Protein Family IF13227

Metagenome Isolate
302 Members
273 Samples
67 Scaffolds
339.44 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2997380424|2997381594|
Length
379 aa
Sequence
MPFFIELNISSDDFHMLCAEPRISRLFRYIIPPLFPYMKEKTMTRKHIYIAYTGGTIGMLKSDHGYVPIAGFMEKQLASMPEFHRPEMPEYTIHEYDPLIDSSDMTPADWQQIADDIRDNYDKYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQANLLNALHIAANYPINEVTLFFNNQLMRGNRSTKSHADGFNAFTSPNLPPLLEAGINIQISNSIKVNAQPEGEFKVHNITPQPIGVITMYPGISHEVIRNTLLQPVNAMILLTFGVGNAPQNPELLGHLKEASERGVIVVNLTQCLAGKVNMGGYATGCALADAGVISGYDMTPEAALAKLHFLLSQNLSYEEVKEKMQEVLRGEMSL

πŸ“Š Sample Types

Isolate 77.8%
Metagenome 22.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 34.1%
Aphididae 9.8%
Anthocoridae 8.2%
Drosophilidae 7.8%
Muscidae 4.7%
Tenebrionidae 3.9%
Curculionidae 3.9%
Calliphoridae 3.5%
Culicidae 2.7%
Elmidae 2.0%
Apidae 1.6%
Cerambycidae 1.6%
Palinuridae 1.2%
Termitidae 1.2%
Talitridae 1.2%
Pteromalidae 1.2%
Tephritidae 1.2%
Sarcophagidae 0.8%
Armadillidiidae 0.8%
Pentatomidae 0.8%
Formicidae 0.8%
Passalidae 0.8%
Majidae 0.8%
Scarabaeidae 0.4%
Ceratophyllidae 0.4%
Nephropidae 0.4%
Lysianassidae 0.4%
Daphniidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Artemiidae 0.4%
Crambidae 0.4%
Reduviidae 0.4%
Rhopalidae 0.4%
Penaeidae 0.4%
Plutellidae 0.4%
Carabidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 282
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2511231129 Vibrio sp. EJY3 Isolate Unclassified
2 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
3 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
4 2558860197 Buchnera aphidicola F009 Isolate Aphididae
5 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
6 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
7 2645727860 Winslowiella iniecta B120 Isolate Aphididae
8 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
9 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
10 2703719240 Serratia marcescens ano2 Isolate Unclassified
11 2834887098 Buchnera aphidicola LNK Isolate Aphididae
12 2871771314 Pantoea sp. Ae16 Isolate Culicidae
13 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
14 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
15 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
16 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
17 2908136803 Vibrio owensii 1700302 Isolate Unclassified
18 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
19 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
20 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
21 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
22 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
23 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
24 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
25 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
26 3300009468 Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov Metagenome Aphididae
27 3300009534 Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov Metagenome
28 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
29 640963010 Vibrio harveyi HY01 Isolate Unclassified
30 648276708 Pantoea sp. aB Isolate Unclassified
31 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
32 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
33 8022345672 Vibrio sp. 070316B Isolate Unclassified
34 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
35 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
36 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
37 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
38 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
39 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
40 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
41 2558860195 Buchnera aphidicola G002 Isolate Aphididae
42 2574179716 Serratia sp. DD3 Isolate Daphniidae
43 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
44 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
45 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
46 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
47 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
48 2654587723 Buchnera aphidicola (Aphis glycines) BAg Isolate Aphididae
49 2718217944 Serratia marcescens AS1 Isolate Culicidae
50 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
51 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
52 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
53 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
54 2864768727 Aeromonas veronii S00020 Isolate Elmidae
55 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
56 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
57 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
58 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
59 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
60 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
