Protein Family IF13315

Metagenome Isolate
282 Members
229 Samples
128 Scaffolds
152.08 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|3003178663|3003180949|
Length
154 aa
Sequence
MQAVQVKVLNPKLTQDEAFSLPTRATDGSAGIDLRACIDEPLTIKAGATHLVGTGLAVYIQDPNYAGMILPRSGLGHKHGIVLGNLVGLIDADYQGELMVSIWNRSSQDFILNPAERMAQYIVVPVARPEFEVVSEFSDKSARGAGGFGHSGRQ

📊 Sample Types

Isolate 54.6%
Metagenome 45.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 16.5%
Anthocoridae 8.9%
Formicidae 7.1%
Drosophilidae 6.7%
Termitidae 5.8%
Culicidae 5.4%
Muscidae 5.4%
Curculionidae 4.5%
Calliphoridae 4.0%
Kalotermitidae 4.0%
Elmidae 3.6%
Coreidae 3.6%
Tenebrionidae 3.6%
Apidae 3.1%
Armadillidiidae 3.1%
Aphididae 1.8%
Cerambycidae 1.8%
Rhinotermitidae 1.3%
Sarcophagidae 0.9%
Pteromalidae 0.9%
Tephritidae 0.9%
Ceratophyllidae 0.4%
Pseudococcidae 0.4%
Plutellidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Rhopalidae 0.4%
Glossinidae 0.4%
Carabidae 0.4%
Siricidae 0.4%
Passalidae 0.4%
Ixodidae 0.4%
Crambidae 0.4%
Pentatomidae 0.4%
Gryllidae 0.4%
Hydrophilidae 0.4%
Daphniidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 258
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
2 2871771314 Pantoea sp. Ae16 Isolate Culicidae
3 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
4 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
5 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
6 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
7 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
8 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
9 2645727860 Winslowiella iniecta B120 Isolate Aphididae
10 2703719240 Serratia marcescens ano2 Isolate Unclassified
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 648276708 Pantoea sp. aB Isolate Unclassified
16 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
17 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
18 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
19 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
20 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
21 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
22 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
23 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
24 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
25 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
26 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
27 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
28 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
29 2838140227 Dyella sp. OAE510 Isolate Unclassified
30 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
31 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
32 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
33 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
34 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
35 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
36 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
37 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
38 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
39 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
40 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
41 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
44 650716016 Candidatus Moranella endobia PCIT Isolate Pseudococcidae
45 8018312681 Enterobacter sp. OLF Isolate Tephritidae
46 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
47 8099192374 Erwinia typographi IC4 Isolate Curculionidae
48 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
49 2978161719 Serratia marcescens KZ2 Isolate Apidae
50 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
51 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
52 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
53 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
54 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
55 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
56 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
57 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
58 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
59 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
60 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
61 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
62 2958255616 Serratia marcescens TM Isolate
