Protein Family IF13494

Metagenome Isolate
170 Members
52 Samples
162 Scaffolds
449.97 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|643348524|643423197|
Length
493 aa
Sequence
MLYGKNSVWNTLDWLTVRVYLVLVLIGWFCIYAASYECNTGRFDFSNRASMQMVWILSSLCIAFVLLMIEGNWYEVFAFGIYIAVMLLLIVTVFVATPIKGSCSWLTLGAVRIQPAEFAKFATALAVAKVMGRYQFDISKKRSIISLLGLVFLPISLILLQRETGSALVFFVFFLVFYREGMSGKILLIGFSAALIFVLVVRFPFVVVSSISCGELLGMGFIIFCVMGLLLQYNYSRELKHVKYLFCAVLGTTVVSISMFLFTSFNVYWIILSFFVSICFYFLFLFMKNRFSIYLWIVLFIIGSFSFLYSTDYIFDNVLELHQKNRVQVALGIIDDPRGAGYNVNQSKIAIGSGGFKGKGYLRGTQTELKYVPEQETDFIFCTLGEEMGFIGSVTVLVLFLILIIRLVWLAEKQQRVFIRVYGYSVACIIFFHFAINIGMVLGITPVIGIPLSFLSYGGSSLWSFTILLFIFLRLDTSKRFGKGDLLKFKFST

📊 Sample Types

Isolate 4.7%
Metagenome 95.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Kalotermitidae 28.0%
Unclassified 12.0%
Rhinotermitidae 8.0%
Blattidae 6.0%
Termopsidae 6.0%
Passalidae 4.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 168
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2998907766 Penaeicola halotolerans LMIT005 Isolate
16 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
28 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
50 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
51 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466696_085038 3300042596 Bacteria 5055
2 Ga0466696_085502 3300042596 Bacteria 15546
3 Ga0466696_328097 3300042596 Bacteria 7211
4 Ga0466729_212035 3300042621 Bacteria 9717
5 Ga0466703_074379 3300042636 Bacteria 18711
6 Ga0466709_124130 3300042648 Bacteria 272718
7 Ga0466724_33645 3300042649 Bacteria 6982
8 Ga0466708_311886 3300042652 Bacteria 13167
9 Ga0466728_019578 3300042620 Bacteria 68915
10 JGI24702J35022_10006559 3300002462 Bacteria 6724
11 JGI24705J35276_12213260 3300002504 Bacteria 1918
12 Ga0123357_10001908 3300009784 Bacteria 22681
13 Ga0466701_098523 3300042598 Bacteria 77309
14 Ga0466706_075896 3300042599 Bacteria 2246
15 Ga0466707_006434 3300042601 Bacteria 3235
16 Ga0466713_050140 3300042602 Bacteria 15810
17 Ga0466716_395857 3300042605 Bacteria 3453
18 Ga0123357_10010638 3300009784 Bacteria 11722
19 Ga0123353_10049367 3300010167 Bacteria 6703
20 Ga0123354_10137685 3300010882 Unclassified 3041
21 Ga0466735_218098 3300042624 Bacteria 3823
22 Ga0466704_110891 3300042643 Bacteria 7069
23 Ga0466704_119159 3300042643 Bacteria 27307
24 Ga0466715_081257 3300042616 Bacteria 32787
25 Ga0466726_087706 3300042619 Bacteria 2953
26 Ga0466700_391349 3300042600 Bacteria 41227
27 Ga0466707_105571 3300042601 Bacteria 9962
28 Ga0466716_238887 3300042605 Bacteria 28802
29 Ga0466716_312373 3300042605 Bacteria 8151
30 Ga0466716_424402 3300042605 Bacteria 27848
31 Ga0466719_111332 3300042606 Bacteria 20001
32 Ga0466722_100835 3300042609 Bacteria 10702
33 Ga0123354_10003756 3300010882 Bacteria 21142
34 Ga0123354_10018723 3300010882 Bacteria 10867
35 Ga0466697_151232 3300042611 Bacteria 4098
36 Ga0466690_087203 3300042590 Bacteria 24182
37 Ga0466696_394022 3300042596 Bacteria 212291
38 Ga0466696_399809 3300042596 Bacteria 6340
39 Ga0466703_072411 3300042636 Bacteria 7818
40 Ga0466703_419148 3300042636 Bacteria 10322
41 Ga0466704_079126 3300042643 Bacteria 6576
42 Ga0466704_367739 3300042643 Bacteria 6973
43 Ga0466709_111041 3300042648 Bacteria 3738