61 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
62 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
63 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
64 3300009456 Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov Metagenome
65 3300009458 Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov Metagenome
66 3300009533 Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov Metagenome
67 3300009535 Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov Metagenome Aphididae
68 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
69 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
70 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
71 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
72 8076029003 Erwinia haradaeae ErCipiceae/3303 Isolate Aphididae
73 8076031238 Erwinia haradaeae ErCicurtihirsuta/3053 Isolate Aphididae
74 8100176769 Kosakonia sp. S57 Isolate Curculionidae
75 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
76 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
77 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
78 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
79 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
80 2850895757 Vibrio campbellii 170502 Isolate Unclassified
81 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
82 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
83 2872471378 Vibrio owensii V180403 Isolate Unclassified
84 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
85 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
86 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
87 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
88 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
89 2958255616 Serratia marcescens TM Isolate
90 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
91 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
92 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
93 3300009477 Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov Metagenome
94 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
95 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
96 651324086 Plautia crossota stali symbiont Isolate Unclassified
97 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
98 8022087107 Vibrio sp. OULL4 Isolate Unclassified
99 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
100 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
101 8071333649 Escherichia coli PN108 Isolate Calliphoridae
102 8071338694 Escherichia coli PN87 Isolate Calliphoridae
103 8102982778 Erwinia sp. S63 Isolate Curculionidae
104 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
105 2558860196 Buchnera aphidicola W106 Isolate Aphididae
106 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
107 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
108 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
109 2836714267 Shimwellia blattae NCTC10965 Isolate
110 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
111 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
112 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
113 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
114 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
115 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
116 2971189173 Yersinia pestis A-1249 Isolate Unclassified
117 2984883310 Serratia symbiotica SCifornacula/2912 Isolate Aphididae
118 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
119 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
120 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
121 8021546568 Klebsiella sp. Kps Isolate Tephritidae
122 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
123 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
124 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
125 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
126 8071322446 Escherichia coli PN122 Isolate Calliphoridae
127 8076033509 Erwinia haradaeae ErCicuneomaculata/2628 Isolate Aphididae
128 8100171289 Kosakonia sp. S42 Isolate Curculionidae
129 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
130 8103002986 Erwinia sp. S38 Isolate Curculionidae
131 8103008710 Erwinia sp. S43 Isolate Curculionidae
132 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
133 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
134 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
135 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
136 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
137 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
138 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
139 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
140 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
141 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
