Protein Family IF13492

Metagenome Isolate
430 Members
289 Samples
210 Scaffolds
235.7 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|641736255|641740887|
Length
282 aa
Sequence
MGGNNILPVKNAGRFCLIQNYDKIKSMAQRKLPSYRQTGGEERMQRRILVVDDEQPIADILKFNLEKEGYEVICAYDGGTAVELAFSEKPDLILLDLMLPVKDGMDVCREVRGKLNTPIIMLTAKDTEIDKVLGLEMGADDYVTKPFGTRELLARVKAHLRRQIKSEAAPEVAKEEPQGIRLDTLFIDTDMYVVYKDGDPLDLTHREFELIYYLAKHPSKVMTREHLLQAVWGYEYFGDVRTVDVTIRRLREKIETDPSKPEYIVTRRGLGYMMRSGKSGGF

πŸ“Š Sample Types

Isolate 50.9%
Metagenome 49.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 26.3%
Apidae 15.0%
Drosophilidae 10.5%
Termitidae 9.8%
Blattidae 4.1%
Scarabaeidae 3.8%
Kalotermitidae 3.8%
Tenebrionidae 3.4%
Halictidae 3.4%
Elmidae 2.6%
Pyralidae 2.3%
Rhinotermitidae 1.5%
Termopsidae 1.5%
Passalidae 1.1%
Formicidae 1.1%
Bombycidae 1.1%
Culicidae 0.8%
Armadillidiidae 0.8%
Noctuidae 0.8%
Dytiscidae 0.8%
Penaeidae 0.4%
Portunidae 0.4%
Curculionidae 0.4%
Rhaphidophoridae 0.4%
Euphausiidae 0.4%
Libellulidae 0.4%
Hydrophilidae 0.4%
Cerambycidae 0.4%
Eresidae 0.4%
Gomphidae 0.4%
Nephropidae 0.4%
Ocypodidae 0.4%
Calliphoridae 0.4%
Vespidae 0.4%
Hodotermitidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 400
Eukaryota 0
Viruses 0
Unclassified 30

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114555646 Enterococcus sp. DIV1094 Isolate
2 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
3 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
4 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
5 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
6 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
7 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
8 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
9 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
10 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
11 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
14 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
15 2627853628 Melissococcus plutonius 82 Isolate Apidae
16 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
17 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
18 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
19 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
20 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
21 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
22 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
23 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
24 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
25 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
26 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
27 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
28 8064008355 Heyndrickxia oleronia Isolate Unclassified
29 8082023105 Niallia sp. Man26 Isolate Penaeidae
30 2969145278 Bacillus cereus 29 Isolate Portunidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
33 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
34 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
35 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
36 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
37 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
38 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
39 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
40 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
41 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
42 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
43 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
44 2595698198 Melissococcus plutonius L9 Isolate Apidae
45 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
46 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
47 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
48 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
49 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
50 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
51 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
52 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
53 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
54 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
55 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
56 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
60 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
61 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
64 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
65 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
66 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
67 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
68 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
69 2864909992 Bacillus velezensis S00166 Isolate Elmidae
70 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
71 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
72 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
73 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
74 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
75 2595698199 Melissococcus plutonius 60 Isolate Apidae
76 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
77 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
78 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
79 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
80 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
81 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
82 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
83 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
84 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
85 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
86 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
87 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
88 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
89 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
90 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
91 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
92 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
93 8007237282 Enterococcus sp. DIV0212c Isolate
94 8017489919 Lactobacillus brevis EF Isolate Unclassified
95 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
96 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