44 Ga0466708_189765 3300042652 Bacteria 2843
45 Ga0466728_202712 3300042620 Bacteria 29942
46 Ga0466728_404528 3300042620 Bacteria 20672
47 Ga0466701_061376 3300042598 Bacteria 5771
48 Ga0466700_303542 3300042600 Bacteria 18342
49 Ga0466707_087930 3300042601 Bacteria 9677
50 Ga0466707_196186 3300042601 Bacteria 9688
51 Ga0466707_383728 3300042601 Bacteria 16507
52 Ga0466713_119093 3300042602 Bacteria 59442
53 Ga0466714_101031 3300042603 Bacteria 79046
54 Ga0466716_085091 3300042605 Bacteria 17694
55 Ga0123357_10003779 3300009784 Bacteria 17515
56 Ga0123357_10117947 3300009784 Bacteria 3356
57 Ga0123353_10373771 3300010167 Bacteria 2135
58 Ga0466705_365178 3300042612 Bacteria 12901
59 Ga0466692_085644 3300042591 Bacteria 19062
60 Ga0466692_179942 3300042591 Bacteria 100786
61 Ga0466696_235371 3300042596 Bacteria 2104
62 Ga0466735_078531 3300042624 Bacteria 2151
63 Ga0466704_061148 3300042643 Bacteria 3671
64 Ga0466704_505644 3300042643 Bacteria 9520
65 Ga0466709_004714 3300042648 Bacteria 1974
66 Ga0466727_170756 3300042655 Bacteria 3452
67 Ga0466705_477179 3300042612 Bacteria 3225
68 Ga0466711_298234 3300042615 Bacteria 16638
69 Ga0466715_403406 3300042616 Bacteria 13428
70 Ga0466723_059293 3300042618 Bacteria 11190
71 Ga0466726_181310 3300042619 Bacteria 18208
72 Ga0466728_063056 3300042620 Bacteria 68416
73 2227228034 2225789004 Bacteria 7379
74 IMNBL1DRAFT_c0000802 3300000062 Bacteria 24738
75 IMNBL1DRAFT_c0004041 3300000062 Bacteria 9008
76 JGI24705J35276_12232119 3300002504 Bacteria 4194
77 JGI24705J35276_12237010 3300002504 Bacteria 9559
78 Ga0068305_10004729 3300005083 Bacteria 14351
79 Ga0123357_10002874 3300009784 Bacteria 19418
80 Ga0466707_286883 3300042601 Bacteria 4422
81 Ga0466713_044001 3300042602 Bacteria 42258
82 Ga0466713_047392 3300042602 Bacteria 6997
83 Ga0466722_148621 3300042609 Bacteria 3851
84 Ga0123357_10098360 3300009784 Unclassified 3782
85 Ga0123354_10217727 3300010882 Bacteria 2040
86 Ga0466690_056201 3300042590 Bacteria 31912
87 Ga0466692_012061 3300042591 Bacteria 54313
88 Ga0466692_165865 3300042591 Bacteria 23835
89 Ga0466696_329822 3300042596 Bacteria 19237
90 Ga0466701_010863 3300042598 Bacteria 2846
91 Ga0466731_008971 3300042622 Bacteria 33045
92 Ga0466703_146643 3300042636 Bacteria 8922
93 Ga0466703_190077 3300042636 Bacteria 16721
94 Ga0466704_097655 3300042643 Bacteria 5923
95 Ga0466711_169251 3300042615 Bacteria 20452
96 Ga0466715_100049 3300042616 Bacteria 24536
97 Ga0466715_372014 3300042616 Bacteria 24656
98 Ga0466728_075600 3300042620 Bacteria 18453
99 Ga0123357_10001478 3300009784 Bacteria 24976
100 Ga0466713_007402 3300042602 Bacteria 4618
101 Ga0466716_248815 3300042605 Bacteria 15950
102 Ga0123357_10021926 3300009784 Bacteria 8556
103 Ga0123356_10239034 3300010049 Bacteria 1886
104 Ga0123353_10379601 3300010167 Bacteria 2114
105 Ga0466705_007870 3300042612 Bacteria 28662
106 Ga0466690_369127 3300042590 Bacteria 12418
107 Ga0466691_093033 3300042593 Bacteria 12147
108 Ga0466703_089004 3300042636 Bacteria 22238
109 Ga0466703_265231 3300042636 Bacteria 35509
110 Ga0466704_222354 3300042643 Bacteria 31272
111 Ga0466727_345918 3300042655 Bacteria 4517
112 Ga0466727_346347 3300042655 Bacteria 4837
