288 |
| 95 | Ga0104051_1018427 | 3300007078 | Unclassified | 1661 |
| 96 | Ga0102740_1010129 | 3300007140 | Unclassified | 1502 |
| 97 | Ga0104040_1040825 | 3300007149 | Unclassified | 4681 |
| 98 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 99 | Ga0466707_081410 | 3300042601 | Bacteria | 24723 |
| 100 | Ga0466734_076859 | 3300042623 | Bacteria | 25073 |
| 101 | Ga0466730_016273 | 3300042625 | Unclassified | 3680 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00297 | Ribosomal_L3 | Ribosomal protein L3 | 147 | 231 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.