Protein Family IF13229

Metagenome Isolate
202 Members
183 Samples
59 Scaffolds
214.62 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2997878596|2997880750|
Length
235 aa
Sequence
MPEVVKPEAVKPDVSKPDTPQPCDVVVLLSGTGGNLQAMIDSFQDGSSPARIRAVISNRADAYGLERANNAGIETRVLDHKAYEGREAFDTALIELIDSFAPKLVVLAGFMRILTPAFVRHYHGRLLNIHPSLLPLYKGLHTHQRVLEAGDAQHGCSVHFVTEELDGGPLVVQAVISVELHDTPTTLARRVHTQEHLIYPLAIRWFAEGRLALSEHGASLNGQLLGPCGHLLPAT

📊 Sample Types

Isolate 70.8%
Metagenome 29.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.4%
Drosophilidae 12.7%
Elmidae 7.9%
Curculionidae 6.7%
Culicidae 4.2%
Armadillidiidae 3.0%
Termitidae 3.0%
Formicidae 2.4%
Talitridae 1.8%
Tenebrionidae 1.8%
Pteromalidae 1.8%
Palinuridae 1.8%
Cerambycidae 1.2%
Aphididae 1.2%
Calliphoridae 1.2%
Apidae 1.2%
Trigoniulidae 0.6%
Nephropidae 0.6%
Penaeidae 0.6%
Reduviidae 0.6%
Ixodidae 0.6%
Siricidae 0.6%
Majidae 0.6%
Artemiidae 0.6%
Lysianassidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 640963010 Vibrio harveyi HY01 Isolate Unclassified
2 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
3 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
4 8022345672 Vibrio sp. 070316B Isolate Unclassified
5 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
6 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
7 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
8 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
9 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
10 2908136803 Vibrio owensii 1700302 Isolate Unclassified
11 2511231129 Vibrio sp. EJY3 Isolate Unclassified
12 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
13 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
14 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
15 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
16 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
17 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
18 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
19 2703719240 Serratia marcescens ano2 Isolate Unclassified
20 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
21 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
22 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
23 8022096067 Vibrio sp. SALL6 Isolate Unclassified
24 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
25 8051461712 Vibrio vulnificus Vv002 Isolate
26 8052469819 Pseudomonas putida DZ-F23 Isolate
27 8060845732 Vibrio vulnificus Vv006 Isolate
28 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
29 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
30 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
31 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
32 2864791955 Aeromonas veronii S00030 Isolate Elmidae
33 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
34 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
35 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
36 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
37 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
38 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
39 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
40 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
41 2585428048 Colwellia sp. NBT2012 Isolate
42 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
43 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
44 2684622551 Vibrio campbellii E1 Isolate Unclassified
45 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
46 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
47 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
48 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
49 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
50 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
51 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
52 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
53 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
54 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
55 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
56 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
57 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
58 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
59 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
60 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
61 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
62 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
63 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
64 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
65 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
66 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
67 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
68 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
69 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
