Protein Family IF13385
Metagenome
Isolate
436
Members
259
Samples
201
Scaffolds
296.92
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|3003878002|3003887172|
- Length
- 337 aa
- Sequence
- MHRTSDAGCFVLLATGNGLRVQRDPKLIYMNEFLTQFAQQAVNGLTLGAIYALIAIGYSMVYGIIGMINFAHGEIYMIGAYVGLVTLTALGTSAGHPLPLVLGAALTVSVVVTGVYGFAIERIAYRPLRGGPRLVPLISAIGMSIFLQNYVQIGQGARDVSVPVLIAGAFDMHLGSGVEVTVPYARMLIVAVTLVLMIALTLYIAHSRMGRACRACAEDMNMANLLGIDTNRVISFTFVLGAMLAAVGGVLIGLTTGKLNPYIGFVAGIKAFTAAVLGGIGSIPGAMLGGVLLGLAETLASGYMPAEYKDVVAFGLLVLILLFRPTGLLGKSDIEKV
Sample Types
Isolate
53.9%
Metagenome
46.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
18.8%
Anthocoridae
8.4%
Curculionidae
8.4%
Formicidae
8.0%
Elmidae
7.6%
Drosophilidae
6.4%
Termitidae
6.4%
Culicidae
6.0%
Muscidae
5.2%
Tenebrionidae
3.6%
Armadillidiidae
2.8%
Calliphoridae
2.8%
Cerambycidae
1.6%
Apidae
1.6%
Tephritidae
1.2%
Daphniidae
0.8%
Hydrophilidae
0.8%
Rhinotermitidae
0.8%
Pentatomidae
0.8%
Sarcophagidae
0.8%
Crambidae
0.8%
Aphididae
0.8%
Kalotermitidae
0.4%
Rhopalidae
0.4%
Carabidae
0.4%
Gryllidae
0.4%
Siricidae
0.4%
Passalidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Largidae
0.4%
Alydidae
0.4%
Pteromalidae
0.4%
Plutellidae
0.4%
Ceratophyllidae
0.4%
Trigoniulidae
0.4%
Taxonomy
Archaea
0
Bacteria
358
Eukaryota
0
Viruses
0
Unclassified
78
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 3 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 4 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 5 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 6 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 7 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 8 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 9 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 10 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 11 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 12 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 13 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 14 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 15 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 16 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 17 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 18 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 19 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 20 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 21 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 22 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 23 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 24 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 25 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 26 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 29 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 34 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 35 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 36 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 37 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 38 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 39 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 40 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 41 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 42 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 43 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 44 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 45 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 46 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 47 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 48 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 49 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 50 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 51 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 52 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 53 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 54 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 55 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 56 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 57 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 58 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 59 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 60 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 61 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 62 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 63 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 64 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 65 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 66 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 67 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 68 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 69 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 70 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 71 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 72 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 73 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 74 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 75 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 76 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 77 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 78 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 79 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 82 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 83 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 84 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 85 