142 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
143 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
144 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
145 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
146 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
147 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
148 2937735258 Serratia marcescens KZ11 Isolate Apidae
149 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
150 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
151 2978102237 Serratia fonticola AeS1 Isolate Culicidae
152 3007994558 Escherichia alba B35 Isolate Tenebrionidae
153 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
154 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
155 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
156 3300009463 Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov Metagenome
157 3300009539 Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov Metagenome Aphididae
158 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
159 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
160 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
161 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
162 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
163 8076029720 Erwinia haradaeae ErCisplendens/3004 Isolate Aphididae
164 8100181737 Kosakonia sp. S58 Isolate Curculionidae
165 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
166 2585428048 Colwellia sp. NBT2012 Isolate
167 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
168 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
169 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
170 2684622551 Vibrio campbellii E1 Isolate Unclassified
171 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
172 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
173 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
174 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
175 2864791955 Aeromonas veronii S00030 Isolate Elmidae
176 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
177 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
178 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
179 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
180 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
181 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
182 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
183 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
184 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
185 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
186 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
187 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
188 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
189 3300009531 Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov Metagenome Aphididae
190 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
191 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
192 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
193 8022096067 Vibrio sp. SALL6 Isolate Unclassified
194 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
195 8051461712 Vibrio vulnificus Vv002 Isolate
196 8060845732 Vibrio vulnificus Vv006 Isolate
197 8071343737 Escherichia coli PN119 Isolate Calliphoridae
198 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
199 8076028257 Erwinia haradaeae ErCisplendens/pseudotsugae/3390 Isolate Aphididae
200 8076047169 Erwinia haradaeae ErCipseudotsugae/2889 Isolate Aphididae
201 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
202 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
203 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
204 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
205 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
206 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
207 2558860194 Buchnera aphidicola USDA Isolate Aphididae
208 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
209 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
210 2648501209 Winslowiella iniecta B149 Isolate Aphididae
211 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
212 2703719239 Serratia marcescens ano1 Isolate Unclassified
213 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
214 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
215 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
216 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
217 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
218 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
219 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
220 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
221 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
222 2912570088 Vibrio parahaemolyticus CHN25 Isolate
223 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
