Protein Family IF13315
Metagenome
Isolate
282
Members
229
Samples
128
Scaffolds
152.08
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|3003178663|3003180949|
- Length
- 154 aa
- Sequence
- MQAVQVKVLNPKLTQDEAFSLPTRATDGSAGIDLRACIDEPLTIKAGATHLVGTGLAVYIQDPNYAGMILPRSGLGHKHGIVLGNLVGLIDADYQGELMVSIWNRSSQDFILNPAERMAQYIVVPVARPEFEVVSEFSDKSARGAGGFGHSGRQ
Sample Types
Isolate
54.6%
Metagenome
45.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
16.5%
Anthocoridae
8.9%
Formicidae
7.1%
Drosophilidae
6.7%
Termitidae
5.8%
Culicidae
5.4%
Muscidae
5.4%
Curculionidae
4.5%
Calliphoridae
4.0%
Kalotermitidae
4.0%
Elmidae
3.6%
Coreidae
3.6%
Tenebrionidae
3.6%
Apidae
3.1%
Armadillidiidae
3.1%
Aphididae
1.8%
Cerambycidae
1.8%
Rhinotermitidae
1.3%
Sarcophagidae
0.9%
Pteromalidae
0.9%
Tephritidae
0.9%
Ceratophyllidae
0.4%
Pseudococcidae
0.4%
Plutellidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Rhopalidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Siricidae
0.4%
Passalidae
0.4%
Ixodidae
0.4%
Crambidae
0.4%
Pentatomidae
0.4%
Gryllidae
0.4%
Hydrophilidae
0.4%
Daphniidae
0.4%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 2 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 3 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 4 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 5 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 6 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 7 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 8 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 9 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 10 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 16 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 17 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 18 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 19 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 20 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 21 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 22 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 23 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 24 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 25 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 26 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 27 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 28 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 29 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 30 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 31 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 32 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 33 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 34 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 35 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 36 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 37 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 38 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 39 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 40 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 44 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 45 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 46 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 47 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 48 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 49 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 50 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 51 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 52 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 53 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 54 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 55 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 56 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 57 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 58 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 59 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 60 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 61 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 62 | 2958255616 | Serratia marcescens TM | Isolate | |
| 63 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 64 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 65 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 66 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 67 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 68 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 69 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 72 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 73 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 74 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 75 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 76 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 77 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 78 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 79 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 80 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 81 | 3300007766 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut | Metagenome | Drosophilidae |
| 82 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 83 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 84 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 85 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 86 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 87 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 88 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 89 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 90 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 91 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 92 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 93 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 96 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 97 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 98 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 99 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 100 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 101 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 102 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 103 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 104 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 105 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 106 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 107 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 108 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 109 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 110 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 111 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 112 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 113 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 114 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 115 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 116 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 117 