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 86 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 87 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 88 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 89 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 90 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 91 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 92 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 93 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 94 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 95 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 96 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 97 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 98 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 99 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 100 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 101 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 102 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 103 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 104 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 105 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 106 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 107 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 108 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 109 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 110 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 111 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 112 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 113 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 114 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 115 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 116 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 117 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 118 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 119 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 120 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 121 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 122 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 123 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 124 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 125 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 126 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 127 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 128 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 129 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 130 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 131 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 132 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 133 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 134 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 135 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 136 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 137 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 138 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 139 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 140 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 141 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 142 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 143 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 144 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 145 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 146 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 147 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 148 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 149 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 150 | 2958255616 | Serratia marcescens TM | Isolate | |
| 151 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 152 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 153 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 154 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 155 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 156 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 157 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 158 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 159 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 160 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 161 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 162 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 163 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 164 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 165 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 166 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 167 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 168 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 169 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 170 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 171 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 172 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 173 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 174 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 175 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 176 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 177 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 178 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 179 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 180 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 181 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 182 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 183 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 184 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 185 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 186 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 187 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 188 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 189 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 190 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 191 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 192 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 193 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 194 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 195 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 196 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 197 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 198 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 199 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 200 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 201 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 202 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 203 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 204 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 205 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 206 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 207 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 208 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 209 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 210 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 211 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 212 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 213 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 214 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 215 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 216 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 217 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 218 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 219 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 220 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 221 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 222 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 223 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 224 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 225 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 226 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 227 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 228 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 229 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 230 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 231 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 232 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 233 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 234 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 235 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 236 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 237 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 238 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 239 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 240 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 241 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 242 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 243 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 244 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 245 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 246 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 247 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 248 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 249 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 250 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 251 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 252 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 253 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 254 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 255 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 256 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 257 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 258 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 259 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0205 | 3300056814 | Bacteria | 140585 |
| 2 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 3 | Ga0466701_051965 | 3300042598 | Bacteria | 80920 |
| 4 | Ga0466713_114243 | 3300042602 | Unclassified | 3678 |
| 5 | Ga0466731_088061 | 3300042622 | Unclassified | 5997 |
| 6 | Ga0466734_060661 | 3300042623 | Bacteria | 37945 |
| 7 | Ga0466734_150960 | 3300042623 | Bacteria | 1636 |
| 8 | Ga0466724_22518 | 3300042649 | Unclassified | 27936 |
| 9 | Ga0466724_26296 | 3300042649 | Bacteria | 24997 |
| 10 | Ga0466724_39934 | 3300042649 | Unclassified | 2619 |
| 11 | Ga0466708_190901 | 3300042652 | Bacteria | 19992 |
| 12 | Ga0466725_071405 | 3300042654 | Bacteria | 1453 |
| 13 | Ga0160459_100060 | 3300012831 | Bacteria | 163817 |
| 14 | Ga0160458_100047 | 3300012832 | Unclassified | 160071 |
| 15 | Ga0160458_100215 | 3300012832 | Unclassified | 40162 |
| 16 | Ga0160433_100156 | 3300012846 | Bacteria | 58077 |
| 17 | Ga0160447_100891 | 3300012849 | Bacteria | 12639 |
| 18 | Ga0160447_101130 | 3300012849 | Unclassified | 10715 |