97 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
98 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
99 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
100 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
101 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
102 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
103 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
104 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
105 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
106 3004719924 Lactobacillus sp. W8174 Isolate Apidae
107 8112490586 Staphylococcus muscae CCM 4175 Isolate
108 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
109 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
110 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
111 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
112 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
113 2537562000 Bacillus cereus HD73 Isolate Pyralidae
114 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
115 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
116 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
117 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
118 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
119 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
120 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
121 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
122 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
123 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
124 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
125 8108568626 Enterococcus sp. DIV1094 Isolate
126 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
127 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
128 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
129 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
130 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
131 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
132 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
133 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
134 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
135 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
136 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
137 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
138 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
139 2864895409 Bacillus aerius S00152 Isolate Elmidae
140 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
141 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
142 2916858470 Heyndrickxia oleronia Isolate Unclassified
143 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
144 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
145 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
146 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
147 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
148 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
149 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
150 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
151 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
152 2595698197 Melissococcus plutonius H6 Isolate Apidae
153 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
154 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
155 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
156 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
157 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
158 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
159 8022725327 Bacillus sp. SN10 Isolate Eresidae
160 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
161 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
162 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
163 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
164 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
165 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
166 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
167 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
168 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
169 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
170 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
171 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
172 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
173 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
174 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
175 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
176 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
177 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
178 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
179 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
180 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
181 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
182 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
183 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
184 2595698195 Melissococcus plutonius 119 Isolate Apidae
185 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
186 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
187 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
188 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
189 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
190 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
191 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
192 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
193 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
194 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
195 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
196 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
197 8007223943 Enterococcus sp. MSG2901 Isolate
198 8012112996 Staphylococcus muscae ATCC 49910 Isolate
199 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
200 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
201 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
202 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
203 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
204 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
205 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