224 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
225 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
226 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
227 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
228 651285005 Serratia symbiotica Tuscon Isolate Aphididae
229 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
230 8004541719 Serratia marcescens KZ19 Isolate Apidae
231 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
232 8051551332 Vibrio vulnificus Vv003 Isolate
233 8076030444 Erwinia haradaeae ErCilaricifoliae/3058 Isolate Aphididae
234 8076031980 Erwinia haradaeae ErCikochiana/2762 Isolate Aphididae
235 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
236 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
237 2511231206 Buchnera aphidicola Ak Isolate Aphididae
238 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
239 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
240 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
241 2585427605 Colwellia sp. MT2012 Isolate
242 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
243 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
244 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
245 2751185823 Erwinia haradaeae 3056 Isolate Aphididae
246 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
247 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
248 2791355473 Vibrio barjaei 3062 Isolate Unclassified
249 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
250 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
251 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
252 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
253 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
254 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
255 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
256 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
257 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
258 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
259 2978161719 Serratia marcescens KZ2 Isolate Apidae
260 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
261 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
262 3006242587 Vibrio sp. RE86 Isolate Unclassified
263 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
264 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
265 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
266 8018312681 Enterobacter sp. OLF Isolate Tephritidae
267 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
268 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
269 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
270 8051534459 Vibrio vulnificus Vv004 Isolate
271 8076032775 Erwinia haradaeae ErCicurvipes/3402 Isolate Aphididae
272 8099192374 Erwinia typographi IC4 Isolate Curculionidae
273 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466724_28634 3300042649 Bacteria 8268
2 Ga0466724_52809 3300042649 Bacteria 17866
3 Ga0265387_1000060 3300024582 Bacteria 33940
4 HBC_ctgsDRAFT_1004349 3300000333 Bacteria 3279
5 Meta3P_1000267 3300002464 Bacteria 49386
6 Ga0074188_1000294 3300005318 Bacteria 24592
7 Ga0104040_1142060 3300007149 Bacteria 4281
8 Ga0104147_1013055 3300007224 Bacteria 10171
9 Ga0466730_003525 3300042625 Bacteria 46259
10 Ga0466730_025636 3300042625 Unclassified 1850
11 DPOL_contig10900 2035918003 Bacteria 2933
12 IMNBL1DRAFT_c0003893 3300000062 Bacteria 9265
13 Meta3P_1001421 3300002464 Bacteria 7726
14 Ga0063521_1002515 3300003973 Unclassified 4473
15 Ga0562379_0001 3300056790 Bacteria 4904077
16 Ga0562378_0338 3300056814 Bacteria 91857
17 Ga0562376_0001 3300056857 Bacteria 4828905
18 Ga0466730_017916 3300042625 Unclassified 4423
19 Ga0466730_065282 3300042625 Unclassified 7040
20 Ga0247289_0489 3300035363 Unclassified 5799
21 Ga0466707_096100 3300042601 Bacteria 163276
22 Ga0466713_099611 3300042602 Unclassified 3776
23 Ga0063521_1000017 3300003973 Bacteria 143248
24 Ga0063521_1000056 3300003973 Bacteria 99837
25 Ga0127645_101788 3300009461 Unclassified 2360
26 Ga0466724_30696 3300042649 Unclassified 9134
27 Ga0466707_143369 3300042601 Unclassified 2791
28 FGTW_contig30935 2065487013 Unclassified 7431
29 CVPL010L_1000548 3300002932 Unclassified 7778
30 Ga0127644_100036 3300009463 Bacteria 636219
31 Ga0127530_100162 3300009468 Bacteria 26462
32 Ga0127530_101165 3300009468 Bacteria 10994
33 Ga0562378_0018 3300056814 Bacteria 860182
34 Ga0562377_0054 3300056842 Bacteria 518542
35 Ga0160433_102243 3300012846 Bacteria 4313
36 Ga0105005_1003412 3300007505 Bacteria 3009
37 Ga0127526_1000110 3300009535 Bacteria 643549
38 Ga0562377_0066 3300056842 Bacteria 455762
39 Ga0466724_68893 3300042649 Unclassified 2717
40 Ga0316159_10420 3300030930 Unclassified 6641
41 Ga0466701_026127 3300042598 Bacteria 91784