| 19 | Ga0466657_334441 | 3300042582 | Bacteria | 3160 |
| 20 | DPO_contig08933 | 2032320009 | Unclassified | 4269 |
| 21 | DPOL_contig03984 | 2035918003 | Bacteria | 25395 |
| 22 | SPBB_contig11509 | 2044078006 | Bacteria | 172655 |
| 23 | FGTW_contig30730 | 2065487013 | Unclassified | 10413 |
| 24 | CVPL005L_10016243 | 3300002938 | Unclassified | 4615 |
| 25 | Ga0103263_105776 | 3300007042 | Unclassified | 1390 |
| 26 | Ga0103265_1000207 | 3300007068 | Bacteria | 9494 |
| 27 | Ga0102739_1003254 | 3300007095 | Unclassified | 2406 |
| 28 | Ga0104042_1001332 | 3300007130 | Unclassified | 6173 |
| 29 | Ga0102740_1000057 | 3300007140 | Unclassified | 27676 |
| 30 | Ga0103268_1000040 | 3300007192 | Unclassified | 39150 |
| 31 | Ga0160470_100058 | 3300012813 | Bacteria | 160171 |
| 32 | Ga0466701_023659 | 3300042598 | Bacteria | 25219 |
| 33 | Ga0466713_037544 | 3300042602 | Bacteria | 80640 |
| 34 | Ga0466713_103553 | 3300042602 | Unclassified | 1266 |
| 35 | Ga0466713_152447 | 3300042602 | Bacteria | 69492 |
| 36 | Ga0466731_234507 | 3300042622 | Bacteria | 2744 |
| 37 | Ga0466730_020275 | 3300042625 | Unclassified | 13069 |
| 38 | Ga0466730_063520 | 3300042625 | Unclassified | 2858 |
| 39 | Ga0466730_069163 | 3300042625 | Bacteria | 24000 |
| 40 | Ga0466730_086673 | 3300042625 | Bacteria | 3927 |
| 41 | Ga0466730_094171 | 3300042625 | Unclassified | 4039 |
| 42 | Ga0466724_10166 | 3300042649 | Unclassified | 28565 |
| 43 | Ga0160455_101816 | 3300012837 | Bacteria | 5460 |
| 44 | Ga0160448_102284 | 3300012854 | Bacteria | 5971 |
| 45 | Ga0265387_1000025 | 3300024582 | Bacteria | 63430 |
| 46 | Ga0466701_008771 | 3300042598 | Bacteria | 246761 |
| 47 | FGTW_contig07551 | 2065487013 | Unclassified | 2365 |
| 48 | Meta3P_1005237 | 3300002464 | Unclassified | 4216 |
| 49 | Ga0063521_1000425 | 3300003973 | Bacteria | 22346 |
| 50 | Ga0063521_1002392 | 3300003973 | Bacteria | 4623 |
| 51 | Ga0102739_1002218 | 3300007095 | Unclassified | 3038 |
| 52 | Ga0102734_1022023 | 3300007129 | Bacteria | 1597 |
| 53 | Ga0103268_1001011 | 3300007192 | Bacteria | 7542 |
| 54 | Ga0123357_10000654 | 3300009784 | Bacteria | 34493 |
| 55 | Ga0562378_0022 | 3300056814 | Bacteria | 672696 |
| 56 | Ga0466713_143957 | 3300042602 | Bacteria | 200019 |
| 57 | Ga0466729_279616 | 3300042621 | Unclassified | 1129 |
| 58 | Ga0466730_049529 | 3300042625 | Bacteria | 10128 |
| 59 | Ga0466724_25606 | 3300042649 | Unclassified | 3003 |
| 60 | Ga0466724_27654 | 3300042649 | Bacteria | 76646 |
| 61 | Ga0466724_64372 | 3300042649 | Unclassified | 2098 |
| 62 | Ga0466725_331172 | 3300042654 | Bacteria | 1530 |
| 63 | Ga0160433_100029 | 3300012846 | Bacteria | 174368 |
| 64 | Ga0265387_1001209 | 3300024582 | Unclassified | 3816 |
| 65 | Ga0247290_00020 | 3300035364 | Bacteria | 63333 |
| 66 | Ga0247290_00273 | 3300035364 | Bacteria | 12989 |
| 67 | Ga0415639_024629 | 3300038395 | Bacteria | 5358 |
| 68 | Ga0466657_076865 | 3300042582 | Bacteria | 1621 |
| 69 | Ga0466657_269120 | 3300042582 | Bacteria | 13880 |
| 70 | DPOL_contig19719 | 2035918003 | Unclassified | 7472 |
| 71 | CVPL010L_1000295 | 3300002932 | Bacteria | 25081 |
| 72 | CVPL005W_1001572 | 3300002934 | Bacteria | 5788 |
| 73 | Ga0102736_1001749 | 3300007052 | Unclassified | 3670 |
| 74 | Ga0103260_1000033 | 3300007139 | Bacteria | 51624 |
| 75 | Ga0102740_1000010 | 3300007140 | Bacteria | 81265 |
| 76 | Ga0103264_1000958 | 3300007188 | Bacteria | 21668 |
| 77 | Ga0103268_1000004 | 3300007192 | Bacteria | 80007 |
| 78 | Ga0105005_1023656 | 3300007505 | Unclassified | 4402 |
| 79 | Ga0466710_436333 | 3300042613 | Bacteria | 1138 |
| 80 | Ga0160454_100199 | 3300012798 | Unclassified | 64966 |
| 81 | Ga0160466_100441 | 3300012809 | Unclassified | 21832 |
| 82 | Ga0466701_042194 | 3300042598 | Bacteria | 63325 |
| 83 | Ga0466721_129109 | 3300042608 | Bacteria | 12480 |
| 84 | Ga0466724_44711 | 3300042649 | Bacteria | 52359 |
| 85 | Ga0466725_007316 | 3300042654 | Bacteria | 10776 |
| 86 | Ga0466725_081778 | 3300042654 | Unclassified | 1799 |
| 87 | Ga0160469_100046 | 3300012824 | Bacteria | 210863 |
| 88 | Ga0160472_100039 | 3300012839 | Bacteria | 240625 |
| 89 | Ga0160433_102288 | 3300012846 | Bacteria | 4239 |
| 90 | Ga0160445_103988 | 3300012847 | Bacteria | 2801 |
| 91 | Ga0160457_1002376 | 3300012858 | Unclassified | 3971 |
| 92 | Ga0160436_1004067 | 3300012861 | Bacteria | 3518 |
| 93 | Ga0247290_00027 | 3300035364 | Unclassified | 57360 |
| 94 | Ga0466693_067440 | 3300042592 | Bacteria | 3661 |
| 95 | Ga0466701_007408 | 3300042598 | Bacteria | 24566 |
| 96 | SWWA_contig32019__length_2535___numreads_47 | 2100351016 | Unclassified | 2535 |
| 97 | JGI24705J35276_12223974 | 3300002504 | Bacteria | 2563 |
| 98 | CVPL010W_10036757 | 3300002931 | Unclassified | 1617 |
| 99 | CVPL010L_1006910 | 3300002932 | Unclassified | 1441 |
| 100 | CVPL005L_10006694 | 3300002938 | Bacteria | 33589 |
| 101 | Ga0063521_1000059 | 3300003973 | Bacteria | 96306 |
| 102 | Ga0102735_1000006 | 3300007080 | Bacteria | 138659 |
| 103 | Ga0102739_1000012 | 3300007095 | Bacteria | 68645 |
| 104 | Ga0105008_1216607 | 3300007507 | Bacteria | 1841 |
| 105 | Ga0466710_175279 | 3300042613 | Bacteria | 8972 |
| 106 | Ga0466717_130524 | 3300042604 | Unclassified | 5688 |
| 107 | Ga0466730_037173 | 3300042625 | Unclassified | 1733 |
| 108 | Ga0466730_061572 | 3300042625 | Unclassified | 5101 |
| 109 | Ga0466724_10328 | 3300042649 | Bacteria | 2237 |
| 110 | Ga0466725_030109 | 3300042654 | Bacteria | 8996 |
| 111 | Ga0160472_100565 | 3300012839 | Unclassified | 22127 |
| 112 | Ga0160448_100036 | 3300012854 | Bacteria | 126010 |