206 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
207 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
208 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
209 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
210 2978778678 Bacillus cereus 25 Isolate Ocypodidae
211 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
212 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
213 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
214 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
215 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
216 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
217 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
218 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
219 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
220 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
221 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
222 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
223 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
224 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
225 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
226 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
227 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
228 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
229 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
230 2595698193 Melissococcus plutonius B5 Isolate Apidae
231 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
232 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
233 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
234 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
235 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
236 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
237 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
238 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
239 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
240 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
241 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
242 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
243 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
244 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
245 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
246 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
247 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
248 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
249 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
250 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
251 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
252 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
253 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
254 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
255 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
256 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
257 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
258 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
259 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
260 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
261 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
262 2864801025 Bacillus aerius S00042 Isolate Elmidae
263 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
264 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
265 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
266 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
267 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
268 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
269 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
270 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
271 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
272 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
273 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
274 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
275 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
276 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
277 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
278 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
279 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
280 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
281 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
282 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
283 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
284 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
285 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
286 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
287 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
288 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
289 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_2321 3300056814 Bacteria 16256
2 Ga0466715_267475 3300042616 Bacteria 78084
3 IMNBL1DRAFT_c0000598 3300000062 Bacteria 28960
4 IMNBL1DRAFT_c0013061 3300000062 Bacteria 3753
5 JGI24703J35330_11623053 3300002501 Bacteria 1461
6 Ga0123357_10224045 3300009784 Bacteria 2079
7 Ga0123355_10037424 3300009826 Bacteria 7890
8 Ga0123355_10068710 3300009826 Bacteria 5698
9 Ga0123356_10465102 3300010049 Bacteria 1415
10 Ga0123353_10042558 3300010167 Bacteria 7184
11 Ga0123353_10055776 3300010167 Bacteria 6322
12 Ga0160445_101243 3300012847 Bacteria 7689
13 Ga0255572_1001208 3300026175 Bacteria 38415
14 Ga0415639_009749 3300038395 Bacteria 20493
15 Ga0415639_058235 3300038395 Bacteria 6225
16 Ga0466735_089493 3300042624 Bacteria 2670
17 Ga0466725_016700 3300042654 Bacteria 1824
18 Ga0466707_414168 3300042601 Bacteria 25705
19 Ga0466719_517119 3300042606 Bacteria 1021
20 Ga0562379_0009 3300056790 Bacteria 1927879
21 Ga0562379_0035 3300056790 Bacteria 679259
22 Ga0562379_4241 3300056790 Bacteria 7699
23 Ga0562375_0057 3300056856 Bacteria 447120
24 Ga0562374_0143 3300057007 Bacteria 173981
25 Ga0562374_0186 3300057007 Unclassified 135189
26 Ga0562374_0303 3300057007 Unclassified 93348
27 Ga0466726_372855 3300042619 Bacteria 1939
28 Ga0123357_10066397 3300009784 Bacteria 4811
29 Ga0123357_10268609 3300009784 Bacteria 1787
30 Ga0123355_10015012 3300009826 Bacteria 12148
31 Ga0123355_10029474 3300009826 Bacteria 8884