42 Ga0466713_112824 3300042602 Bacteria 48577
43 FGTW_contig05871 2065487013 Unclassified 4765
44 2227507945 2225789004 Bacteria 72134
45 Ga0063521_1000032 3300003973 Bacteria 118735
46 Ga0105553_1042061 3300007767 Unclassified 4535
47 Ga0127523_100016 3300009456 Bacteria 642955
48 Ga0127648_100010 3300009534 Bacteria 473475
49 Ga0127521_100003 3300009539 Bacteria 647534
50 Ga0160460_100010 3300012845 Bacteria 503980
51 Ga0316159_11684 3300030930 Bacteria 2674
52 Ga0466713_139973 3300042602 Bacteria 49584
53 DPOL_contig03311 2035918003 Unclassified 10789
54 Ga0127646_100058 3300009458 Bacteria 571963
55 Ga0127522_100011 3300009477 Bacteria 644448
56 Ga0127528_1000015 3300009533 Bacteria 619772
57 Ga0466724_12489 3300042649 Bacteria 79172
58 Ga0466724_26052 3300042649 Bacteria 121987
59 Ga0160469_100029 3300012824 Unclassified 283547
60 Ga0265387_1001063 3300024582 Unclassified 4083
61 FGTW_contig30509 2065487013 Unclassified 20457
62 CVPL010L_1000723 3300002932 Bacteria 10986
63 CVPL010L_1002213 3300002932 Unclassified 2522
64 Ga0063521_1000002 3300003973 Bacteria 391466
65 Ga0063521_1000104 3300003973 Bacteria 66158
66 Ga0127645_100025 3300009461 Bacteria 631301
67 Ga0127525_100070 3300009531 Bacteria 646221

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042649 Ga0466724_68893 Ga0466724_68893_15_986 310
2 iso_pr_bacteria 2551306520 2553399650 321
3 iso_pr_bacteria 2551306520 2553401069 321
4 iso_pr_bacteria 2558860194 2559122227 321
5 iso_pr_bacteria 2597489903 2597925404 323
6 3300042649 Ga0466724_28634 Ga0466724_28634_2270_3289 328
7 3300003973 Ga0063521_1000002 Ga0063521_10000026 329
8 3300009534 Ga0127648_100010 Ga0127648_100010428 331
9 iso_pr_bacteria 2864764899 2864766643 335
10 iso_pr_bacteria 2864768727 2864769999 335
11 iso_pr_bacteria 2864777284 2864780385 335
12 iso_pr_bacteria 2864791955 2864792854 335
13 iso_pr_bacteria 2864796242 2864796371 335
14 iso_pr_bacteria 2889908211 2889911070 335
15 iso_pr_bacteria 2671180705 2673867826 336
16 iso_pr_bacteria 2858407585 2858412550 336
17 iso_pr_bacteria 2873884416 2873888016 336
18 iso_pr_bacteria 2902896024 2902896999 336
19 iso_pr_bacteria 2902916284 2902920994 336
20 iso_pr_bacteria 8048923410 8048925892 336
21 iso_pr_bacteria 8048928574 8048931078 336
22 2065487013 FGTW_contig30509 FGTW_01122310 337
23 3300007149 Ga0104040_1142060 Ga0104040_11420602 337
24 3300030930 Ga0316159_11684 Ga0316159_116844 337
25 3300056814 Ga0562378_0338 Ga0562378_0338_75292_76305 337
26 iso_pr_bacteria 2501651205 2501714106 337
27 iso_pr_bacteria 2511231129 2511731707 337
28 iso_pr_bacteria 2531839005 2531865239 337
29 iso_pr_bacteria 2558860195 2559122834 337
30 iso_pr_bacteria 2558860196 2559123449 337
31 iso_pr_bacteria 2558860197 2559124057 337
32 iso_pr_bacteria 2571042430 2572515862 337
33 iso_pr_bacteria 2571042554 2572925805 337
34 iso_pr_bacteria 2585427605 2585888207 337
35 iso_pr_bacteria 2585428048 2587692896 337
36 iso_pr_bacteria 2600255074 2600845572 337
37 iso_pr_bacteria 2609459925 2610645366 337
38 iso_pr_bacteria 2609459958 2610824061 337
39 iso_pr_bacteria 2619619082 2620614115 337
40 iso_pr_bacteria 2627853677 2628493994 337
41 iso_pr_bacteria 2627854002 2629835287 337
42 iso_pr_bacteria 2630968716 2632955582 337
43 iso_pr_bacteria 2636415542 2636992364 337
44 iso_pr_bacteria 2636415586 2637166865 337
45 iso_pr_bacteria 2645727860 2647288842 337
46 iso_pr_bacteria 2648501209 2648985448 337
47 iso_pr_bacteria 2648501820 2651397061 337
48 iso_pr_bacteria 2654587515 2654657214 337
49 iso_pr_bacteria 2667527887 2669889191 337
50 iso_pr_bacteria 2684622551 2684819147 337
51 iso_pr_bacteria 2731957638 2732532309 337
52 iso_pr_bacteria 2791355473 2794384046 337
53 iso_pr_bacteria 2834887098 2834887137 337
54 iso_pr_bacteria 2835335304 2835338573 337
55 iso_pr_bacteria 2837516909 2837518934 337
56 iso_pr_bacteria 2843904799 2843906216 337
57 iso_pr_bacteria 2844251356 2844251977 337
58 iso_pr_bacteria 2846386538 2846389154 337
59 iso_pr_bacteria 2850895757 2850898004 337
60 iso_pr_bacteria 2860776474 2860777355 337
61 iso_pr_bacteria 2868883784 2868887155 337
62 iso_pr_bacteria 2871760914 2871761623 337
63 iso_pr_bacteria 2871771314 2871773707 337
64 iso_pr_bacteria 2872471378 2872471934 337
65 iso_pr_bacteria 2875320051 2875321091 337
66 iso_pr_bacteria 2877638525 2877641515 337
67 iso_pr_bacteria 2877647439 2877648343 337
68 iso_pr_bacteria 2880115952 2880118360 337
69 iso_pr_bacteria 2896925746 2896930533 337
70 iso_pr_bacteria 2898991528 2898994526 337
71 iso_pr_bacteria 2900349738 2900351887 337
72 iso_pr_bacteria 2902438364 2902440735 337
73 iso_pr_bacteria 2902451016 2902452924 337
74 iso_pr_bacteria 2902469402 2902472723 337
75 iso_pr_bacteria 2908136803 2908137795 337
76 iso_pr_bacteria 2912570088 2912572275 337
77 iso_pr_bacteria 3001459110 3001460360 337
78 iso_pr_bacteria 3001462594 3001464548 337