70 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
71 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
72 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
73 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
74 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
75 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
76 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
77 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
78 8051534459 Vibrio vulnificus Vv004 Isolate
79 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
80 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
81 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
82 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
83 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
84 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
85 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
86 2585427605 Colwellia sp. MT2012 Isolate
87 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
88 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
89 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
90 2791355473 Vibrio barjaei 3062 Isolate Unclassified
91 3000861951 Budvicia diplopodorum D9 Isolate
92 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
93 3006242587 Vibrio sp. RE86 Isolate Unclassified
94 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
95 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
96 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
97 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
98 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
99 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
100 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
101 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
102 8022087107 Vibrio sp. OULL4 Isolate Unclassified
103 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
104 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
105 2850895757 Vibrio campbellii 170502 Isolate Unclassified
106 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
107 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
108 2872471378 Vibrio owensii V180403 Isolate Unclassified
109 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
110 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
111 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
112 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
113 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
114 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
115 3300009478 Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov Metagenome
116 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
117 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
118 637000219 Pseudomonas entomophila L48 Isolate Unclassified
119 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
120 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
121 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
122 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
123 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
124 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
125 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
126 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
127 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
128 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
129 2505679062 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
130 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
131 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
132 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
133 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
134 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
135 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
136 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
137 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
138 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
139 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
140 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
141 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
142 651285005 Serratia symbiotica Tuscon Isolate Aphididae
143 8035422605 Pseudomonas monteilii CY06 Isolate
144 8051551332 Vibrio vulnificus Vv003 Isolate
145 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
146 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
147 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
148 2912570088 Vibrio parahaemolyticus CHN25 Isolate
149 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
150 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
151 2554235022 Vibrio parahaemolyticus v110 Isolate
152 2585427711 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
153 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
154 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