63 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
64 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
65 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
66 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
67 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
68 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
69 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
70 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
71 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
72 651324086 Plautia crossota stali symbiont Isolate Unclassified
73 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
74 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
75 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
76 8071333649 Escherichia coli PN108 Isolate Calliphoridae
77 8071338694 Escherichia coli PN87 Isolate Calliphoridae
78 8102982778 Erwinia sp. S63 Isolate Curculionidae
79 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
80 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
81 3300007766 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut Metagenome Drosophilidae
82 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
83 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
84 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
85 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
86 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
87 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
88 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
89 2864791955 Aeromonas veronii S00030 Isolate Elmidae
90 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
91 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
92 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
93 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
94 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
95 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
96 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
97 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
98 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
99 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
100 8071343737 Escherichia coli PN119 Isolate Calliphoridae
101 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
102 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
103 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
104 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
105 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
106 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
107 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
108 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
109 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
110 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
111 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
112 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
113 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
114 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
115 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
116 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
117 2849409164 Snodgrassella alvi wkB298 Isolate Apidae
118 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
119 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
120 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
121 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
122 2937735258 Serratia marcescens KZ11 Isolate Apidae
123 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
124 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
125 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
126 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
127 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
128 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
129 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
130 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
131 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
132 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
133 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
134 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
135 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
136 8100181737 Kosakonia sp. S58 Isolate Curculionidae
137 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