113 Ga0466728_030059 3300042620 Bacteria 8376
114 JGI24705J35276_12238730 3300002504 Bacteria 46742
115 Ga0068305_10083512 3300005083 Bacteria 17021
116 Ga0466701_069354 3300042598 Bacteria 4008
117 Ga0466707_009633 3300042601 Bacteria 35190
118 Ga0466707_273436 3300042601 Bacteria 3837
119 Ga0466722_229738 3300042609 Bacteria 42096
120 Ga0466697_030728 3300042611 Bacteria 1607
121 Ga0123353_10271365 3300010167 Bacteria 2613
122 Ga0466733_164143 3300042659 Bacteria 4108
123 Ga0456237_0000006 3300041968 Bacteria 62306
124 Ga0466690_335963 3300042590 Bacteria 14238
125 Ga0466692_151517 3300042591 Bacteria 8533
126 Ga0466691_179044 3300042593 Bacteria 2337
127 Ga0466694_386233 3300042594 Bacteria 8172
128 Ga0466696_132281 3300042596 Bacteria 5658
129 Ga0466696_246530 3300042596 Bacteria 6131
130 Ga0466704_304995 3300042643 Bacteria 7216
131 Ga0466710_126297 3300042613 Bacteria 2244
132 Ga0466711_034154 3300042615 Bacteria 9934
133 Ga0466711_045368 3300042615 Bacteria 43229
134 Ga0466715_192873 3300042616 Bacteria 10969
135 Ga0466718_032068 3300042617 Bacteria 2136
136 Ga0466723_128730 3300042618 Bacteria 22067
137 Ga0466723_236631 3300042618 Bacteria 23560
138 Ga0466729_039119 3300042621 Bacteria 17456
139 Ga0466729_077009 3300042621 Bacteria 32046
140 IMNBL1DRAFT_c0000312 3300000062 Bacteria 41387
141 JGI24699J35502_11134214 3300002509 Bacteria 63548
142 Ga0466713_123497 3300042602 Bacteria 4888
143 Ga0466722_006046 3300042609 Bacteria 2735
144 Ga0123357_10009748 3300009784 Bacteria 12140
145 Ga0123356_10015385 3300010049 Bacteria 7337
146 Ga0123353_10377628 3300010167 Bacteria 2122
147 Ga0123354_10023390 3300010882 Bacteria 9747
148 Ga0466690_228138 3300042590 Bacteria 28377
149 Ga0466735_032969 3300042624 Bacteria 2300
150 Ga0466735_154777 3300042624 Bacteria 5853
151 Ga0466703_040410 3300042636 Bacteria 7418
152 Ga0466704_295450 3300042643 Bacteria 5382
153 Ga0466708_138945 3300042652 Bacteria 5124
154 Ga0466727_224853 3300042655 Bacteria 23233
155 Ga0466711_072653 3300042615 Bacteria 7639
156 Ga0466711_364135 3300042615 Bacteria 3426
157 Ga0466723_094954 3300042618 Bacteria 8294
158 JGI24705J35276_12223232 3300002504 Bacteria 2489
159 Ga0466701_020502 3300042598 Bacteria 10007
160 Ga0466713_048475 3300042602 Bacteria 59892
161 Ga0466713_109474 3300042602 Bacteria 12788
162 Ga0123354_10000043 3300010882 Bacteria 94179

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_124130 Ga0466709_124130_83996_85426 395
2 3300042655 Ga0466727_346347 Ga0466727_346347_1849_3228 395
3 3300042594 Ga0466694_386233 Ga0466694_386233_960_2342 401
4 3300002504 JGI24705J35276_12213260 JGI24705J35276_122132602 402
5 3300042636 Ga0466703_265231 Ga0466703_265231_5071_6525 402
6 3300009784 Ga0123357_10021926 Ga0123357_100219264 404
7 3300042636 Ga0466703_072411 Ga0466703_072411_4933_6321 404
8 3300009784 Ga0123357_10001478 Ga0123357_1000147816 408
9 3300042591 Ga0466692_012061 Ga0466692_012061_39081_40469 410
10 3300042616 Ga0466715_372014 Ga0466715_372014_8083_9405 411
11 3300002504 JGI24705J35276_12238730 JGI24705J35276_122387307 412
12 3300010049 Ga0123356_10015385 Ga0123356_100153853 412
13 3300042605 Ga0466716_238887 Ga0466716_238887_2365_3816 412
14 3300042618 Ga0466723_094954 Ga0466723_094954_6904_8280 412