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 118 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 119 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 120 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 121 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 122 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 123 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 124 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 125 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 126 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 127 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 128 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 129 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 130 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 131 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 132 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 133 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 134 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 135 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 136 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 137 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 138 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 139 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 140 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 141 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 142 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 143 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 144 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 145 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 146 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 147 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 148 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 149 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 150 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 151 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 152 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 153 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 154 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 155 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 156 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 157 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 158 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 159 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 160 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 161 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 162 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 163 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 164 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 165 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 166 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 167 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 168 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 169 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 170 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 171 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 172 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 173 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 174 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 175 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 176 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 177 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 178 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 179 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 180 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 181 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 182 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 183 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 184 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 185 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 186 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 187 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 188 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 189 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 190 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 191 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 192 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 193 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 194 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 195 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 196 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 197 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 198 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 199 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 200 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 201 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 202 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 203 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 204 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 205 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 206 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 207 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 208 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 209 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 210 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 211 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 212 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 213 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 214 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 215 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 216 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 217 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 218 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 219 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 220 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 221 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 222 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 223 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 224 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 225 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 226 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 227 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 228 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 229 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 2 | Ga0466709_105421 | 3300042648 | Bacteria | 27532 |
| 3 | Ga0466724_05639 | 3300042649 | Unclassified | 7983 |
| 4 | Ga0466715_403366 | 3300042616 | Bacteria | 28580 |
| 5 | Ga0123353_10102605 | 3300010167 | Unclassified | 4611 |
| 6 | Ga0160471_102409 | 3300012812 | Bacteria | 3120 |
| 7 | SWWA_contig05030__length_5583___numreads_125 | 2100351016 | Unclassified | 5583 |
| 8 | 2227355514 | 2225789004 | Bacteria | 1134 |
| 9 | JGI24702J35022_10009039 | 3300002462 | Bacteria | 5614 |
| 10 | Ga0103265_1002978 | 3300007068 | Bacteria | 2552 |