155 2703719239 Serratia marcescens ano1 Isolate Unclassified
156 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
157 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
158 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
159 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
160 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
161 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
162 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
163 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
164 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
165 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
166 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
167 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
168 2864768727 Aeromonas veronii S00020 Isolate Elmidae
169 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
170 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
171 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
172 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
173 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
174 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
175 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
176 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
177 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
178 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
179 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
180 2718217944 Serratia marcescens AS1 Isolate Culicidae
181 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
182 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
183 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 DPO_contig09256 2032320009 Bacteria 18326
2 Ga0104040_1155727 3300007149 Bacteria 1010
3 Ga0105005_1039398 3300007505 Bacteria 23432
4 Ga0466701_102488 3300042598 Bacteria 117881
5 Ga0466717_020321 3300042604 Bacteria 6485
6 Ga0466724_11674 3300042649 Unclassified 17516
7 Ga0466724_27463 3300042649 Unclassified 8013
8 Ga0160456_100373 3300012820 Bacteria 16044
9 DPOL_contig18631 2035918003 Bacteria 49264
10 Ga0160433_100119 3300012846 Bacteria 74337
11 Meta3P_1004819 3300002464 Unclassified 8054
12 Ga0102734_1001199 3300007129 Bacteria 6569
13 Ga0466701_103106 3300042598 Bacteria 35693
14 Ga0562378_0288 3300056814 Bacteria 106393
15 Ga0562377_0001 3300056842 Bacteria 5082480
16 Meta3P_1000465 3300002464 Bacteria 26510
17 CVPL010L_1003199 3300002932 Unclassified 1899
18 Ga0103264_1000467 3300007188 Bacteria 42232
19 Ga0127656_100320 3300009453 Bacteria 24091
20 Ga0160470_100651 3300012813 Unclassified 11687
21 Ga0160441_100777 3300012825 Bacteria 16693
22 Ga0562379_0001 3300056790 Bacteria 4904077
23 SPBB_contig11507 2044078006 Bacteria 117601
24 Ga0104041_1002457 3300007106 Bacteria 12585
25 Ga0127524_173303 3300009478 Bacteria 1226
26 Ga0466730_076174 3300042625 Bacteria 1325
27 Ga0466724_08972 3300042649 Bacteria 58576
28 Ga0466724_30137 3300042649 Bacteria 6533
29 DPO_contig08759 2032320009 Unclassified 12927
30 DPOL_contig18765 2035918003 Bacteria 16169
31 Ga0074188_1000378 3300005318 Bacteria 15132
32 Ga0104049_1137602 3300007103 Bacteria 1010
33 Ga0105005_1026430 3300007505 Bacteria 5534
34 Ga0127645_109031 3300009461 Bacteria 20576
35 Ga0466701_052319 3300042598 Bacteria 107579
36 Ga0466730_015129 3300042625 Bacteria 3317
37 Ga0466730_020598 3300042625 Unclassified 1913
38 Ga0466724_64900 3300042649 Bacteria 3217
39 Ga0160447_100391 3300012849 Bacteria 21857
40 Ga0123353_10057488 3300010167 Unclassified 6231
41 Ga0160465_100542 3300012803 Unclassified 16822
42 FGTW_contig30515 2065487013 Bacteria 19946
43 SWWA_contig31635__length_57763___numreads_3216 2100351016 Bacteria 57763
44 Ga0074302_1142760 3300005316 Unclassified 1014
45 Ga0104041_1117318 3300007106 Unclassified 1207
46 Ga0466730_032652 3300042625 Unclassified 8295
47 Ga0160467_101827 3300012829 Unclassified 6469
48 Ga0160455_106249 3300012837 Bacteria 1222
49 Ga0160435_1001571 3300012857 Unclassified 5761
50 Ga0316159_10004 3300030930 Bacteria 218282
51 Ga0160454_100247 3300012798 Bacteria 52886
52 SPBB_contig08588 2044078006 Unclassified 1121
53 SPBB_contig11550 2044078006 Bacteria 46395
54 Ga0063521_1000075 3300003973 Bacteria 80955
55 Ga0104041_1110790 3300007106 Bacteria 2381
56 Ga0466724_41843 3300042649 Bacteria 3415
57 Ga0160445_100843 3300012847 Bacteria 11186
58 Ga0160448_101750 3300012854 Bacteria 6936
59 Ga0160448_104601 3300012854 Bacteria 3800

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002464 Meta3P_1000465 Meta3P_100046511 199
2 3300007129 Ga0102734_1001199 Ga0102734_10011996 203
3 3300007188 Ga0103264_1000467 Ga0103264_100046746 207
4 iso_pr_bacteria 2820856540 2820857677 207
5 3300010167 Ga0123353_10057488 Ga0123353_100574886 208
6 iso_pr_bacteria 2731957969 2734001555 209
7 iso_pr_bacteria 2529292851 2530233392 211