138 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
139 2978102237 Serratia fonticola AeS1 Isolate Culicidae
140 3007994558 Escherichia alba B35 Isolate Tenebrionidae
141 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
142 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
143 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
144 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
145 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
146 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
147 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
148 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
149 2836714267 Shimwellia blattae NCTC10965 Isolate
150 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
151 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
152 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
153 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
154 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
155 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
156 2603880170 Burkholderiales A2 Isolate Unclassified
157 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
158 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
159 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
160 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
161 8021546568 Klebsiella sp. Kps Isolate Tephritidae
162 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
163 8071322446 Escherichia coli PN122 Isolate Calliphoridae
164 8103002986 Erwinia sp. S38 Isolate Curculionidae
165 8103008710 Erwinia sp. S43 Isolate Curculionidae
166 2971189173 Yersinia pestis A-1249 Isolate Unclassified
167 2984883310 Serratia symbiotica SCifornacula/2912 Isolate Aphididae
168 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
169 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
170 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
171 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
172 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
173 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
174 2864768727 Aeromonas veronii S00020 Isolate Elmidae
175 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
176 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
177 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
178 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
179 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
180 2574179716 Serratia sp. DD3 Isolate Daphniidae
181 2718217944 Serratia marcescens AS1 Isolate Culicidae
182 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
183 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
184 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
185 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
186 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
187 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
188 8100176769 Kosakonia sp. S57 Isolate Curculionidae
189 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
190 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
191 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
192 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
193 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
194 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
195 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
196 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
197 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
198 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
199 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
200 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
201 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
202 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
203 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
204 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
205 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
206 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
207 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
208 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
209 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
210 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
211 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
212 2648501209 Winslowiella iniecta B149 Isolate Aphididae