32 Ga0123355_10252627 3300009826 Bacteria 2479
33 Ga0123355_10364985 3300009826 Bacteria 1898
34 Ga0123355_10502381 3300009826 Bacteria 1495
35 Ga0123355_10521536 3300009826 Bacteria 1453
36 Ga0123353_10167748 3300010167 Bacteria 3488
37 Ga0466693_394352 3300042592 Bacteria 1741
38 Ga0466697_252736 3300042611 Unclassified 1659
39 Ga0466724_54918 3300042649 Bacteria 5503
40 Ga0466706_110813 3300042599 Bacteria 17325
41 Ga0466722_048005 3300042609 Bacteria 1923
42 Ga0466733_209395 3300042659 Bacteria 8489
43 Ga0530661_000022 3300056564 Bacteria 194089
44 Ga0562377_0032 3300056842 Bacteria 719749
45 Ga0562374_0165 3300057007 Unclassified 152624
46 Ga0466711_437333 3300042615 Bacteria 1902
47 2227605177 2225789004 Bacteria 12323
48 IMNBL1DRAFT_c0003296 3300000062 Bacteria 10497
49 JGI24702J35022_10001022 3300002462 Bacteria 17516
50 JGI24702J35022_10002843 3300002462 Bacteria 10480
51 JGI24705J35276_12220619 3300002504 Unclassified 2280
52 Ga0068302_10014565 3300005071 Bacteria 5314
53 Ga0123355_10497986 3300009826 Bacteria 1505
54 Ga0123353_10052461 3300010167 Bacteria 6513
55 Ga0123353_10249228 3300010167 Bacteria 2752
56 Ga0466690_380404 3300042590 Bacteria 2415
57 Ga0466690_398342 3300042590 Bacteria 11708
58 Ga0466693_257359 3300042592 Bacteria 2308
59 Ga0466704_130710 3300042643 Bacteria 3829
60 Ga0466704_567071 3300042643 Unclassified 5947
61 Ga0466706_139548 3300042599 Bacteria 5004
62 Ga0466706_216995 3300042599 Bacteria 1097
63 Ga0466714_126800 3300042603 Bacteria 4902
64 Ga0466716_359933 3300042605 Bacteria 3352
65 Ga0466719_541131 3300042606 Bacteria 9048
66 Ga0562378_0674 3300056814 Unclassified 50623
67 Ga0562377_0018 3300056842 Bacteria 1087840
68 Ga0562375_0015 3300056856 Bacteria 1028412
69 Ga0562375_0188 3300056856 Bacteria 178390
70 Ga0562376_4907 3300056857 Unclassified 9937
71 Ga0466715_474279 3300042616 Bacteria 9744
72 Ga0466715_552953 3300042616 Bacteria 12941
73 Ga0466726_305593 3300042619 Bacteria 14036
74 Ga0466728_455520 3300042620 Bacteria 9482
75 JGI24702J35022_10051854 3300002462 Bacteria 2186
76 JGI24705J35276_12208339 3300002504 Bacteria 1770
77 JGI24705J35276_12235608 3300002504 Bacteria 6728
78 Ga0068305_10166261 3300005083 Bacteria 2732
79 Ga0074278_154531 3300005721 Unclassified 8802
80 Ga0105005_1103670 3300007505 Unclassified 2408
81 Ga0123355_10063447 3300009826 Bacteria 5958
82 Ga0123355_10652840 3300009826 Bacteria 1227
83 Ga0123353_10012256 3300010167 Bacteria 12168
84 Ga0123353_10031321 3300010167 Bacteria 8236
85 Ga0123353_10197328 3300010167 Bacteria 3171
86 Ga0123353_11295791 3300010167 Bacteria 946
87 Ga0123354_10200785 3300010882 Unclassified 2193
88 Ga0123354_10223904 3300010882 Bacteria 1989
89 Ga0160455_100978 3300012837 Bacteria 10361
90 Ga0466705_100624 3300042612 Bacteria 26262
91 Ga0466704_288241 3300042643 Bacteria 1113
92 Ga0466727_346481 3300042655 Bacteria 130939
93 Ga0466706_101186 3300042599 Bacteria 14190
94 Ga0466716_370072 3300042605 Bacteria 4756
95 Ga0562379_0033 3300056790 Bacteria 743383
96 Ga0562375_0211 3300056856 Bacteria 162868
97 Ga0562376_4997 3300056857 Unclassified 9638
98 Ga0562374_0010 3300057007 Bacteria 1930599
99 Ga0562374_0011 3300057007 Bacteria 1900075
100 Ga0466726_338088 3300042619 Bacteria 7910
101 Ga0466729_043508 3300042621 Bacteria 9393
102 HBC_ctgsDRAFT_1000060 3300000333 Bacteria 27539
103 JGI24695J34938_10065846 3300002450 Unclassified 1529
104 Ga0072941_1044336 3300005201 Bacteria 15623
105 Ga0074278_113112 3300005721 Unclassified 3433
106 Ga0105005_1007168 3300007505 Bacteria 2503
107 Ga0123355_10000703 3300009826 Bacteria 45383
108 Ga0123356_10988702 3300010049 Bacteria 1012
109 Ga0123356_11379081 3300010049 Bacteria 866
110 Ga0123353_10039180 3300010167 Bacteria 7457
111 Ga0123353_10231969 3300010167 Bacteria 2877
112 Ga0123354_10099308 3300010882 Bacteria 3951
113 Ga0123354_10270647 3300010882 Unclassified 1673
114 Ga0160466_102951 3300012809 Bacteria 3022
115 Ga0466696_424705 3300042596 Bacteria 1285
116 Ga0466704_322254 3300042643 Bacteria 25270
117 Ga0466725_117025 3300042654 Bacteria 6063
118 Ga0466706_006037 3300042599 Unclassified 2141
119 Ga0466706_152143 3300042599 Bacteria 5079
120 Ga0466714_133724 3300042603 Bacteria 18444
121 Ga0530661_005362 3300056564 Bacteria 3785
122 Ga0562379_0005 3300056790 Bacteria 2649770
123 Ga0562379_0006 3300056790 Bacteria 2459409
124 Ga0562377_0641 3300056842 Bacteria 52294
125 Ga0562376_0004 3300056857 Bacteria 3026470
126 2227080776 2225789004 Unclassified 183011
127 IMNBL1DRAFT_c0000229 3300000062 Bacteria 49083
128 Ga0072940_1264544 3300005200 Bacteria 6541
129 Ga0105005_1112206 3300007505 Unclassified 2426
130 Ga0123357_10427562 3300009784 Bacteria 1174
131 Ga0123355_10091961 3300009826 Unclassified 4807
132 Ga0123355_10127593 3300009826 Unclassified 3927
133 Ga0123356_10045902 3300010049 Bacteria 4065
134 Ga0123353_10000587 3300010167 Bacteria 44450
135 Ga0123353_10191314 3300010167 Bacteria 3229
136 Ga0123353_10296464 3300010167 Bacteria 2472
137 Ga0123353_10813726 3300010167 Bacteria 1287
138 Ga0123353_11179726 3300010167 Bacteria 1007
139 Ga0123354_10309359 3300010882 Bacteria 1479
140 Ga0415639_076623 3300038395 Bacteria 3434
141 Ga0466734_140079 3300042623 Bacteria 3531
142 Ga0466724_40032 3300042649 Bacteria 8701
143 Ga0466727_215734 3300042655 Bacteria 27407
144 Ga0466701_021689 3300042598 Bacteria 144748
145 Ga0466706_138228 3300042599 Unclassified 3002
146 Ga0466707_126663 3300042601 Bacteria 75061
147 Ga0466707_332300 3300042601 Bacteria 1724
148 Ga0466713_155845 3300042602 Unclassified 168359
149 Ga0466697_036687 3300042611 Bacteria 2000
150 Ga0562379_0011 3300056790 Bacteria 1623141
151 Ga0562379_0039 3300056790 Bacteria 641946
152 Ga0562379_0429 3300056790 Bacteria 90757
153 Ga0562375_0729 3300056856 Bacteria 58270
154 Ga0466711_193898 3300042615 Bacteria 3839
155 Ga0466715_637226 3300042616 Bacteria 117449
156 AglaG_contig22322 2084038013 Bacteria 9147
157 2227502402 2225789004 Bacteria 19221
158 IMNBGM34_c000648 3300000036 Bacteria 8543
159 JGI24700J35501_10926977 3300002508 Unclassified 6550
160 Ga0063521_1000086 3300003973 Bacteria 78064
161 Ga0063521_1012261 3300003973 Unclassified 2068
162 Ga0068305_10268814 3300005083 Bacteria 2687
163 Ga0123355_10031403 3300009826 Bacteria 8618
164 Ga0123355_10191652 3300009826 Bacteria 3009