8 iso_pr_bacteria 2896187957 2896191008 211
9 2035918003 DPOL_contig18765 DPOLB_523320 212
10 3300009478 Ga0127524_173303 Ga0127524_1733032 212
11 3300030930 Ga0316159_10004 Ga0316159_10004147 212
12 3300042604 Ga0466717_020321 Ga0466717_020321_1806_2444 212
13 3300042625 Ga0466730_032652 Ga0466730_032652_7254_7892 212
14 3300042625 Ga0466730_076174 Ga0466730_076174_284_922 212
15 3300042649 Ga0466724_11674 Ga0466724_11674_2558_3196 212
16 3300042649 Ga0466724_27463 Ga0466724_27463_1086_1724 212
17 3300042649 Ga0466724_30137 Ga0466724_30137_2493_3131 212
18 iso_pr_bacteria 2531839005 2531865572 212
19 iso_pr_bacteria 2571042430 2572514800 212
20 iso_pr_bacteria 2571042554 2572925566 212
21 iso_pr_bacteria 2597489902 2597921500 212
22 iso_pr_bacteria 2597489903 2597925487 212
23 iso_pr_bacteria 2600255074 2600847505 212
24 iso_pr_bacteria 2609459925 2610645489 212
25 iso_pr_bacteria 2609459958 2610823194 212
26 iso_pr_bacteria 2627853677 2628493695 212
27 iso_pr_bacteria 2627854002 2629834330 212
28 iso_pr_bacteria 2630968716 2632956921 212
29 iso_pr_bacteria 2636415542 2636992633 212
30 iso_pr_bacteria 2636415586 2637166355 212
31 iso_pr_bacteria 2648501158 2648750359 212
32 iso_pr_bacteria 2648501820 2651398509 212
33 iso_pr_bacteria 2651870110 2653796080 212
34 iso_pr_bacteria 2654587515 2654660969 212
35 iso_pr_bacteria 2667527887 2669889328 212
36 iso_pr_bacteria 2684622551 2684818288 212
37 iso_pr_bacteria 2703719239 2706053186 212
38 iso_pr_bacteria 2703719240 2706058510 212
39 iso_pr_bacteria 2718217944 2719464228 212
40 iso_pr_bacteria 2731957638 2732532609 212
41 iso_pr_bacteria 2791355473 2794383491 212
42 iso_pr_bacteria 2820369699 2820371583 212
43 iso_pr_bacteria 2835335304 2835339808 212
44 iso_pr_bacteria 2837516909 2837517651 212
45 iso_pr_bacteria 2841260384 2841261281 212
46 iso_pr_bacteria 2847708326 2847712281 212
47 iso_pr_bacteria 2850131454 2850132944 212
48 iso_pr_bacteria 2850895757 2850898143 212
49 iso_pr_bacteria 2859315706 2859318447 212
50 iso_pr_bacteria 2864764899 2864765062 212
51 iso_pr_bacteria 2864768727 2864769594 212
52 iso_pr_bacteria 2864777284 2864778378 212
53 iso_pr_bacteria 2864791955 2864792274 212
54 iso_pr_bacteria 2864796242 2864796914 212
55 iso_pr_bacteria 2872471378 2872471794 212
56 iso_pr_bacteria 2877638525 2877641337 212
57 iso_pr_bacteria 2896925746 2896929758 212
58 iso_pr_bacteria 2908136803 2908137656 212
59 iso_pr_bacteria 640963010 641030647 212
60 iso_pr_bacteria 651285005 651303997 212
61 iso_pr_bacteria 8008122225 8008127757 212
62 iso_pr_bacteria 8042061949 8042063257 212
63 iso_pr_bacteria 8051461712 8051465536 212
64 iso_pr_bacteria 8051534459 8051535038 212
65 iso_pr_bacteria 8051551332 8051553546 212
66 iso_pr_bacteria 8060845732 8060850400 212
67 iso_pr_bacteria 8062647588 8062647958 212
68 iso_pr_bacteria 8101676404 8101677477 212
69 iso_pr_bacteria 8101680043 8101681343 212
70 iso_pr_bacteria 8101683685 8101685100 212
71 iso_pr_bacteria 8116627632 8116632401 212
72 3300002932 CVPL010L_1003199 CVPL010L_10031991 213
73 3300003973 Ga0063521_1000075 Ga0063521_100007541 213
74 3300005318 Ga0074188_1000378 Ga0074188_100037814 213
75 3300007106 Ga0104041_1002457 Ga0104041_10024579 213
76 3300007149 Ga0104040_1155727 Ga0104040_11557271 213
77 3300007505 Ga0105005_1039398 Ga0105005_10393986 213
78 3300056790 Ga0562379_0001 Ga0562379_0001_1732290_1732931 213
79 3300056814 Ga0562378_0288 Ga0562378_0288_48584_49225 213
80 3300056842 Ga0562377_0001 Ga0562377_0001_83637_84278 213
81 iso_pr_bacteria 2501651205 2501713575 213
82 iso_pr_bacteria 2510065003 2510075714 213
83 iso_pr_bacteria 2565956518 2566026175 213
84 iso_pr_bacteria 2585427605 2585887738 213
85 iso_pr_bacteria 2585428048 2587692438 213
86 iso_pr_bacteria 2711768158 2712481797 213
87 iso_pr_bacteria 2744054871 2745950196 213
88 iso_pr_bacteria 2791355471 2794376403 213
89 iso_pr_bacteria 2844251356 2844253377 213
90 iso_pr_bacteria 2868883784 2868885964 213
91 iso_pr_bacteria 2900349738 2900350491 213
92 iso_pr_bacteria 2902451016 2902453239 213
93 iso_pr_bacteria 2902469402 2902472643 213
94 iso_pr_bacteria 2989793055 2989795264 213
95 iso_pr_bacteria 3006225627 3006229476 213
96 iso_pr_bacteria 3006242587 3006244552 213
97 iso_pr_bacteria 8033364368 8033368438 213
98 iso_pr_bacteria 8033368880 8033370339 213
99 3300009461 Ga0127645_109031 Ga0127645_1090315 214
100 3300042649 Ga0466724_08972 Ga0466724_08972_39812_40456 214
101 iso_pr_bacteria 2510065002 2510072416 214
102 iso_pr_bacteria 2524614872 2526112455 214
103 iso_pr_bacteria 2582581321 2585352179 214
104 iso_pr_bacteria 2833478085 2833481281 214
105 iso_pr_bacteria 2836755666 2836758145 214
106 iso_pr_bacteria 2858407585 2858407602 214
107 iso_pr_bacteria 2864944480 2864946793 214
108 iso_pr_bacteria 2873884416 2873887395 214
109 iso_pr_bacteria 8048923410 8048924127 214