213 2703719239 Serratia marcescens ano1 Isolate Unclassified
214 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
215 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
216 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
217 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
218 8004541719 Serratia marcescens KZ19 Isolate Apidae
219 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
220 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
221 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
222 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
223 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
224 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
225 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
226 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
227 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
228 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
229 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0003 3300056842 Bacteria 3990310
2 Ga0466709_105421 3300042648 Bacteria 27532
3 Ga0466724_05639 3300042649 Unclassified 7983
4 Ga0466715_403366 3300042616 Bacteria 28580
5 Ga0123353_10102605 3300010167 Unclassified 4611
6 Ga0160471_102409 3300012812 Bacteria 3120
7 SWWA_contig05030__length_5583___numreads_125 2100351016 Unclassified 5583
8 2227355514 2225789004 Bacteria 1134
9 JGI24702J35022_10009039 3300002462 Bacteria 5614
10 Ga0103265_1002978 3300007068 Bacteria 2552
11 Ga0104051_1103694 3300007078 Unclassified 1479
12 Ga0104042_1030173 3300007130 Bacteria 998
13 Ga0102740_1009470 3300007140 Bacteria 1570
14 Ga0102737_1003192 3300007142 Bacteria 5356
15 Ga0160447_100550 3300012849 Bacteria 17428
16 Ga0247290_00147 3300035364 Unclassified 22143
17 Ga0466729_127108 3300042621 Bacteria 11194
18 FGTW_contig01490 2065487013 Bacteria 48536
19 Ga0074311_1146190 3300005317 Bacteria 1243
20 Ga0102734_1000386 3300007129 Bacteria 14903
21 Ga0103260_1000134 3300007139 Bacteria 17716
22 Ga0104019_1002429 3300007150 Bacteria 3012
23 Ga0466657_320718 3300042582 Bacteria 2750
24 Ga0466657_393334 3300042582 Bacteria 4814
25 Ga0466692_175419 3300042591 Bacteria 3916
26 Ga0562377_0013 3300056842 Bacteria 1229680
27 Ga0466730_028133 3300042625 Unclassified 19744
28 Ga0466724_08036 3300042649 Bacteria 9259
29 Ga0123356_10645800 3300010049 Unclassified 1225
30 CVPL005W_1000085 3300002934 Bacteria 36605
31 Ga0103263_100312 3300007042 Bacteria 6817
32 Ga0103261_1004613 3300007083 Bacteria 2402
33 Ga0102739_1000013 3300007095 Bacteria 65151
34 Ga0104049_1139687 3300007103 Bacteria 895
35 Ga0104042_1130285 3300007130 Unclassified 998
36 Ga0102738_1000260 3300007141 Bacteria 10459
37 Ga0466701_037609 3300042598 Unclassified 3092
38 Ga0466713_126679 3300042602 Bacteria 66561
39 Ga0466722_135096 3300042609 Bacteria 33731
40 Ga0160445_100001 3300012847 Bacteria 765249
41 Ga0265387_1000005 3300024582 Bacteria 95017
42 Ga0466657_066867 3300042582 Bacteria 21233
43 Ga0466657_105709 3300042582 Bacteria 1133
44 Ga0562375_1905 3300056856 Bacteria 25570
45 Ga0466734_054595 3300042623 Bacteria 10767
46 Ga0466730_060325 3300042625 Bacteria 1833
47 Ga0466730_092372 3300042625 Bacteria 2005
48 Ga0466709_409753 3300042648 Bacteria 9226
49 Ga0466725_437641 3300042654 Bacteria 1862
50 Ga0466728_029704 3300042620 Bacteria 32782
51 SPBB_contig02437 2044078006 Unclassified 1156
52 Meta3P_1003262 3300002464 Bacteria 5248
53 CVPL010W_10004864 3300002931 Bacteria 14703
54 Ga0102735_1020647 3300007080 Bacteria 882
55 Ga0104047_1124676 3300007088 Unclassified 886
56 Ga0102739_1001838 3300007095 Bacteria 3403
57 Ga0102739_1002590 3300007095 Unclassified 2755
58 Ga0105005_1189586 3300007505 Bacteria 652
59 Ga0105005_1287710 3300007505 Bacteria 1503
60 Ga0105553_1041596 3300007767 Bacteria 28063
61 Ga0160447_120834 3300012849 Bacteria 1052
62 Ga0466691_041386 3300042593 Bacteria 26058
63 Ga0562377_0587 3300056842 Bacteria 55342
64 Ga0466734_140944 3300042623 Bacteria 7048
65 Ga0466730_102403 3300042625 Bacteria 6598
66 Ga0466703_047465 3300042636 Bacteria 7955
67 Ga0466725_437773 3300042654 Bacteria 32551
68 Ga0466710_448377 3300042613 Bacteria 17884
69 Ga0466711_186348 3300042615 Bacteria 5147
70 Ga0466715_381436 3300042616 Bacteria 2384
71 Ga0466723_197141 3300042618 Bacteria 10242
72 Ga0123355_10283538 3300009826 Bacteria 2283