165 Ga0123355_10239634 3300009826 Bacteria 2572
166 Ga0123356_10007093 3300010049 Bacteria 11231
167 Ga0123353_10042601 3300010167 Bacteria 7181
168 Ga0123354_10100444 3300010882 Bacteria 3915
169 Ga0160454_100033 3300012798 Bacteria 266490
170 Ga0160471_102416 3300012812 Bacteria 3113
171 Ga0466693_273738 3300042592 Bacteria 1280
172 Ga0466731_002319 3300042622 Bacteria 1200
173 Ga0466702_244404 3300042635 Bacteria 50690
174 Ga0466706_163402 3300042599 Bacteria 3931
175 Ga0466719_442117 3300042606 Bacteria 1740
176 Ga0466697_031650 3300042611 Bacteria 3001
177 Ga0466733_027686 3300042659 Bacteria 32514
178 Ga0562379_1501 3300056790 Unclassified 26182
179 Ga0562376_2169 3300056857 Bacteria 24570
180 Ga0562374_0008 3300057007 Bacteria 1999653
181 Ga0562374_0520 3300057007 Bacteria 62981
182 2211957112 2209111004 Unclassified 18391
183 JGI24702J35022_10153408 3300002462 Bacteria 1294
184 JGI24703J35330_11748707 3300002501 Bacteria 27424
185 Ga0068302_10052571 3300005071 Unclassified 6273
186 Ga0074278_119900 3300005721 Unclassified 4900
187 Ga0104047_1120807 3300007088 Bacteria 1348
188 Ga0105005_1117592 3300007505 Unclassified 2431
189 Ga0123356_10236486 3300010049 Bacteria 1895
190 Ga0123356_10447408 3300010049 Bacteria 1439
191 Ga0123356_10514587 3300010049 Bacteria 1354
192 Ga0123353_10103457 3300010167 Bacteria 4590
193 Ga0123353_10190037 3300010167 Bacteria 3242
194 Ga0123353_10290140 3300010167 Bacteria 2505
195 Ga0123354_10151323 3300010882 Bacteria 2810
196 Ga0123354_10198454 3300010882 Bacteria 2216
197 Ga0160464_103214 3300012805 Bacteria 2463
198 Ga0160441_100217 3300012825 Bacteria 57415
199 Ga0415639_064670 3300038395 Bacteria 2136
200 Ga0415639_105292 3300038395 Bacteria 3438
201 Ga0466692_003593 3300042591 Bacteria 3777
202 Ga0466693_000112 3300042592 Bacteria 4099
203 Ga0466705_127490 3300042612 Bacteria 6710
204 Ga0466730_095391 3300042625 Unclassified 4961
205 Ga0466703_088727 3300042636 Bacteria 8092
206 Ga0466700_079203 3300042600 Bacteria 57895
207 Ga0466719_166180 3300042606 Bacteria 1544
208 Ga0466722_040195 3300042609 Bacteria 4739
209 Ga0466722_045557 3300042609 Bacteria 252817
210 Ga0466697_011659 3300042611 Bacteria 4229

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_064670 Ga0415639_064670_316_990 224
2 2225789004 2227605177 2228173568 226
3 3300000036 IMNBGM34_c000648 IMNBGM34_00064810 227
4 3300010167 Ga0123353_10167748 Ga0123353_101677484 227
5 3300042612 Ga0466705_127490 Ga0466705_127490_3835_4518 227
6 3300042643 Ga0466704_567071 Ga0466704_567071_3751_4434 227
7 iso_pr_bacteria 2820606014 2820606821 227
8 3300002504 JGI24705J35276_12208339 JGI24705J35276_122083392 228
9 3300002504 JGI24705J35276_12235608 JGI24705J35276_122356086 228
10 3300005200 Ga0072940_1264544 Ga0072940_12645442 228
11 3300009826 Ga0123355_10037424 Ga0123355_100374243 228
12 3300009826 Ga0123355_10068710 Ga0123355_100687104 228
13 3300010049 Ga0123356_10988702 Ga0123356_109887022 228
14 3300010167 Ga0123353_10103457 Ga0123353_101034574 228
15 3300010882 Ga0123354_10270647 Ga0123354_102706472 228
16 3300042592 Ga0466693_000112 Ga0466693_000112_2725_3411 228
17 3300042619 Ga0466726_372855 Ga0466726_372855_353_1039 228
18 iso_pr_bacteria 2820211246 2820213568 228
19 iso_pr_bacteria 2820594669 2820596682 228
20 3300005201 Ga0072941_1044336 Ga0072941_10443368 229
21 3300009826 Ga0123355_10015012 Ga0123355_100150123 229
22 3300010049 Ga0123356_10007093 Ga0123356_100070936 229
23 3300010049 Ga0123356_10465102 Ga0123356_104651022 229
24 3300010049 Ga0123356_11379081 Ga0123356_113790811 229
25 3300010167 Ga0123353_10039180 Ga0123353_100391805 229
26 3300010167 Ga0123353_10042558 Ga0123353_100425585 229
27 3300010167 Ga0123353_10052461 Ga0123353_100524614 229
28 3300010167 Ga0123353_11295791 Ga0123353_112957911 229
29 3300038395 Ga0415639_009749 Ga0415639_009749_4615_5304 229
30 3300042609 Ga0466722_045557 Ga0466722_045557_190973_191662 229
31 3300042616 Ga0466715_552953 Ga0466715_552953_9205_9894 229
32 3300042621 Ga0466729_043508 Ga0466729_043508_360_1049 229
33 iso_pr_bacteria 650716050 650845528 229
34 3300002462 JGI24702J35022_10002843 JGI24702J35022_100028437 230
35 3300002462 JGI24702J35022_10153408 JGI24702J35022_101534082 230
36 3300009784 Ga0123357_10066397 Ga0123357_100663979 230
37 3300009826 Ga0123355_10521536 Ga0123355_105215361 230
38 3300010167 Ga0123353_10012256 Ga0123353_100122566 230
39 3300010167 Ga0123353_10191314 Ga0123353_101913143 230
40 3300010167 Ga0123353_10197328 Ga0123353_101973283 230
41 3300010167 Ga0123353_10231969 Ga0123353_102319693 230
42 3300010167 Ga0123353_10290140 Ga0123353_102901404 230
43 3300010882 Ga0123354_10100444 Ga0123354_101004443 230
44 3300010882 Ga0123354_10309359 Ga0123354_103093592 230
45 3300038395 Ga0415639_058235 Ga0415639_058235_3321_4013 230
46 3300038395 Ga0415639_076623 Ga0415639_076623_1732_2424 230
47 3300038395 Ga0415639_105292 Ga0415639_105292_99_791 230
48 3300042601 Ga0466707_332300 Ga0466707_332300_631_1323 230
49 3300042609 Ga0466722_048005 Ga0466722_048005_1083_1775 230
50 3300042615 Ga0466711_193898 Ga0466711_193898_244_936 230
51 3300042654 Ga0466725_016700 Ga0466725_016700_198_890 230
52 iso_pr_bacteria 2820333861 2820334043 230
53 iso_pr_bacteria 2820641689 2820642988 230
54 3300010167 Ga0123353_10296464 Ga0123353_102964642 231
55 3300042592 Ga0466693_257359 Ga0466693_257359_1080_1799 231
56 iso_pr_bacteria 2820249082 2820249621 231
57 iso_pr_bacteria 2820416776 2820417916 231
58 iso_pr_bacteria 2820487239 2820488112 231
59 2225789004 2227502402 2227986470 232
60 3300000062 IMNBL1DRAFT_c0000229 IMNBL1DRAFT_000022931 232
61 3300010167 Ga0123353_10042601 Ga0123353_100426011 232
62 3300010167 Ga0123353_10190037 Ga0123353_101900374 232
63 3300042603 Ga0466714_133724 Ga0466714_133724_13021_13719 232
64 3300042611 Ga0466697_036687 Ga0466697_036687_222_920 232
65 3300042654 Ga0466725_117025 Ga0466725_117025_1106_1804 232
66 iso_pr_bacteria 2820683647 2820684942 232
67 2225789004 2227080776 2227452015 233
68 3300000062 IMNBL1DRAFT_c0000598 IMNBL1DRAFT_000059831 233
69 3300002462 JGI24702J35022_10001022 JGI24702J35022_100010222 233
70 3300005083 Ga0068305_10268814 Ga0068305_102688143 233
71 3300009826 Ga0123355_10191652 Ga0123355_101916522 233
72 3300010049 Ga0123356_10514587 Ga0123356_105145872 233