15 3300002509 JGI24699J35502_11134214 JGI24699J35502_111342145 413
16 3300042611 Ga0466697_151232 Ga0466697_151232_795_2243 414
17 3300042598 Ga0466701_061376 Ga0466701_061376_611_1858 415
18 3300042611 Ga0466697_030728 Ga0466697_030728_275_1522 415
19 3300042598 Ga0466701_020502 Ga0466701_020502_4332_5582 416
20 3300042598 Ga0466701_069354 Ga0466701_069354_871_2121 416
21 3300042601 Ga0466707_105571 Ga0466707_105571_6508_7926 416
22 3300042601 Ga0466707_273436 Ga0466707_273436_1391_2839 416
23 3300042613 Ga0466710_126297 Ga0466710_126297_97_1347 416
24 3300042622 Ga0466731_008971 Ga0466731_008971_2027_3277 416
25 3300042649 Ga0466724_33645 Ga0466724_33645_2747_3997 416
26 3300010049 Ga0123356_10239034 Ga0123356_102390341 417
27 3300010167 Ga0123353_10049367 Ga0123353_100493673 417
28 3300010167 Ga0123353_10271365 Ga0123353_102713652 417
29 3300010167 Ga0123353_10379601 Ga0123353_103796012 417
30 3300042602 Ga0466713_044001 Ga0466713_044001_28302_29741 417
31 3300042612 Ga0466705_477179 Ga0466705_477179_1921_3204 417
32 3300042609 Ga0466722_006046 Ga0466722_006046_913_2286 420
33 3300042618 Ga0466723_059293 Ga0466723_059293_668_2068 420
34 3300002504 JGI24705J35276_12223232 JGI24705J35276_122232322 421
35 3300042643 Ga0466704_061148 Ga0466704_061148_1188_2588 422
36 3300042624 Ga0466735_154777 Ga0466735_154777_3779_5197 423
37 3300042590 Ga0466690_228138 Ga0466690_228138_20491_21927 424
38 iso_pr_bacteria 2998907766 2998910604 425
39 3300042624 Ga0466735_078531 Ga0466735_078531_66_1475 426
40 3300042655 Ga0466727_170756 Ga0466727_170756_1850_3298 426
41 3300042590 Ga0466690_087203 Ga0466690_087203_3130_4581 427
42 3300042602 Ga0466713_119093 Ga0466713_119093_13016_14461 427
43 2225789004 2227228034 2227663299 428
44 3300010882 Ga0123354_10137685 Ga0123354_101376853 428
45 3300042598 Ga0466701_010863 Ga0466701_010863_494_1942 428
46 3300042615 Ga0466711_045368 Ga0466711_045368_13308_14756 428
47 3300042619 Ga0466726_181310 Ga0466726_181310_6130_7578 428
48 3300042596 Ga0466696_246530 Ga0466696_246530_3496_4884 429
49 3300042606 Ga0466719_111332 Ga0466719_111332_12251_13693 429
50 3300000062 IMNBL1DRAFT_c0000802 IMNBL1DRAFT_00008022 430
51 3300002462 JGI24702J35022_10006559 JGI24702J35022_100065596 430
52 3300042600 Ga0466700_303542 Ga0466700_303542_12496_13944 431
53 3300042591 Ga0466692_151517 Ga0466692_151517_3823_5259 433
54 3300042596 Ga0466696_085038 Ga0466696_085038_318_1769 433
55 3300042655 Ga0466727_345918 Ga0466727_345918_1532_2947 433
56 3300042596 Ga0466696_085502 Ga0466696_085502_4039_5490 434
57 3300042643 Ga0466704_222354 Ga0466704_222354_13065_14456 434
58 3300042601 Ga0466707_087930 Ga0466707_087930_7032_8480 435
59 3300042601 Ga0466707_286883 Ga0466707_286883_1807_3192 436
60 3300009784 Ga0123357_10001908 Ga0123357_100019083 437
61 3300010882 Ga0123354_10003756 Ga0123354_100037568 437
62 3300042593 Ga0466691_093033 Ga0466691_093033_2787_4229 437
63 3300042621 Ga0466729_039119 Ga0466729_039119_15388_16836 437
64 3300042598 Ga0466701_098523 Ga0466701_098523_36900_38303 438
65 3300042619 Ga0466726_087706 Ga0466726_087706_342_1808 438
66 3300042617 Ga0466718_032068 Ga0466718_032068_630_2012 439
67 3300009784 Ga0123357_10003779 Ga0123357_100037798 440