73 Ga0123354_10080414 3300010882 Bacteria 4614
74 FGTW_contig08319 2065487013 Unclassified 3391
75 Ga0063521_1068365 3300003973 Unclassified 701
76 Ga0063521_1076367 3300003973 Unclassified 643
77 Ga0103266_1004408 3300007067 Bacteria 1902
78 Ga0102737_1000356 3300007142 Bacteria 15541
79 Ga0466707_319735 3300042601 Bacteria 1300
80 Ga0160432_100064 3300012818 Bacteria 124271
81 Ga0160456_100070 3300012820 Bacteria 144397
82 Ga0160443_100154 3300012848 Bacteria 98725
83 Ga0265387_1000754 3300024582 Bacteria 4959
84 Ga0466657_147289 3300042582 Bacteria 48033
85 Ga0466692_177079 3300042591 Bacteria 65363
86 Ga0466734_070958 3300042623 Bacteria 8225
87 Ga0466734_150898 3300042623 Bacteria 6049
88 Ga0466730_039940 3300042625 Unclassified 9413
89 Ga0466730_040222 3300042625 Bacteria 14131
90 Ga0466710_108458 3300042613 Bacteria 43285
91 Ga0063521_1009915 3300003973 Unclassified 2285
92 Ga0104042_1001321 3300007130 Bacteria 10966
93 Ga0102738_1001375 3300007141 Unclassified 3784
94 Ga0104147_1022094 3300007224 Bacteria 20548
95 Ga0105003_1000020 3300007766 Bacteria 4526
96 Ga0160446_100014 3300012835 Bacteria 270286
97 Ga0160433_102819 3300012846 Bacteria 3480
98 Ga0160436_1001873 3300012861 Unclassified 5567
99 Ga0562375_0007 3300056856 Bacteria 1880046
100 Ga0466730_009815 3300042625 Unclassified 8479
101 Ga0466704_420893 3300042643 Bacteria 12772
102 Ga0466724_50987 3300042649 Unclassified 1045
103 FGTW_contig31258 2065487013 Unclassified 5244
104 HBC_ctgsDRAFT_1010920 3300000333 Bacteria 2167
105 Ga0063521_1000233 3300003973 Bacteria 37861
106 Ga0102735_1000301 3300007080 Bacteria 16768
107 Ga0102737_1007739 3300007142 Bacteria 1939
108 Ga0103264_1000458 3300007188 Bacteria 21026
109 Ga0103268_1000948 3300007192 Bacteria 7834
110 Ga0466719_099025 3300042606 Bacteria 25998
111 Ga0160467_100002 3300012829 Bacteria 1006994
112 Ga0160458_110033 3300012832 Bacteria 1062
113 Ga0466657_164977 3300042582 Bacteria 6106
114 Ga0466697_246947 3300042611 Bacteria 1814
115 Ga0123356_10014214 3300010049 Bacteria 7658
116 FGTW_contig31977 2065487013 Unclassified 3033
117 HBC_ctgsDRAFT_1013672 3300000333 Bacteria 1956
118 CVPL010W_10030794 3300002931 Bacteria 3287
119 CVPL010L_1000164 3300002932 Bacteria 19286
120 Ga0104045_1005266 3300007085 Bacteria 4507
121 Ga0102734_1007952 3300007129 Bacteria 2405
122 Ga0103260_1012857 3300007139 Bacteria 1165
123 Ga0102738_1000030 3300007141 Bacteria 97776
124 Ga0102737_1000846 3300007142 Unclassified 9447
125 Ga0466707_024630 3300042601 Bacteria 2497
126 Ga0160468_103025 3300012819 Bacteria 2490
127 Ga0160467_100817 3300012829 Bacteria 20627
128 Ga0160457_1000044 3300012858 Bacteria 205522

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012861 Ga0160436_1001873 Ga0160436_10018733 142
2 3300007080 Ga0102735_1020647 Ga0102735_10206471 146
3 3300007142 Ga0102737_1003192 Ga0102737_10031924 147
4 3300009826 Ga0123355_10283538 Ga0123355_102835382 147
5 3300042623 Ga0466734_070958 Ga0466734_070958_7298_7744 148
6 iso_pr_bacteria 2603880170 2606029274 148
7 iso_pr_bacteria 2687453742 2689989592 148
8 iso_pr_bacteria 2848339753 2848341325 148
9 iso_pr_bacteria 8023747282 8023751834 148
10 iso_pr_bacteria 8025701579 8025705367 148
11 iso_pr_bacteria 8025728939 8025729528 148
12 iso_pr_bacteria 8025735396 8025735604 148
13 iso_pr_bacteria 8069770227 8069774779 148
14 iso_pr_bacteria 8102169119 8102169327 148
15 iso_pr_bacteria 8102174626 8102175215 148
16 iso_pr_bacteria 8102201977 8102205765 148
17 3300002931 CVPL010W_10004864 CVPL010W_1000486416 149
18 3300007042 Ga0103263_100312 Ga0103263_1003125 149
19 3300007095 Ga0102739_1002590 Ga0102739_10025902 149
20 3300007139 Ga0103260_1012857 Ga0103260_10128572 149
21 3300007142 Ga0102737_1000356 Ga0102737_10003564 149
22 3300007188 Ga0103264_1000458 Ga0103264_10004588 149
23 3300007192 Ga0103268_1000948 Ga0103268_100094811 149
24 3300012812 Ga0160471_102409 Ga0160471_1024094 149
25 3300012819 Ga0160468_103025 Ga0160468_1030252 149
26 3300012820 Ga0160456_100070 Ga0160456_100070124 149
27 3300012849 Ga0160447_120834 Ga0160447_1208341 149
28 3300042582 Ga0466657_066867 Ga0466657_066867_5961_6410 149
29 3300042582 Ga0466657_147289 Ga0466657_147289_13709_14158 149
30 3300042582 Ga0466657_164977 Ga0466657_164977_2002_2451 149
31 3300042591 Ga0466692_175419 Ga0466692_175419_3022_3471 149