73 3300010167 Ga0123353_10000587 Ga0123353_100005878 233
74 3300042599 Ga0466706_110813 Ga0466706_110813_2608_3309 233
75 3300042599 Ga0466706_138228 Ga0466706_138228_22_723 233
76 3300042599 Ga0466706_139548 Ga0466706_139548_3166_3867 233
77 3300042601 Ga0466707_414168 Ga0466707_414168_11673_12374 233
78 3300042602 Ga0466713_155845 Ga0466713_155845_81727_82428 233
79 3300042619 Ga0466726_305593 Ga0466726_305593_9618_10319 233
80 3300042643 Ga0466704_288241 Ga0466704_288241_146_847 233
81 3300042649 Ga0466724_54918 Ga0466724_54918_217_918 233
82 3300042655 Ga0466727_346481 Ga0466727_346481_17791_18492 233
83 3300056790 Ga0562379_0006 Ga0562379_0006_627212_627913 233
84 3300056790 Ga0562379_0011 Ga0562379_0011_1004037_1004738 233
85 3300056790 Ga0562379_4241 Ga0562379_4241_1679_2380 233
86 3300056814 Ga0562378_0674 Ga0562378_0674_47192_47893 233
87 3300056814 Ga0562378_2321 Ga0562378_2321_12980_13681 233
88 3300056842 Ga0562377_0032 Ga0562377_0032_290318_291019 233
89 3300056857 Ga0562376_0004 Ga0562376_0004_2615711_2616412 233
90 3300056857 Ga0562376_4907 Ga0562376_4907_5856_6557 233
91 3300057007 Ga0562374_0008 Ga0562374_0008_477340_478041 233
92 3300057007 Ga0562374_0010 Ga0562374_0010_17848_18549 233
93 3300057007 Ga0562374_0165 Ga0562374_0165_130160_130861 233
94 3300057007 Ga0562374_0520 Ga0562374_0520_44554_45255 233
95 iso_pr_bacteria 2595698190 2596206218 233
96 iso_pr_bacteria 2595698193 2596211629 233
97 iso_pr_bacteria 2595698194 2596213350 233
98 iso_pr_bacteria 2595698195 2596215246 233
99 iso_pr_bacteria 2595698196 2596217130 233
100 iso_pr_bacteria 2595698197 2596218968 233
101 iso_pr_bacteria 2595698198 2596220799 233
102 iso_pr_bacteria 2595698199 2596222611 233
103 iso_pr_bacteria 2627853628 2628280936 233
104 iso_pr_bacteria 2740892557 2743949780 233
105 iso_pr_bacteria 2820209022 2820209712 233
106 iso_pr_bacteria 2820236043 2820237498 233
107 iso_pr_bacteria 2850695442 2850698102 233
108 iso_pr_bacteria 2864985977 2864987393 233
109 iso_pr_bacteria 2878857142 2878858418 233
110 iso_pr_bacteria 2917496769 2917497357 233
111 iso_pr_bacteria 2940218408 2940219101 233
112 iso_pr_bacteria 2940261461 2940262010 233
113 iso_pr_bacteria 8012112996 8012114502 233
114 iso_pr_bacteria 8012942269 8012944868 233
115 iso_pr_bacteria 8112490586 8112490944 233
116 3300002508 JGI24700J35501_10926977 JGI24700J35501_109269772 234
117 3300003973 Ga0063521_1012261 Ga0063521_10122612 234
118 3300007088 Ga0104047_1120807 Ga0104047_11208073 234
119 3300009784 Ga0123357_10427562 Ga0123357_104275622 234
120 3300009826 Ga0123355_10502381 Ga0123355_105023812 234
121 3300010167 Ga0123353_11179726 Ga0123353_111797261 234
122 3300010882 Ga0123354_10151323 Ga0123354_101513232 234
123 3300026175 Ga0255572_1001208 Ga0255572_100120820 234
124 3300042592 Ga0466693_273738 Ga0466693_273738_459_1163 234
125 3300042599 Ga0466706_006037 Ga0466706_006037_373_1077 234
126 3300042599 Ga0466706_163402 Ga0466706_163402_1246_1950 234
127 3300042599 Ga0466706_216995 Ga0466706_216995_91_795 234
128 3300042606 Ga0466719_166180 Ga0466719_166180_223_927 234
129 3300042606 Ga0466719_541131 Ga0466719_541131_2718_3422 234
130 3300042609 Ga0466722_040195 Ga0466722_040195_2441_3145 234
131 3300042619 Ga0466726_338088 Ga0466726_338088_276_980 234
132 3300056790 Ga0562379_0005 Ga0562379_0005_359561_360265 234
133 3300056790 Ga0562379_0009 Ga0562379_0009_1758948_1759652 234
134 3300056790 Ga0562379_0011 Ga0562379_0011_1474354_1475058 234
135 3300056790 Ga0562379_0033 Ga0562379_0033_444518_445222 234
136 3300056790 Ga0562379_0035 Ga0562379_0035_307073_307777 234
137 3300056790 Ga0562379_0039 Ga0562379_0039_243954_244658 234
138 3300056790 Ga0562379_0429 Ga0562379_0429_41059_41763 234
139 3300056790 Ga0562379_1501 Ga0562379_1501_19804_20508 234
140 3300056842 Ga0562377_0018 Ga0562377_0018_233091_233795 234
141 3300056842 Ga0562377_0641 Ga0562377_0641_38749_39453 234
142 3300056856 Ga0562375_0015 Ga0562375_0015_891413_892117 234
143 3300056856 Ga0562375_0057 Ga0562375_0057_281649_282353 234
144 3300056856 Ga0562375_0188 Ga0562375_0188_137252_137956 234
145 3300056856 Ga0562375_0211 Ga0562375_0211_97212_97916 234
146 3300056856 Ga0562375_0729 Ga0562375_0729_29420_30124 234
147 3300056857 Ga0562376_2169 Ga0562376_2169_20673_21377 234
148 3300056857 Ga0562376_4997 Ga0562376_4997_3252_3956 234
149 3300057007 Ga0562374_0011 Ga0562374_0011_762075_762779 234
150 3300057007 Ga0562374_0143 Ga0562374_0143_168643_169347 234
151 3300057007 Ga0562374_0186 Ga0562374_0186_129852_130556 234
152 iso_pr_bacteria 2563367190 2565787809 234
153 iso_pr_bacteria 2585428141 2588053301 234
154 iso_pr_bacteria 2622736579 2623393045 234
155 iso_pr_bacteria 2775507073 2777016519 234
156 iso_pr_bacteria 2820459456 2820459683 234
157 iso_pr_bacteria 2825804107 2825804656 234
158 iso_pr_bacteria 2873581347 2873583068 234
159 iso_pr_bacteria 2873632256 2873632739 234
160 iso_pr_bacteria 2890957088 2890958745 234
161 iso_pr_bacteria 2896402965 2896403489 234
162 iso_pr_bacteria 643886085 644682816 234
163 iso_pr_bacteria 643886087 644670437 234
164 iso_pr_bacteria 643886091 644651500 234
165 iso_pr_bacteria 647533136 647748376 234
166 iso_pr_bacteria 8007211731 8007213299 234
167 iso_pr_bacteria 8007215774 8007217532 234
168 iso_pr_bacteria 8007220153 8007221360 234
169 iso_pr_bacteria 8007223943 8007224019 234
170 iso_pr_bacteria 8007237282 8007238894 234
171 iso_pr_bacteria 8012939035 8012940679 234
172 iso_pr_bacteria 8018750880 8018751243 234
173 iso_pr_bacteria 8018754795 8018757131 234
174 iso_pr_bacteria 8018794549 8018795593 234
175 iso_pr_bacteria 8018798118 8018801256 234
176 iso_pr_bacteria 8018802046 8018805402 234
177 iso_pr_bacteria 8038268975 8038271890 234
178 iso_pr_bacteria 8077780672 8077781715 234
179 iso_pr_bacteria 8108568626 8108569285 234
180 iso_pr_bacteria 8108576847 8108577577 234
181 iso_pr_bacteria 8114537524 8114537737 234
182 iso_pr_bacteria 8114541043 8114542113 234
183 iso_pr_bacteria 8114544644 8114544712 234
184 iso_pr_bacteria 8114549044 8114549774 234
185 iso_pr_bacteria 8114555646 8114556305 234
186 2084038013 AglaG_contig22322 AglaG_02026870 235
187 3300000333 HBC_ctgsDRAFT_1000060 HBC_ctgsDRAFT_100006022 235
188 3300002462 JGI24702J35022_10051854 JGI24702J35022_100518542 235