110 iso_pr_bacteria 8048928574 8048929323 214
111 3300005316 Ga0074302_1142760 Ga0074302_11427601 215
112 3300007106 Ga0104041_1110790 Ga0104041_11107902 215
113 3300042598 Ga0466701_103106 Ga0466701_103106_18530_19177 215
114 iso_pr_bacteria 2511231129 2511731861 215
115 iso_pr_bacteria 2551306507 2553349971 215
116 iso_pr_bacteria 2554235022 2554338642 215
117 iso_pr_bacteria 2663763317 2666537557 215
118 iso_pr_bacteria 2667527830 2669648095 215
119 iso_pr_bacteria 2693429575 2693740921 215
120 iso_pr_bacteria 2700989396 2702441804 215
121 iso_pr_bacteria 2785510762 2785803456 215
122 iso_pr_bacteria 2860776474 2860777226 215
123 iso_pr_bacteria 2875320051 2875320963 215
124 iso_pr_bacteria 2877647439 2877648214 215
125 iso_pr_bacteria 2880115952 2880118492 215
126 iso_pr_bacteria 2902438364 2902439565 215
127 iso_pr_bacteria 2902896024 2902898874 215
128 iso_pr_bacteria 2912570088 2912572404 215
129 iso_pr_bacteria 2987233858 2987235980 215
130 iso_pr_bacteria 2997380424 2997381466 215
131 iso_pr_bacteria 3000861951 3000862136 215
132 iso_pr_bacteria 8022087107 8022087832 215
133 iso_pr_bacteria 8022096067 8022098408 215
134 2032320009 DPO_contig08759 DPOB_460740 216
135 2032320009 DPO_contig09256 DPOB_186940 216
136 2035918003 DPOL_contig18631 DPOLB_2288180 216
137 2044078006 SPBB_contig08588 SPBB_403470 216
138 2044078006 SPBB_contig11507 SPBB_276020 216
139 2044078006 SPBB_contig11550 SPBB_411700 216
140 2100351016 SWWA_contig31635__length_57763___numreads_3216 SWWA_01884010 216
141 3300042625 Ga0466730_015129 Ga0466730_015129_190_840 216
142 3300042625 Ga0466730_020598 Ga0466730_020598_903_1553 216
143 iso_pr_bacteria 2519899622 2520391637 216
144 iso_pr_bacteria 2671180705 2673868764 216
145 iso_pr_bacteria 2864739902 2864741284 216
146 iso_pr_bacteria 2864745180 2864745606 216
147 iso_pr_bacteria 2864847319 2864847917 216
148 iso_pr_bacteria 2864853652 2864853896 216
149 iso_pr_bacteria 2864926767 2864929537 216
150 iso_pr_bacteria 3001459110 3001461614 216
151 3300002464 Meta3P_1004819 Meta3P_10048197 217
152 3300007103 Ga0104049_1137602 Ga0104049_11376022 217
153 3300007106 Ga0104041_1117318 Ga0104041_11173182 217
154 3300012798 Ga0160454_100247 Ga0160454_10024742 217
155 3300012813 Ga0160470_100651 Ga0160470_10065113 217
156 3300012820 Ga0160456_100373 Ga0160456_10037317 217
157 3300012829 Ga0160467_101827 Ga0160467_1018272 217
158 3300012847 Ga0160445_100843 Ga0160445_1008438 217
159 3300012854 Ga0160448_101750 Ga0160448_1017507 217
160 3300042598 Ga0466701_052319 Ga0466701_052319_40133_40786 217
161 3300042598 Ga0466701_102488 Ga0466701_102488_54069_54722 217
162 3300042649 Ga0466724_41843 Ga0466724_41843_1689_2342 217
163 3300042649 Ga0466724_64900 Ga0466724_64900_1673_2326 217
164 iso_pr_bacteria 2990166910 2990166963 217
165 iso_pr_bacteria 3007473699 3007474593 217
166 iso_pr_bacteria 3007478678 3007483595 217
167 iso_pr_bacteria 637000219 638000430 217
168 iso_pr_bacteria 8011329375 8011330394 217
169 iso_pr_bacteria 8035422605 8035424185 217
170 iso_pr_bacteria 8052469819 8052470296 217
171 3300012803 Ga0160465_100542 Ga0160465_1005422 218
172 3300012825 Ga0160441_100777 Ga0160441_1007772 218
173 3300012846 Ga0160433_100119 Ga0160433_10011914 218
174 3300012849 Ga0160447_100391 Ga0160447_1003915 218
175 iso_pr_bacteria 3001462594 3001464332 218
176 iso_pr_bacteria 3002773460 3002773639 218
177 iso_pr_bacteria 8022439116 8022442562 218
178 iso_pr_bacteria 8065462725 8065464341 218
179 iso_pr_bacteria 8065466226 8065468128 218
180 iso_pr_bacteria 8065469765 8065471541 218
181 iso_pr_bacteria 8074288691 8074290331 218
182 iso_pr_bacteria 8074292191 8074293960 218
183 iso_pr_bacteria 648861007 648921833 219
184 2065487013 FGTW_contig30515 FGTW_01174020 220
185 3300009453 Ga0127656_100320 Ga0127656_1003205 220
186 iso_pr_bacteria 2505679062 2505924740 220
187 iso_pr_bacteria 2585427711 2586306551 220
188 iso_pr_bacteria 2902916284 2902918916 220
189 iso_pr_bacteria 8011357093 8011360656 220
190 iso_pr_bacteria 8035321120 8035323223 220
191 iso_pr_bacteria 8035326735 8035328406 220
192 3300012837 Ga0160455_106249 Ga0160455_1062492 221
193 3300012857 Ga0160435_1001571 Ga0160435_10015713 221
194 iso_pr_bacteria 2524614573 2524999018 222
195 iso_pr_bacteria 2864751016 2864754768 222
196 iso_pr_bacteria 2864903489 2864908288 222
197 iso_pr_bacteria 2912636047 2912637171 224
198 iso_pr_bacteria 8022116796 8022118673 224
199 iso_pr_bacteria 8022345672 8022346743 224
200 3300012854 Ga0160448_104601 Ga0160448_1046013 226
201 3300007505 Ga0105005_1026430 Ga0105005_10264308 231
202 iso_pr_bacteria 2997878596 2997880750 235

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00551 Formyl_trans_N Formyl transferase 25 203 0.99

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00551 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.