68 3300010882 Ga0123354_10217727 Ga0123354_102177271 440
69 3300010882 Ga0123354_10018723 Ga0123354_100187233 441
70 3300042591 Ga0466692_165865 Ga0466692_165865_11826_13274 441
71 3300042601 Ga0466707_383728 Ga0466707_383728_12080_13534 441
72 3300042596 Ga0466696_328097 Ga0466696_328097_3308_4738 442
73 3300042602 Ga0466713_109474 Ga0466713_109474_1135_2583 442
74 3300042616 Ga0466715_192873 Ga0466715_192873_6951_8393 442
75 3300042621 Ga0466729_212035 Ga0466729_212035_8053_9471 442
76 3300042616 Ga0466715_403406 Ga0466715_403406_4303_5751 443
77 3300042601 Ga0466707_196186 Ga0466707_196186_6735_8183 444
78 3300042643 Ga0466704_295450 Ga0466704_295450_410_1858 444
79 3300042652 Ga0466708_189765 Ga0466708_189765_677_2098 444
80 3300009784 Ga0123357_10009748 Ga0123357_100097484 445
81 3300042596 Ga0466696_132281 Ga0466696_132281_3865_5265 447
82 3300010882 Ga0123354_10000043 Ga0123354_1000004367 448
83 3300042605 Ga0466716_395857 Ga0466716_395857_2063_3442 448
84 3300042615 Ga0466711_364135 Ga0466711_364135_94_1473 448
85 3300042605 Ga0466716_085091 Ga0466716_085091_4324_5703 449
86 3300042605 Ga0466716_424402 Ga0466716_424402_20020_21399 449
87 3300002504 JGI24705J35276_12237010 JGI24705J35276_122370107 450
88 3300042593 Ga0466691_179044 Ga0466691_179044_437_1885 450
89 3300009784 Ga0123357_10010638 Ga0123357_100106388 451
90 3300002504 JGI24705J35276_12232119 JGI24705J35276_122321194 452
91 3300009784 Ga0123357_10002874 Ga0123357_1000287411 452
92 3300042600 Ga0466700_391349 Ga0466700_391349_38454_39905 452
93 3300042599 Ga0466706_075896 Ga0466706_075896_226_1671 456
94 3300042652 Ga0466708_311886 Ga0466708_311886_5940_7397 456
95 3300010882 Ga0123354_10023390 Ga0123354_100233905 457
96 3300009784 Ga0123357_10098360 Ga0123357_100983602 458
97 3300042596 Ga0466696_399809 Ga0466696_399809_2449_3879 458
98 3300042605 Ga0466716_248815 Ga0466716_248815_3697_5076 459
99 3300042618 Ga0466723_236631 Ga0466723_236631_21472_22851 459
100 3300042590 Ga0466690_335963 Ga0466690_335963_67_1449 460
101 3300042602 Ga0466713_007402 Ga0466713_007402_46_1428 460
102 3300042603 Ga0466714_101031 Ga0466714_101031_27828_29210 460
103 3300042648 Ga0466709_004714 Ga0466709_004714_39_1421 460
104 3300009784 Ga0123357_10117947 Ga0123357_101179472 461
105 3300042612 Ga0466705_007870 Ga0466705_007870_22860_24245 461
106 3300042620 Ga0466728_202712 Ga0466728_202712_19760_21145 461
107 3300042655 Ga0466727_224853 Ga0466727_224853_13822_15273 462
108 3300005083 Ga0068305_10004729 Ga0068305_1000472911 463
109 3300042602 Ga0466713_050140 Ga0466713_050140_4323_5771 465
110 3300042636 Ga0466703_089004 Ga0466703_089004_13410_14858 465
111 3300042591 Ga0466692_085644 Ga0466692_085644_5267_6718 466
112 3300042616 Ga0466715_100049 Ga0466715_100049_21369_22814 467
113 3300042624 Ga0466735_032969 Ga0466735_032969_91_1563 467
114 3300042648 Ga0466709_111041 Ga0466709_111041_1688_3133 467
115 3300042652 Ga0466708_138945 Ga0466708_138945_405_1862 468
116 3300042643 Ga0466704_119159 Ga0466704_119159_12140_13585 469
117 3300042659 Ga0466733_164143 Ga0466733_164143_2390_3841 469
118 3300042591 Ga0466692_179942 Ga0466692_179942_70265_71713 470
119 3300042596 Ga0466696_235371 Ga0466696_235371_436_1887 470