189 3300005071 Ga0068302_10052571 Ga0068302_100525714 235
190 3300009784 Ga0123357_10224045 Ga0123357_102240452 235
191 3300009826 Ga0123355_10091961 Ga0123355_100919611 235
192 3300009826 Ga0123355_10127593 Ga0123355_101275933 235
193 3300009826 Ga0123355_10239634 Ga0123355_102396343 235
194 3300009826 Ga0123355_10364985 Ga0123355_103649852 235
195 3300010049 Ga0123356_10236486 Ga0123356_102364862 235
196 3300010167 Ga0123353_10031321 Ga0123353_100313216 235
197 3300042591 Ga0466692_003593 Ga0466692_003593_2675_3382 235
198 3300042596 Ga0466696_424705 Ga0466696_424705_329_1036 235
199 3300042599 Ga0466706_152143 Ga0466706_152143_2278_2985 235
200 3300042600 Ga0466700_079203 Ga0466700_079203_48218_48925 235
201 3300042606 Ga0466719_517119 Ga0466719_517119_276_983 235
202 3300042611 Ga0466697_031650 Ga0466697_031650_89_796 235
203 3300042611 Ga0466697_252736 Ga0466697_252736_163_870 235
204 3300042616 Ga0466715_267475 Ga0466715_267475_66266_66973 235
205 3300042622 Ga0466731_002319 Ga0466731_002319_100_807 235
206 3300042625 Ga0466730_095391 Ga0466730_095391_2497_3204 235
207 3300057007 Ga0562374_0303 Ga0562374_0303_60879_61586 235
208 iso_pr_bacteria 2537562000 2539437871 235
209 iso_pr_bacteria 2558860143 2559000662 235
210 iso_pr_bacteria 2576861670 2579167162 235
211 iso_pr_bacteria 2597490293 2598965473 235
212 iso_pr_bacteria 2675903377 2677723954 235
213 iso_pr_bacteria 2690315820 2691199649 235
214 iso_pr_bacteria 2718218475 2721606435 235
215 iso_pr_bacteria 2728369362 2730149295 235
216 iso_pr_bacteria 2770939318 2771019141 235
217 iso_pr_bacteria 2822232166 2822233533 235
218 iso_pr_bacteria 2822450720 2822453592 235
219 iso_pr_bacteria 2834540479 2834541493 235
220 iso_pr_bacteria 2864782175 2864786320 235
221 iso_pr_bacteria 2864801025 2864801983 235
222 iso_pr_bacteria 2864816158 2864820592 235
223 iso_pr_bacteria 2864895409 2864895469 235
224 iso_pr_bacteria 2873584433 2873584640 235
225 iso_pr_bacteria 2881375749 2881377701 235
226 iso_pr_bacteria 2881902429 2881902495 235
227 iso_pr_bacteria 2912849059 2912854735 235
228 iso_pr_bacteria 2916873227 2916878171 235
229 iso_pr_bacteria 2923762712 2923763180 235
230 iso_pr_bacteria 2936628749 2936629959 235
231 iso_pr_bacteria 2937236879 2937238248 235
232 iso_pr_bacteria 2957623355 2957626563 235
233 iso_pr_bacteria 2960772748 2960772820 235
234 iso_pr_bacteria 2964739456 2964741120 235
235 iso_pr_bacteria 2964749277 2964752221 235
236 iso_pr_bacteria 2964765680 2964767209 235
237 iso_pr_bacteria 2964775400 2964776893 235
238 iso_pr_bacteria 2964778705 2964780220 235
239 iso_pr_bacteria 2967802344 2967805305 235
240 iso_pr_bacteria 2967825073 2967827658 235
241 iso_pr_bacteria 2969145278 2969146459 235
242 iso_pr_bacteria 2970199020 2970201723 235
243 iso_pr_bacteria 2970225615 2970228618 235
244 iso_pr_bacteria 2970254690 2970257271 235
245 iso_pr_bacteria 2977592972 2977594260 235
246 iso_pr_bacteria 2977596371 2977598373 235
247 iso_pr_bacteria 2977622177 2977622499 235
248 iso_pr_bacteria 2977628635 2977630195 235
249 iso_pr_bacteria 2977635137 2977636757 235
250 iso_pr_bacteria 2977653127 2977653429 235
251 iso_pr_bacteria 2978778678 2978778791 235
252 iso_pr_bacteria 643886090 644664389 235
253 iso_pr_bacteria 8002299145 8002300067 235
254 iso_pr_bacteria 8002304686 8002306112 235
255 iso_pr_bacteria 8002519755 8002523496 235
256 iso_pr_bacteria 8022725327 8022727847 235
257 iso_pr_bacteria 8022781829 8022787660 235
258 iso_pr_bacteria 8043041867 8043044723 235
259 iso_pr_bacteria 8061039349 8061040198 235
260 iso_pr_bacteria 8061045771 8061050485 235
261 iso_pr_bacteria 8061100935 8061104280 235
262 iso_pr_bacteria 8066790652 8066792300 235
263 iso_pr_bacteria 8066792404 8066793811 235
264 iso_pr_bacteria 8066794103 8066794470 235
265 iso_pr_bacteria 8066795793 8066797487 235
266 iso_pr_bacteria 8066797744 8066799150 235
267 iso_pr_bacteria 8066799369 8066800743 235
268 iso_pr_bacteria 8066802609 8066804075 235
269 2209111004 2211957112 2211986382 236
270 3300000062 IMNBL1DRAFT_c0003296 IMNBL1DRAFT_00032967 236
271 3300000062 IMNBL1DRAFT_c0013061 IMNBL1DRAFT_00130613 236
272 3300003973 Ga0063521_1000086 Ga0063521_100008643 236
273 3300007505 Ga0105005_1117592 Ga0105005_11175922 236
274 3300009826 Ga0123355_10063447 Ga0123355_100634473 236
275 3300010882 Ga0123354_10200785 Ga0123354_102007852 236
276 3300010882 Ga0123354_10223904 Ga0123354_102239042 236
277 3300042592 Ga0466693_394352 Ga0466693_394352_22_732 236
278 3300042599 Ga0466706_101186 Ga0466706_101186_13268_13978 236
279 3300042603 Ga0466714_126800 Ga0466714_126800_2453_3163 236
280 3300042605 Ga0466716_359933 Ga0466716_359933_1096_1839 236
281 3300042611 Ga0466697_011659 Ga0466697_011659_1710_2420 236
282 3300042659 Ga0466733_209395 Ga0466733_209395_5900_6610 236
283 iso_pr_bacteria 2576861701 2579269824 236
284 iso_pr_bacteria 2731957677 2732688059 236
285 iso_pr_bacteria 2767802234 2769332744 236
286 iso_pr_bacteria 2791355481 2794426053 236
287 iso_pr_bacteria 2820380671 2820382508 236
288 iso_pr_bacteria 2834951433 2834953977 236
289 iso_pr_bacteria 2852431164 2852433455 236
290 iso_pr_bacteria 2864909992 2864912477 236
291 iso_pr_bacteria 2864981449 2864985786 236
292 iso_pr_bacteria 2877522083 2877522131 236
293 iso_pr_bacteria 2905310146 2905310811 236
294 iso_pr_bacteria 2916858470 2916858927 236
295 iso_pr_bacteria 2997944163 2997944550 236
296 iso_pr_bacteria 8064008355 8064013868 236
297 iso_pr_bacteria 8082023105 8082027114 236
298 3300002501 JGI24703J35330_11748707 JGI24703J35330_1174870715 237
299 3300010049 Ga0123356_10447408 Ga0123356_104474082 237
300 3300042590 Ga0466690_380404 Ga0466690_380404_199_912 237
301 3300042601 Ga0466707_126663 Ga0466707_126663_11511_12224 237
302 3300042606 Ga0466719_442117 Ga0466719_442117_608_1321 237
303 3300042612 Ga0466705_100624 Ga0466705_100624_1552_2265 237
304 3300042616 Ga0466715_637226 Ga0466715_637226_62949_63662 237
305 3300042636 Ga0466703_088727 Ga0466703_088727_6927_7640 237
306 3300042655 Ga0466727_215734 Ga0466727_215734_2200_2913 237
307 3300056564 Ga0530661_000022 Ga0530661_000022_67134_67847 237
308 iso_pr_bacteria 2524614537 2524836074 237
309 iso_pr_bacteria 2651870343 2654486740 237
310 iso_pr_bacteria 2751185832 2753512293 237
311 iso_pr_bacteria 2820362221 2820363751 237