32 3300042601 Ga0466707_319735 Ga0466707_319735_84_533 149
33 3300042606 Ga0466719_099025 Ga0466719_099025_13271_13720 149
34 3300042609 Ga0466722_135096 Ga0466722_135096_11956_12405 149
35 3300042611 Ga0466697_246947 Ga0466697_246947_808_1257 149
36 3300042613 Ga0466710_108458 Ga0466710_108458_31745_32194 149
37 3300042615 Ga0466711_186348 Ga0466711_186348_1865_2314 149
38 3300042616 Ga0466715_403366 Ga0466715_403366_9409_9858 149
39 3300042621 Ga0466729_127108 Ga0466729_127108_7393_7842 149
40 3300042636 Ga0466703_047465 Ga0466703_047465_3366_3815 149
41 3300042643 Ga0466704_420893 Ga0466704_420893_5404_5853 149
42 3300042648 Ga0466709_409753 Ga0466709_409753_4750_5199 149
43 3300042654 Ga0466725_437641 Ga0466725_437641_853_1302 149
44 3300042654 Ga0466725_437773 Ga0466725_437773_28616_29065 149
45 iso_pr_bacteria 2820089333 2820091720 149
46 3300002462 JGI24702J35022_10009039 JGI24702J35022_100090392 150
47 3300002934 CVPL005W_1000085 CVPL005W_100008512 150
48 3300007080 Ga0102735_1000301 Ga0102735_100030112 150
49 3300007083 Ga0103261_1004613 Ga0103261_10046132 150
50 3300007129 Ga0102734_1000386 Ga0102734_10003865 150
51 3300007140 Ga0102740_1009470 Ga0102740_10094701 150
52 3300007142 Ga0102737_1000846 Ga0102737_10008465 150
53 3300010167 Ga0123353_10102605 Ga0123353_101026053 150
54 3300010882 Ga0123354_10080414 Ga0123354_100804143 150
55 3300042598 Ga0466701_037609 Ga0466701_037609_1157_1609 150
56 3300042648 Ga0466709_105421 Ga0466709_105421_18196_18648 150
57 iso_pr_bacteria 2864874997 2864877972 150
58 iso_pr_bacteria 3006190525 3006193470 150
59 iso_pr_bacteria 8021899934 8021900199 150
60 2065487013 FGTW_contig08319 FGTW_00273750 151
61 2065487013 FGTW_contig31258 FGTW_03095020 151
62 2065487013 FGTW_contig31977 FGTW_00870970 151
63 3300005317 Ga0074311_1146190 Ga0074311_11461901 151
64 3300007085 Ga0104045_1005266 Ga0104045_10052662 151
65 3300007150 Ga0104019_1002429 Ga0104019_10024292 151
66 3300007505 Ga0105005_1189586 Ga0105005_11895861 151
67 3300042582 Ga0466657_105709 Ga0466657_105709_78_533 151
68 3300042591 Ga0466692_177079 Ga0466692_177079_20271_20726 151
69 3300042623 Ga0466734_140944 Ga0466734_140944_1726_2181 151
70 3300042623 Ga0466734_150898 Ga0466734_150898_4775_5230 151
71 3300042625 Ga0466730_060325 Ga0466730_060325_49_504 151
72 3300042625 Ga0466730_102403 Ga0466730_102403_5691_6146 151
73 iso_pr_bacteria 2513020017 2513102554 151
74 iso_pr_bacteria 2519899623 2520394983 151
75 iso_pr_bacteria 2529292851 2530236161 151
76 iso_pr_bacteria 2582581321 2585352263 151
77 iso_pr_bacteria 2588253791 2588728398 151
78 iso_pr_bacteria 2597489902 2597923616 151
79 iso_pr_bacteria 2599185261 2599817008 151
80 iso_pr_bacteria 2838140227 2838140893 151
81 iso_pr_bacteria 2841260384 2841263909 151
82 iso_pr_bacteria 2850131454 2850135540 151
83 iso_pr_bacteria 2864847319 2864848776 151
84 iso_pr_bacteria 2874434233 2874436273 151
85 iso_pr_bacteria 2889908211 2889912707 151
86 iso_pr_bacteria 2896187957 2896192787 151
87 iso_pr_bacteria 2922113941 2922115235 151
88 iso_pr_bacteria 3000478755 3000479074 151
89 iso_pr_bacteria 637000270 637854193 151
90 iso_pr_bacteria 651324086 651695918 151
91 2100351016 SWWA_contig05030__length_5583___numreads_125 SWWA_00673880 152
92 3300007088 Ga0104047_1124676 Ga0104047_11246762 152
93 3300007130 Ga0104042_1030173 Ga0104042_10301732 152
94 3300007130 Ga0104042_1130285 Ga0104042_11302851 152
95 3300012832 Ga0160458_110033 Ga0160458_1100331 152
96 3300024582 Ga0265387_1000005 Ga0265387_10000053 152
97 3300024582 Ga0265387_1000754 Ga0265387_10007544 152
98 3300035364 Ga0247290_00147 Ga0247290_00147_1219_1677 152
99 3300042601 Ga0466707_024630 Ga0466707_024630_1967_2425 152
100 3300042602 Ga0466713_126679 Ga0466713_126679_63762_64220 152
101 3300042625 Ga0466730_009815 Ga0466730_009815_41_499 152
102 3300042625 Ga0466730_028133 Ga0466730_028133_2185_2643 152
103 3300042625 Ga0466730_039940 Ga0466730_039940_6648_7106 152
104 3300042625 Ga0466730_040222 Ga0466730_040222_2208_2666 152
105 3300042649 Ga0466724_05639 Ga0466724_05639_3466_3924 152
106 3300042649 Ga0466724_08036 Ga0466724_08036_6672_7130 152
107 3300042649 Ga0466724_50987 Ga0466724_50987_329_787 152
108 3300056842 Ga0562377_0003 Ga0562377_0003_822052_822510 152
109 3300056842 Ga0562377_0013 Ga0562377_0013_892241_892699 152