| 11 | Ga0104051_1103694 | 3300007078 | Unclassified | 1479 |
| 12 | Ga0104042_1030173 | 3300007130 | Bacteria | 998 |
| 13 | Ga0102740_1009470 | 3300007140 | Bacteria | 1570 |
| 14 | Ga0102737_1003192 | 3300007142 | Bacteria | 5356 |
| 15 | Ga0160447_100550 | 3300012849 | Bacteria | 17428 |
| 16 | Ga0247290_00147 | 3300035364 | Unclassified | 22143 |
| 17 | Ga0466729_127108 | 3300042621 | Bacteria | 11194 |
| 18 | FGTW_contig01490 | 2065487013 | Bacteria | 48536 |
| 19 | Ga0074311_1146190 | 3300005317 | Bacteria | 1243 |
| 20 | Ga0102734_1000386 | 3300007129 | Bacteria | 14903 |
| 21 | Ga0103260_1000134 | 3300007139 | Bacteria | 17716 |
| 22 | Ga0104019_1002429 | 3300007150 | Bacteria | 3012 |
| 23 | Ga0466657_320718 | 3300042582 | Bacteria | 2750 |
| 24 | Ga0466657_393334 | 3300042582 | Bacteria | 4814 |
| 25 | Ga0466692_175419 | 3300042591 | Bacteria | 3916 |
| 26 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 27 | Ga0466730_028133 | 3300042625 | Unclassified | 19744 |
| 28 | Ga0466724_08036 | 3300042649 | Bacteria | 9259 |
| 29 | Ga0123356_10645800 | 3300010049 | Unclassified | 1225 |
| 30 | CVPL005W_1000085 | 3300002934 | Bacteria | 36605 |
| 31 | Ga0103263_100312 | 3300007042 | Bacteria | 6817 |
| 32 | Ga0103261_1004613 | 3300007083 | Bacteria | 2402 |
| 33 | Ga0102739_1000013 | 3300007095 | Bacteria | 65151 |
| 34 | Ga0104049_1139687 | 3300007103 | Bacteria | 895 |
| 35 | Ga0104042_1130285 | 3300007130 | Unclassified | 998 |
| 36 | Ga0102738_1000260 | 3300007141 | Bacteria | 10459 |
| 37 | Ga0466701_037609 | 3300042598 | Unclassified | 3092 |
| 38 | Ga0466713_126679 | 3300042602 | Bacteria | 66561 |
| 39 | Ga0466722_135096 | 3300042609 | Bacteria | 33731 |
| 40 | Ga0160445_100001 | 3300012847 | Bacteria | 765249 |
| 41 | Ga0265387_1000005 | 3300024582 | Bacteria | 95017 |
| 42 | Ga0466657_066867 | 3300042582 | Bacteria | 21233 |
| 43 | Ga0466657_105709 | 3300042582 | Bacteria | 1133 |
| 44 | Ga0562375_1905 | 3300056856 | Bacteria | 25570 |
| 45 | Ga0466734_054595 | 3300042623 | Bacteria | 10767 |
| 46 | Ga0466730_060325 | 3300042625 | Bacteria | 1833 |
| 47 | Ga0466730_092372 | 3300042625 | Bacteria | 2005 |
| 48 | Ga0466709_409753 | 3300042648 | Bacteria | 9226 |
| 49 | Ga0466725_437641 | 3300042654 | Bacteria | 1862 |
| 50 | Ga0466728_029704 | 3300042620 | Bacteria | 32782 |
| 51 | SPBB_contig02437 | 2044078006 | Unclassified | 1156 |
| 52 | Meta3P_1003262 | 3300002464 | Bacteria | 5248 |
| 53 | CVPL010W_10004864 | 3300002931 | Bacteria | 14703 |
| 54 | Ga0102735_1020647 | 3300007080 | Bacteria | 882 |
| 55 | Ga0104047_1124676 | 3300007088 | Unclassified | 886 |
| 56 | Ga0102739_1001838 | 3300007095 | Bacteria | 3403 |
| 57 | Ga0102739_1002590 | 3300007095 | Unclassified | 2755 |
| 58 | Ga0105005_1189586 | 3300007505 | Bacteria | 652 |
| 59 | Ga0105005_1287710 | 3300007505 | Bacteria | 1503 |
| 60 | Ga0105553_1041596 | 3300007767 | Bacteria | 28063 |
| 61 | Ga0160447_120834 | 3300012849 | Bacteria | 1052 |
| 62 | Ga0466691_041386 | 3300042593 | Bacteria | 26058 |
| 63 | Ga0562377_0587 | 3300056842 | Bacteria | 55342 |
| 64 | Ga0466734_140944 | 3300042623 | Bacteria | 7048 |
| 65 | Ga0466730_102403 | 3300042625 | Bacteria | 6598 |
| 66 | Ga0466703_047465 | 3300042636 | Bacteria | 7955 |
| 67 | Ga0466725_437773 | 3300042654 | Bacteria | 32551 |
| 68 | Ga0466710_448377 | 3300042613 | Bacteria | 17884 |
| 69 | Ga0466711_186348 | 3300042615 | Bacteria | 5147 |
| 70 | Ga0466715_381436 | 3300042616 | Bacteria | 2384 |
| 71 | Ga0466723_197141 | 3300042618 | Bacteria | 10242 |
| 72 | Ga0123355_10283538 | 3300009826 | Bacteria | 2283 |
| 73 | Ga0123354_10080414 | 3300010882 | Bacteria | 4614 |
| 74 | FGTW_contig08319 | 2065487013 | Unclassified | 3391 |
| 75 | Ga0063521_1068365 | 3300003973 | Unclassified | 701 |
| 76 | Ga0063521_1076367 | 3300003973 | Unclassified | 643 |
| 77 | Ga0103266_1004408 | 3300007067 | Bacteria | 1902 |
| 78 | Ga0102737_1000356 | 3300007142 | Bacteria | 15541 |
| 79 | Ga0466707_319735 | 3300042601 | Bacteria | 1300 |
| 80 | Ga0160432_100064 | 3300012818 | Bacteria | 124271 |
| 81 | Ga0160456_100070 | 3300012820 | Bacteria | 144397 |
| 82 | Ga0160443_100154 | 3300012848 | Bacteria | 98725 |
| 83 | Ga0265387_1000754 | 3300024582 | Bacteria | 4959 |
| 84 | Ga0466657_147289 | 3300042582 | Bacteria | 48033 |
| 85 | Ga0466692_177079 | 3300042591 | Bacteria | 65363 |
| 86 | Ga0466734_070958 | 3300042623 | Bacteria | 8225 |
| 87 | Ga0466734_150898 | 3300042623 | Bacteria | 6049 |
| 88 | Ga0466730_039940 | 3300042625 | Unclassified | 9413 |
| 89 | Ga0466730_040222 | 3300042625 | Bacteria | 14131 |
| 90 | Ga0466710_108458 | 3300042613 | Bacteria | 43285 |
| 91 | Ga0063521_1009915 | 3300003973 | Unclassified | 2285 |
| 92 | Ga0104042_1001321 | 3300007130 | Bacteria | 10966 |
| 93 | Ga0102738_1001375 | 3300007141 | Unclassified | 3784 |
| 94 | Ga0104147_1022094 | 3300007224 | Bacteria | 20548 |
| 95 | Ga0105003_1000020 | 3300007766 | Bacteria | 4526 |
| 96 | Ga0160446_100014 | 3300012835 | Bacteria | 270286 |
| 97 | Ga0160433_102819 | 3300012846 | Bacteria | 3480 |
| 98 | Ga0160436_1001873 | 3300012861 | Unclassified | 5567 |
| 99 | Ga0562375_0007 | 3300056856 | Bacteria | 1880046 |
| 100 | Ga0466730_009815 | 3300042625 | Unclassified | 8479 |
| 101 | Ga0466704_420893 | 3300042643 | Bacteria | 12772 |
| 102 | Ga0466724_50987 | 3300042649 | Unclassified | 1045 |
| 103 | FGTW_contig31258 | 2065487013 | Unclassified | 5244 |
| 104 | HBC_ctgsDRAFT_1010920 | 3300000333 | Bacteria | 2167 |
| 105 | Ga0063521_1000233 | 3300003973 | Bacteria | 37861 |
| 106 | Ga0102735_1000301 | 3300007080 | Bacteria | 16768 |
| 107 | Ga0102737_1007739 | 3300007142 | Bacteria | 1939 |
| 108 | Ga0103264_1000458 | 3300007188 | Bacteria | 21026 |
| 109 | Ga0103268_1000948 | 3300007192 | Bacteria | 7834 |
| 110 | Ga0466719_099025 | 3300042606 | Bacteria | 25998 |
| 111 | Ga0160467_100002 | 3300012829 | Bacteria | 1006994 |
| 112 | Ga0160458_110033 | 3300012832 | Bacteria | 1062 |
| 113 | Ga0466657_164977 | 3300042582 | Bacteria | 6106 |
| 114 | Ga0466697_246947 | 3300042611 | Bacteria | 1814 |
| 115 | Ga0123356_10014214 | 3300010049 | Bacteria | 7658 |
| 116 | FGTW_contig31977 | 2065487013 | Unclassified | 3033 |
| 117 | HBC_ctgsDRAFT_1013672 | 3300000333 | Bacteria | 1956 |
| 118 | CVPL010W_10030794 | 3300002931 | Bacteria | 3287 |
| 119 | CVPL010L_1000164 | 3300002932 | Bacteria | 19286 |
| 120 | Ga0104045_1005266 | 3300007085 | Bacteria | 4507 |
| 121 | Ga0102734_1007952 | 3300007129 | Bacteria | 2405 |
| 122 | Ga0103260_1012857 | 3300007139 | Bacteria | 1165 |
| 123 | Ga0102738_1000030 | 3300007141 | Bacteria | 97776 |
| 124 | Ga0102737_1000846 | 3300007142 | Unclassified | 9447 |
| 125 | Ga0466707_024630 | 3300042601 | Bacteria | 2497 |
| 126 | Ga0160468_103025 | 3300012819 | Bacteria | 2490 |
| 127 | Ga0160467_100817 | 3300012829 | Bacteria | 20627 |
| 128 | Ga0160457_1000044 | 3300012858 | Bacteria | 205522 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00692 | dUTPase | dUTPase | 19 | 152 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.