312 iso_pr_bacteria 2820693137 2820693348 237
313 iso_pr_bacteria 2843246524 2843246632 237
314 iso_pr_bacteria 2852123468 2852127217 237
315 iso_pr_bacteria 2855361764 2855365498 237
316 iso_pr_bacteria 2900804455 2900804489 237
317 iso_pr_bacteria 2902668162 2902669600 237
318 3300002450 JGI24695J34938_10065846 JGI24695J34938_100658462 238
319 3300002501 JGI24703J35330_11623053 JGI24703J35330_116230531 238
320 3300002504 JGI24705J35276_12220619 JGI24705J35276_122206192 238
321 3300005083 Ga0068305_10166261 Ga0068305_101662612 238
322 3300009826 Ga0123355_10652840 Ga0123355_106528402 238
323 3300010167 Ga0123353_10249228 Ga0123353_102492282 238
324 3300010167 Ga0123353_10813726 Ga0123353_108137262 238
325 3300010882 Ga0123354_10099308 Ga0123354_100993083 238
326 3300012812 Ga0160471_102416 Ga0160471_1024164 238
327 3300056564 Ga0530661_005362 Ga0530661_005362_2004_2720 238
328 iso_pr_bacteria 2645727721 2646683636 238
329 iso_pr_bacteria 2684622911 2686072877 238
330 iso_pr_bacteria 2684622912 2686074756 238
331 iso_pr_bacteria 2684622913 2686076388 238
332 iso_pr_bacteria 2684622914 2686078394 238
333 iso_pr_bacteria 2756170272 2756776163 238
334 iso_pr_bacteria 2758568501 2760244490 238
335 iso_pr_bacteria 2758568502 2760246171 238
336 iso_pr_bacteria 2758568503 2760247832 238
337 iso_pr_bacteria 2758568504 2760249496 238
338 iso_pr_bacteria 2758568505 2760251147 238
339 iso_pr_bacteria 2758568506 2760252834 238
340 iso_pr_bacteria 2758568507 2760254525 238
341 iso_pr_bacteria 2758568508 2760256224 238
342 iso_pr_bacteria 2758568509 2760257923 238
343 iso_pr_bacteria 2758568510 2760259626 238
344 iso_pr_bacteria 2758568511 2760261308 238
345 iso_pr_bacteria 2758568512 2760263077 238
346 iso_pr_bacteria 2758568513 2760264873 238
347 iso_pr_bacteria 2758568514 2760266746 238
348 iso_pr_bacteria 2758568515 2760268794 238
349 iso_pr_bacteria 2758568558 2760423836 238
350 iso_pr_bacteria 2785510748 2785746420 238
351 iso_pr_bacteria 2799112220 2799190533 238
352 iso_pr_bacteria 2799112229 2799229547 238
353 iso_pr_bacteria 2799112230 2799230677 238
354 iso_pr_bacteria 2814123166 2815023410 238
355 iso_pr_bacteria 2851410423 2851410560 238
356 iso_pr_bacteria 2877513988 2877514116 238
357 iso_pr_bacteria 2882334426 2882335799 238
358 iso_pr_bacteria 2896843662 2896845478 238
359 iso_pr_bacteria 2912324399 2912324490 238
360 iso_pr_bacteria 2958885890 2958885968 238
361 iso_pr_bacteria 2961465228 2961465305 238
362 iso_pr_bacteria 2961515617 2961515747 238
363 iso_pr_bacteria 2968368220 2968368796 238
364 iso_pr_bacteria 2971062614 2971064103 238
365 iso_pr_bacteria 2979949929 2979950041 238
366 iso_pr_bacteria 3004719924 3004720966 238
367 iso_pr_bacteria 8004832522 8004832600 238
368 iso_pr_bacteria 8017440191 8017440306 238
369 iso_pr_bacteria 8017462664 8017462811 238
370 iso_pr_bacteria 8017489919 8017489985 238
371 iso_pr_bacteria 8017536074 8017536197 238
372 3300005721 Ga0074278_113112 Ga0074278_1131123 239
373 3300005721 Ga0074278_119900 Ga0074278_1199002 239
374 3300005721 Ga0074278_154531 Ga0074278_1545319 239
375 3300009826 Ga0123355_10031403 Ga0123355_100314037 239
376 3300012809 Ga0160466_102951 Ga0160466_1029512 239
377 3300042615 Ga0466711_437333 Ga0466711_437333_49_768 239
378 3300042616 Ga0466715_474279 Ga0466715_474279_7288_8007 239
379 3300042643 Ga0466704_130710 Ga0466704_130710_2931_3650 239
380 3300042643 Ga0466704_322254 Ga0466704_322254_15368_16087 239
381 iso_pr_bacteria 2836667214 2836667518 239
382 iso_pr_bacteria 2849099867 2849104574 239
383 iso_pr_bacteria 2849104611 2849109234 239
384 iso_pr_bacteria 2850744690 2850744858 239
385 iso_pr_bacteria 2956928875 2956930053 239
386 3300007505 Ga0105005_1103670 Ga0105005_11036702 240
387 3300009826 Ga0123355_10000703 Ga0123355_1000070336 240
388 3300009826 Ga0123355_10497986 Ga0123355_104979862 240
389 3300042659 Ga0466733_027686 Ga0466733_027686_26698_27420 240
390 iso_pr_bacteria 2556921622 2558102536 240
391 3300007505 Ga0105005_1112206 Ga0105005_11122062 241
392 3300009784 Ga0123357_10268609 Ga0123357_102686092 241
393 3300009826 Ga0123355_10252627 Ga0123355_102526273 241
394 3300042605 Ga0466716_370072 Ga0466716_370072_2642_3367 241
395 3300042623 Ga0466734_140079 Ga0466734_140079_2019_2744 241
396 3300042635 Ga0466702_244404 Ga0466702_244404_29063_29788 241
397 iso_pr_bacteria 2820252425 2820252666 241
398 iso_pr_bacteria 2940380068 2940380796 241
399 iso_pr_bacteria 2940419646 2940423484 241
400 3300009826 Ga0123355_10029474 Ga0123355_100294742 242
401 3300010049 Ga0123356_10045902 Ga0123356_100459024 242
402 3300010167 Ga0123353_10055776 Ga0123353_100557764 242
403 3300007505 Ga0105005_1007168 Ga0105005_10071682 243
404 3300010882 Ga0123354_10198454 Ga0123354_101984542 243
405 3300042598 Ga0466701_021689 Ga0466701_021689_67336_68067 243
406 iso_pr_bacteria 2551306396 2552920283 243
407 iso_pr_bacteria 2940221333 2940225801 243
408 iso_pr_bacteria 2940386776 2940387964 243
409 iso_pr_bacteria 2940393498 2940394227 243
410 iso_pr_bacteria 2940400224 2940400951 243
411 iso_pr_bacteria 2940406939 2940408243 243
412 iso_pr_bacteria 2940413413 2940416915 243
413 iso_pr_bacteria 2940425923 2940429575 243
414 iso_pr_bacteria 2983866074 2983868962 243
415 iso_pr_bacteria 2827179085 2827181511 244
416 iso_pr_bacteria 2940425923 2940430043 245
417 iso_pr_bacteria 2971438493 2971442139 246
418 3300012798 Ga0160454_100033 Ga0160454_100033164 247
419 3300012837 Ga0160455_100978 Ga0160455_1009787 248
420 3300012825 Ga0160441_100217 Ga0160441_10021736 249
421 3300012847 Ga0160445_101243 Ga0160445_1012434 252
422 3300042590 Ga0466690_398342 Ga0466690_398342_9472_10233 253
423 3300042649 Ga0466724_40032 Ga0466724_40032_2383_3144 253
424 3300042624 Ga0466735_089493 Ga0466735_089493_1160_1927 255
425 3300005071 Ga0068302_10014565 Ga0068302_100145654 258
426 iso_pr_bacteria 2852337885 2852341111 259
427 3300012805 Ga0160464_103214 Ga0160464_1032142 263
428 3300042620 Ga0466728_455520 Ga0466728_455520_2365_3210 281
429 iso_pr_bacteria 2523231078 2523493256 282
430 iso_pr_bacteria 641736255 641740887 282

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 48 157 0.98
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 198 274 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.