| 113 | Ga0316159_11360 | 3300030930 | Bacteria | 5416 |
| 114 | Ga0316159_12041 | 3300030930 | Bacteria | 5739 |
| 115 | Ga0466692_186048 | 3300042591 | Bacteria | 5802 |
| 116 | DPO_contig09148 | 2032320009 | Unclassified | 54196 |
| 117 | DPOL_contig00086 | 2035918003 | Bacteria | 93085 |
| 118 | DPOL_contig01078 | 2035918003 | Bacteria | 15392 |
| 119 | FGTW_contig30612 | 2065487013 | Unclassified | 7920 |
| 120 | CVPL010W_10000061 | 3300002931 | Bacteria | 70210 |
| 121 | CVPL010L_1000008 | 3300002932 | Bacteria | 167752 |
| 122 | Ga0063521_1000072 | 3300003973 | Bacteria | 82111 |
| 123 | Ga0063521_1000945 | 3300003973 | Unclassified | 9451 |
| 124 | Ga0074302_1139031 | 3300005316 | Unclassified | 1268 |
| 125 | Ga0103266_1000054 | 3300007067 | Bacteria | 47947 |
| 126 | Ga0102734_1000224 | 3300007129 | Unclassified | 29545 |
| 127 | Ga0102737_1000050 | 3300007142 | Bacteria | 71117 |
| 128 | Ga0103264_1001592 | 3300007188 | Unclassified | 10037 |
| 129 | Ga0103267_1000605 | 3300007190 | Unclassified | 10353 |
| 130 | Ga0104147_1036054 | 3300007224 | Bacteria | 10477 |
| 131 | Ga0123357_10054056 | 3300009784 | Unclassified | 5416 |
| 132 | Ga0466701_074537 | 3300042598 | Bacteria | 175342 |
| 133 | Ga0466713_041719 | 3300042602 | Bacteria | 16821 |
| 134 | Ga0466730_010269 | 3300042625 | Bacteria | 97082 |
| 135 | Ga0466730_024232 | 3300042625 | Bacteria | 195834 |
| 136 | Ga0466730_041544 | 3300042625 | Unclassified | 9771 |
| 137 | Ga0466724_16785 | 3300042649 | Bacteria | 209654 |
| 138 | Ga0466724_34622 | 3300042649 | Unclassified | 26371 |
| 139 | Ga0466724_35738 | 3300042649 | Bacteria | 10461 |
| 140 | Ga0160444_104302 | 3300012841 | Unclassified | 1958 |
| 141 | Ga0316159_10814 | 3300030930 | Bacteria | 7359 |
| 142 | Ga0466695_402432 | 3300042595 | Bacteria | 3044 |
| 143 | DPOL_contig20505 | 2035918003 | Bacteria | 20226 |
| 144 | SPBB_contig11534 | 2044078006 | Bacteria | 56479 |
| 145 | 2227080782 | 2225789004 | Bacteria | 166845 |
| 146 | HBC_ctgsDRAFT_1001695 | 3300000333 | Bacteria | 4839 |
| 147 | Meta3P_1000061 | 3300002464 | Unclassified | 24008 |
| 148 | Meta3P_1000869 | 3300002464 | Bacteria | 44072 |
| 149 | Meta3P_1001199 | 3300002464 | Unclassified | 19368 |
| 150 | Ga0063521_1000019 | 3300003973 | Bacteria | 139495 |
| 151 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 152 | Ga0103266_1000145 | 3300007067 | Bacteria | 54759 |
| 153 | Ga0102735_1001505 | 3300007080 | Unclassified | 3924 |
| 154 | Ga0103261_1000063 | 3300007083 | Bacteria | 38196 |
| 155 | Ga0102738_1000517 | 3300007141 | Unclassified | 6407 |
| 156 | Ga0103264_1000143 | 3300007188 | Bacteria | 73593 |
| 157 | Ga0103264_1000158 | 3300007188 | Bacteria | 39120 |
| 158 | Ga0103267_1000177 | 3300007190 | Bacteria | 24738 |
| 159 | Ga0530661_000504 | 3300056564 | Unclassified | 27557 |
| 160 | Ga0466710_177955 | 3300042613 | Unclassified | 4221 |
| 161 | Ga0123354_10002877 | 3300010882 | Bacteria | 23319 |
| 162 | Ga0123354_10445343 | 3300010882 | Bacteria | 1054 |
| 163 | Ga0160442_100158 | 3300012806 | Bacteria | 64993 |
| 164 | Ga0466717_277189 | 3300042604 | Unclassified | 1368 |
| 165 | Ga0466734_006457 | 3300042623 | Bacteria | 2824 |
| 166 | Ga0466730_013740 | 3300042625 | Unclassified | 37679 |
| 167 | Ga0160460_101242 | 3300012845 | Unclassified | 9436 |
| 168 | Ga0160436_1006698 | 3300012861 | Unclassified | 2651 |
| 169 | Ga0247290_00051 | 3300035364 | Bacteria | 40110 |
| 170 | DPOL_contig19401 | 2035918003 | Unclassified | 28621 |
| 171 | SPBB_contig07226 | 2044078006 | Bacteria | 63389 |
| 172 | SWWA_contig06288__length_3438___numreads_58 | 2100351016 | Bacteria | 3438 |
| 173 | SWWA_contig31140__length_4672___numreads_95 | 2100351016 | Bacteria | 4672 |
| 174 | Meta3P_1006548 | 3300002464 | Unclassified | 3993 |
| 175 | JGI24705J35276_12237970 | 3300002504 | Bacteria | 14605 |
| 176 | CVPL010W_10020385 | 3300002931 | Unclassified | 3830 |
| 177 | CVPL010L_1000051 | 3300002932 | Bacteria | 128613 |
| 178 | Ga0104049_1027887 | 3300007103 | Unclassified | 4578 |
| 179 | Ga0104042_1003108 | 3300007130 | Bacteria | 1782 |
| 180 | Ga0103268_1000438 | 3300007192 | Unclassified | 12835 |
| 181 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 182 | Ga0466710_068680 | 3300042613 | Bacteria | 4214 |
| 183 | Ga0466730_051540 | 3300042625 | Bacteria | 5417 |
| 184 | Ga0466724_33561 | 3300042649 | Bacteria | 205596 |
| 185 | Ga0160470_103332 | 3300012813 | Unclassified | 2620 |
| 186 | Ga0160467_103878 | 3300012829 | Unclassified | 2328 |
| 187 | Ga0160444_103364 | 3300012841 | Unclassified | 2296 |
| 188 | Ga0160448_105202 | 3300012854 | Unclassified | 3453 |
| 189 | DPO_contig08367 | 2032320009 | Bacteria | 28977 |
| 190 | SWWA_contig17086__length_64668___numreads_3845 | 2100351016 | Bacteria | 64668 |
| 191 | CVPL010W_10000412 | 3300002931 | Bacteria | 44390 |
| 192 | CVPL010W_10005877 | 3300002931 | Unclassified | 14658 |
| 193 | Ga0103261_1000231 | 3300007083 | Unclassified | 9270 |
| 194 | Ga0102739_1007311 | 3300007095 | Unclassified | 1463 |
| 195 | Ga0104041_1110112 | 3300007106 | Unclassified | 4513 |
| 196 | Ga0102734_1010616 | 3300007129 | Unclassified | 2144 |
| 197 | Ga0102738_1000032 | 3300007141 | Bacteria | 69171 |
| 198 | Ga0102738_1003121 | 3300007141 | Unclassified | 2442 |
| 199 | Ga0103264_1001547 | 3300007188 | Bacteria | 18997 |
| 200 | Ga0105553_1034021 | 3300007767 | Bacteria | 72525 |
| 201 | Ga0123357_10000042 | 3300009784 | Bacteria | 102427 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 41 | 321 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.