120 3300010167 Ga0123353_10373771 Ga0123353_103737712 471
121 iso_pr_bacteria 2509276035 2509456243 471
122 3300042624 Ga0466735_218098 Ga0466735_218098_495_1913 472
123 3300042596 Ga0466696_329822 Ga0466696_329822_2508_3971 473
124 3300042609 Ga0466722_100835 Ga0466722_100835_6682_8127 473
125 3300042609 Ga0466722_229738 Ga0466722_229738_11569_13014 473
126 3300042601 Ga0466707_009633 Ga0466707_009633_21567_23027 474
127 3300042590 Ga0466690_056201 Ga0466690_056201_24320_25747 475
128 3300042636 Ga0466703_146643 Ga0466703_146643_485_1933 475
129 3300000062 IMNBL1DRAFT_c0000312 IMNBL1DRAFT_00003128 476
130 3300042618 Ga0466723_128730 Ga0466723_128730_8103_9533 476
131 3300042596 Ga0466696_394022 Ga0466696_394022_95503_96954 477
132 3300042601 Ga0466707_006434 Ga0466707_006434_1571_3013 480
133 3300042620 Ga0466728_030059 Ga0466728_030059_491_1933 480
134 3300042590 Ga0466690_369127 Ga0466690_369127_2508_3953 481
135 3300042612 Ga0466705_365178 Ga0466705_365178_3453_4898 481
136 3300042615 Ga0466711_034154 Ga0466711_034154_1687_3132 481
137 3300042615 Ga0466711_072653 Ga0466711_072653_4510_5955 481
138 3300042615 Ga0466711_169251 Ga0466711_169251_15850_17295 481
139 3300042615 Ga0466711_298234 Ga0466711_298234_9259_10704 481
140 3300042636 Ga0466703_040410 Ga0466703_040410_4652_6097 481
141 3300042636 Ga0466703_074379 Ga0466703_074379_14018_15463 481
142 3300042636 Ga0466703_190077 Ga0466703_190077_15263_16708 481
143 3300042602 Ga0466713_047392 Ga0466713_047392_5138_6586 482
144 3300042602 Ga0466713_123497 Ga0466713_123497_985_2433 482
145 3300042621 Ga0466729_077009 Ga0466729_077009_11389_12837 482
146 3300042643 Ga0466704_079126 Ga0466704_079126_2551_4002 483
147 3300042643 Ga0466704_097655 Ga0466704_097655_199_1650 483
148 3300042643 Ga0466704_110891 Ga0466704_110891_1436_2887 483
149 3300042643 Ga0466704_304995 Ga0466704_304995_4201_5652 483
150 3300042643 Ga0466704_367739 Ga0466704_367739_4996_6447 483
151 3300042643 Ga0466704_505644 Ga0466704_505644_434_1885 483
152 3300000062 IMNBL1DRAFT_c0004041 IMNBL1DRAFT_00040415 484
153 3300042636 Ga0466703_419148 Ga0466703_419148_479_1933 484
154 3300010167 Ga0123353_10377628 Ga0123353_103776282 485
155 3300042609 Ga0466722_148621 Ga0466722_148621_805_2262 485
156 3300042616 Ga0466715_081257 Ga0466715_081257_7657_9114 485
157 iso_pr_bacteria 2820778767 2820779886 485
158 iso_pr_bacteria 2940216256 2940217996 485
159 iso_pr_bacteria 2820757377 2820759396 486
160 3300042602 Ga0466713_048475 Ga0466713_048475_238_1701 487
161 3300005083 Ga0068305_10083512 Ga0068305_100835122 488
162 iso_pr_bacteria 2940199050 2940199183 488
163 iso_pr_bacteria 2940346213 2940346242 488
164 3300042620 Ga0466728_075600 Ga0466728_075600_11397_12875 492
165 3300041968 Ga0456237_0000006 Ga0456237_0000006_54902_56383 493
166 3300042620 Ga0466728_019578 Ga0466728_019578_11085_12566 493
167 iso_pr_bacteria 643348524 643423197 493
168 3300042620 Ga0466728_063056 Ga0466728_063056_51405_52895 496
169 3300042620 Ga0466728_404528 Ga0466728_404528_4636_6126 496
170 3300042605 Ga0466716_312373 Ga0466716_312373_4207_5709 500

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01098 FTSW_RODA_SPOVE Cell cycle protein 15 199 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.