110 3300056842 Ga0562377_0587 Ga0562377_0587_45303_45761 152
111 3300056856 Ga0562375_0007 Ga0562375_0007_1768375_1768833 152
112 3300056856 Ga0562375_1905 Ga0562375_1905_10600_11058 152
113 iso_pr_bacteria 2510065002 2510072783 152
114 iso_pr_bacteria 2518285522 2518344093 152
115 iso_pr_bacteria 2524614872 2526111637 152
116 iso_pr_bacteria 2531839602 2534153356 152
117 iso_pr_bacteria 2537561600 2537923813 152
118 iso_pr_bacteria 2547132185 2547712079 152
119 iso_pr_bacteria 2551306516 2553378616 152
120 iso_pr_bacteria 2551306531 2553452190 152
121 iso_pr_bacteria 2574179716 2574244071 152
122 iso_pr_bacteria 2574179716 2574244898 152
123 iso_pr_bacteria 2574179716 2574246665 152
124 iso_pr_bacteria 2574179716 2574246901 152
125 iso_pr_bacteria 2619619082 2620613441 152
126 iso_pr_bacteria 2645727860 2647289810 152
127 iso_pr_bacteria 2648501209 2648984965 152
128 iso_pr_bacteria 2703719239 2706052849 152
129 iso_pr_bacteria 2703719240 2706058173 152
130 iso_pr_bacteria 2718217749 2718707306 152
131 iso_pr_bacteria 2718217944 2719465462 152
132 iso_pr_bacteria 2731957969 2734001870 152
133 iso_pr_bacteria 2765235945 2766081241 152
134 iso_pr_bacteria 2775506951 2776480397 152
135 iso_pr_bacteria 2778261152 2779039207 152
136 iso_pr_bacteria 2778261153 2779043324 152
137 iso_pr_bacteria 2822856742 2822856864 152
138 iso_pr_bacteria 2824588292 2824590297 152
139 iso_pr_bacteria 2833053935 2833056871 152
140 iso_pr_bacteria 2835335304 2835337051 152
141 iso_pr_bacteria 2836714267 2836718354 152
142 iso_pr_bacteria 2837516909 2837521207 152
143 iso_pr_bacteria 2846386538 2846390334 152
144 iso_pr_bacteria 2847708326 2847713538 152
145 iso_pr_bacteria 2856068565 2856069566 152
146 iso_pr_bacteria 2859315706 2859319991 152
147 iso_pr_bacteria 2864764899 2864768643 152
148 iso_pr_bacteria 2864768727 2864772953 152
149 iso_pr_bacteria 2864777284 2864782031 152
150 iso_pr_bacteria 2864791955 2864796214 152
151 iso_pr_bacteria 2864796242 2864800893 152
152 iso_pr_bacteria 2871760914 2871761097 152
153 iso_pr_bacteria 2871771314 2871772984 152
154 iso_pr_bacteria 2873562573 2873563008 152
155 iso_pr_bacteria 2874504452 2874506646 152
156 iso_pr_bacteria 2874880541 2874883587 152
157 iso_pr_bacteria 2876334352 2876337021 152
158 iso_pr_bacteria 2876358570 2876362373 152
159 iso_pr_bacteria 2878947168 2878947641 152
160 iso_pr_bacteria 2885043073 2885045014 152
161 iso_pr_bacteria 2885046828 2885048742 152
162 iso_pr_bacteria 2885050628 2885052489 152
163 iso_pr_bacteria 2885054481 2885056322 152
164 iso_pr_bacteria 2885058212 2885060003 152
165 iso_pr_bacteria 2885061987 2885063940 152
166 iso_pr_bacteria 2885065815 2885067679 152
167 iso_pr_bacteria 2921816052 2921818640 152
168 iso_pr_bacteria 2921842437 2921842818 152
169 iso_pr_bacteria 2937387794 2937391168 152
170 iso_pr_bacteria 2937427229 2937429582 152
171 iso_pr_bacteria 2937735258 2937737463 152
172 iso_pr_bacteria 2937751072 2937752538 152
173 iso_pr_bacteria 2938192669 2938197440 152
174 iso_pr_bacteria 2957730672 2957731869 152
175 iso_pr_bacteria 2958255616 2958255912 152
176 iso_pr_bacteria 2961206375 2961207612 152
177 iso_pr_bacteria 2961232173 2961233264 152
178 iso_pr_bacteria 2961247850 2961248513 152
179 iso_pr_bacteria 2964846109 2964850108 152
180 iso_pr_bacteria 2964859436 2964862998 152
181 iso_pr_bacteria 2965197371 2965198907 152
182 iso_pr_bacteria 2967915117 2967915750 152
183 iso_pr_bacteria 2970322301 2970324309 152
184 iso_pr_bacteria 2970335472 2970339612 152
185 iso_pr_bacteria 2970791725 2970793191 152
186 iso_pr_bacteria 2971189173 2971190028 152
187 iso_pr_bacteria 2977727922 2977731860 152
188 iso_pr_bacteria 2977745872 2977749620 152
189 iso_pr_bacteria 2978102237 2978107044 152
190 iso_pr_bacteria 2978161719 2978164912 152
191 iso_pr_bacteria 2979682021 2979682319 152
192 iso_pr_bacteria 2984883310 2984883340 152
193 iso_pr_bacteria 2996406003 2996410864 152
194 iso_pr_bacteria 2996467878 2996468435 152
195 iso_pr_bacteria 3004010258 3004010492 152
196 iso_pr_bacteria 3004364956 3004365634 152
197 iso_pr_bacteria 3007994558 3007997838 152
198 iso_pr_bacteria 648276708 648771080 152
199 iso_pr_bacteria 648861007 648922318 152
200 iso_pr_bacteria 650716016 651012171 152
201 iso_pr_bacteria 8001059720 8001060830 152
202 iso_pr_bacteria 8004118532 8004121987 152
203 iso_pr_bacteria 8004285568 8004286943 152
204 iso_pr_bacteria 8004307473 8004312528 152
205 iso_pr_bacteria 8004541719 8004545429 152
206 iso_pr_bacteria 8004571736 8004572372 152
207 iso_pr_bacteria 8004582426 8004583581 152
208 iso_pr_bacteria 8006199443 8006200280 152
209 iso_pr_bacteria 8018312681 8018316954 152
210 iso_pr_bacteria 8021535516 8021538828 152
211 iso_pr_bacteria 8021546568 8021548058 152
212 iso_pr_bacteria 8028002147 8028006715 152
213 iso_pr_bacteria 8062647588 8062648618 152
214 iso_pr_bacteria 8071322446 8071325592 152
215 iso_pr_bacteria 8071333649 8071338009 152
216 iso_pr_bacteria 8071338694 8071341752 152
217 iso_pr_bacteria 8071343737 8071348129 152
218 iso_pr_bacteria 8073124432 8073124740 152
219 iso_pr_bacteria 8099192374 8099196970 152
220 iso_pr_bacteria 8100176769 8100177567 152
221 iso_pr_bacteria 8100181737 8100182952 152
222 iso_pr_bacteria 8102982778 8102984240 152
223 iso_pr_bacteria 8103002986 8103005531 152
224 iso_pr_bacteria 8103008710 8103009783 152
225 iso_pr_bacteria 8110023836 8110026315 152
226 3300000333 HBC_ctgsDRAFT_1010920 HBC_ctgsDRAFT_10109203 153
227 3300000333 HBC_ctgsDRAFT_1013672 HBC_ctgsDRAFT_10136722 153
228 3300002464 Meta3P_1003262 Meta3P_10032623 153
229 3300002932 CVPL010L_1000164 CVPL010L_10001643 153
230 3300003973 Ga0063521_1000233 Ga0063521_10002338 153
231 3300003973 Ga0063521_1009915 Ga0063521_10099153 153
232 3300003973 Ga0063521_1068365 Ga0063521_10683651 153
233 3300003973 Ga0063521_1076367 Ga0063521_10763672 153
234 3300007078 Ga0104051_1103694 Ga0104051_11036942 153
235 3300007103 Ga0104049_1139687 Ga0104049_11396871 153
236 3300007224 Ga0104147_1022094 Ga0104147_10220943 153
237 3300007505 Ga0105005_1287710 Ga0105005_12877102 153
238 3300007766 Ga0105003_1000020 Ga0105003_10000202 153
239 3300007767 Ga0105553_1041596 Ga0105553_104159610 153
240 3300012846 Ga0160433_102819 Ga0160433_1028193 153
241 3300042593 Ga0466691_041386 Ga0466691_041386_15872_16333 153
242 3300042616 Ga0466715_381436 Ga0466715_381436_1051_1512 153
243 3300042618 Ga0466723_197141 Ga0466723_197141_666_1127 153
244 3300042620 Ga0466728_029704 Ga0466728_029704_5305_5766 153
245 iso_pr_bacteria 2846359427 2846360009 153
246 iso_pr_bacteria 2846379220 2846379987 153
247 iso_pr_bacteria 2849409164 2849411080 153
248 3300002931 CVPL010W_10030794 CVPL010W_100307942 154
249 3300010049 Ga0123356_10014214 Ga0123356_100142145 154
250 3300010049 Ga0123356_10645800 Ga0123356_106458002 154
251 iso_pr_bacteria 2841821538 2841823270 154
252 iso_pr_bacteria 3003178663 3003180949 154
253 3300007129 Ga0102734_1007952 Ga0102734_10079524 155
254 3300007142 Ga0102737_1007739 Ga0102737_10077392 155
255 2065487013 FGTW_contig01490 FGTW_02204170 156
256 3300007068 Ga0103265_1002978 Ga0103265_10029782 156
257 3300007095 Ga0102739_1000013 Ga0102739_100001319 156
258 3300007141 Ga0102738_1000030 Ga0102738_100003033 156
259 3300007141 Ga0102738_1000260 Ga0102738_100026010 156
260 3300012849 Ga0160447_100550 Ga0160447_10055012 156
261 3300042625 Ga0466730_092372 Ga0466730_092372_1433_1903 156
262 2044078006 SPBB_contig02437 SPBB_157900 157
263 3300007067 Ga0103266_1004408 Ga0103266_10044083 157
264 3300007095 Ga0102739_1001838 Ga0102739_10018384 157
265 3300012835 Ga0160446_100014 Ga0160446_100014181 157
266 3300042623 Ga0466734_054595 Ga0466734_054595_5946_6419 157
267 iso_pr_bacteria 2864761044 2864763482 157
268 3300007130 Ga0104042_1001321 Ga0104042_10013212 158
269 3300012818 Ga0160432_100064 Ga0160432_10006416 158
270 3300012829 Ga0160467_100002 Ga0160467_10000280 158
271 3300012847 Ga0160445_100001 Ga0160445_10000144 158
272 3300012848 Ga0160443_100154 Ga0160443_10015479 158
273 3300012858 Ga0160457_1000044 Ga0160457_1000044175 158
274 iso_pr_bacteria 2524614573 2524998361 158
275 3300042582 Ga0466657_393334 Ga0466657_393334_4042_4521 159
276 3300042582 Ga0466657_320718 Ga0466657_320718_1441_1923 160
277 3300042613 Ga0466710_448377 Ga0466710_448377_3222_3704 160
278 2225789004 2227355514 2227800410 162
279 3300012829 Ga0160467_100817 Ga0160467_10081713 163
280 iso_pr_bacteria 2967924226 2967926489 164
281 3300007139 Ga0103260_1000134 Ga0103260_10001342 176
282 3300007141 Ga0102738_1001375 Ga0102738_10013753 176

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00692 dUTPase dUTPase 19 152 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.