79 iso_pr_bacteria 640963010 641028823 337
80 iso_pr_bacteria 648276708 648768159 337
81 iso_pr_bacteria 651324086 651698227 337
82 iso_pr_bacteria 8008122225 8008122442 337
83 iso_pr_bacteria 8042061949 8042066869 337
84 iso_pr_bacteria 8051461712 8051463418 337
85 iso_pr_bacteria 8051534459 8051538258 337
86 iso_pr_bacteria 8051551332 8051554993 337
87 iso_pr_bacteria 8060845732 8060850020 337
88 iso_pr_bacteria 8065462725 8065465822 337
89 iso_pr_bacteria 8065466226 8065466666 337
90 iso_pr_bacteria 8065469765 8065472591 337
91 iso_pr_bacteria 8074288691 8074292043 337
92 iso_pr_bacteria 8074292191 8074293436 337
93 iso_pr_bacteria 8102982778 8102985020 337
94 iso_pr_bacteria 8103002986 8103006028 337
95 iso_pr_bacteria 8103008710 8103012179 337
96 iso_pr_bacteria 8116627632 8116632570 337
97 2035918003 DPOL_contig10900 DPOLB_1378080 338
98 2065487013 FGTW_contig05871 FGTW_01792060 338
99 2065487013 FGTW_contig30935 FGTW_00526940 338
100 2225789004 2227507945 2227997783 338
101 3300000062 IMNBL1DRAFT_c0003893 IMNBL1DRAFT_00038935 338
102 3300003973 Ga0063521_1000104 Ga0063521_10001046 338
103 3300003973 Ga0063521_1002515 Ga0063521_10025154 338
104 3300009463 Ga0127644_100036 Ga0127644_10003691 338
105 3300009468 Ga0127530_100162 Ga0127530_10016225 338
106 3300009468 Ga0127530_101165 Ga0127530_1011656 338
107 3300009531 Ga0127525_100070 Ga0127525_100070375 338
108 3300009539 Ga0127521_100003 Ga0127521_100003487 338
109 3300012845 Ga0160460_100010 Ga0160460_100010163 338
110 3300024582 Ga0265387_1001063 Ga0265387_10010635 338
111 3300030930 Ga0316159_10420 Ga0316159_104204 338
112 3300035363 Ga0247289_0489 Ga0247289_0489_1879_2895 338
113 3300042601 Ga0466707_143369 Ga0466707_143369_864_1880 338
114 3300042602 Ga0466713_139973 Ga0466713_139973_44829_45845 338
115 3300042625 Ga0466730_003525 Ga0466730_003525_42041_43057 338
116 3300042625 Ga0466730_017916 Ga0466730_017916_2809_3825 338
117 3300042625 Ga0466730_025636 Ga0466730_025636_808_1824 338
118 3300042625 Ga0466730_065282 Ga0466730_065282_3233_4249 338
119 3300042649 Ga0466724_12489 Ga0466724_12489_35971_36987 338
120 3300042649 Ga0466724_26052 Ga0466724_26052_46192_47208 338
121 3300042649 Ga0466724_52809 Ga0466724_52809_15649_16665 338
122 3300056814 Ga0562378_0018 Ga0562378_0018_698489_699505 338
123 3300056842 Ga0562377_0054 Ga0562377_0054_160530_161546 338
124 3300056857 Ga0562376_0001 Ga0562376_0001_350662_351678 338
125 iso_pr_bacteria 2507262057 2507517273 338
126 iso_pr_bacteria 2511231206 2511995440 338
127 iso_pr_bacteria 2513020017 2513100991 338
128 iso_pr_bacteria 2519899623 2520394628 338
129 iso_pr_bacteria 2531839602 2534151915 338
130 iso_pr_bacteria 2537561600 2537927012 338
131 iso_pr_bacteria 2547132185 2547711086 338
132 iso_pr_bacteria 2565956518 2566024683 338
133 iso_pr_bacteria 2588253791 2588731508 338
134 iso_pr_bacteria 2648501158 2648748876 338
135 iso_pr_bacteria 2651870110 2653797319 338
136 iso_pr_bacteria 2654587723 2655552682 338
137 iso_pr_bacteria 2711768158 2712481412 338
138 iso_pr_bacteria 2756170277 2756796823 338
139 iso_pr_bacteria 2765235945 2766083288 338
140 iso_pr_bacteria 2778261152 2779038984 338
141 iso_pr_bacteria 2778261153 2779041888 338
142 iso_pr_bacteria 2791355471 2794375370 338
143 iso_pr_bacteria 2822856742 2822859448 338
144 iso_pr_bacteria 2824588292 2824590510 338
145 iso_pr_bacteria 2833053935 2833058843 338
146 iso_pr_bacteria 2836714267 2836716741 338
147 iso_pr_bacteria 2847708326 2847711291 338
148 iso_pr_bacteria 2856068565 2856070346 338
149 iso_pr_bacteria 2859315706 2859317460 338
150 iso_pr_bacteria 2874434233 2874435693 338
151 iso_pr_bacteria 2874504452 2874505110 338
152 iso_pr_bacteria 2874880541 2874881935 338
153 iso_pr_bacteria 2876334352 2876337481 338
154 iso_pr_bacteria 2876358570 2876358649 338
155 iso_pr_bacteria 2878947168 2878948822 338
156 iso_pr_bacteria 2885043073 2885045489 338
157 iso_pr_bacteria 2885046828 2885049167 338
158 iso_pr_bacteria 2885050628 2885050657 338
159 iso_pr_bacteria 2885054481 2885058098 338
160 iso_pr_bacteria 2885058212 2885061360 338
161 iso_pr_bacteria 2885061987 2885062124 338
162 iso_pr_bacteria 2885065815 2885065838 338
163 iso_pr_bacteria 2912636047 2912637329 338
164 iso_pr_bacteria 2921816052 2921819748 338
165 iso_pr_bacteria 2921842437 2921845150 338
166 iso_pr_bacteria 2922113941 2922114535 338
167 iso_pr_bacteria 2937387794 2937389396 338
168 iso_pr_bacteria 2937427229 2937429332 338
169 iso_pr_bacteria 2937735258 2937735335 338
170 iso_pr_bacteria 2937751072 2937752975 338
171 iso_pr_bacteria 2938192669 2938193424 338
172 iso_pr_bacteria 2957730672 2957734340 338
173 iso_pr_bacteria 2958255616 2958258566 338
174 iso_pr_bacteria 2961232173 2961235437 338
175 iso_pr_bacteria 2964846109 2964846351 338
176 iso_pr_bacteria 2964859436 2964863907 338
177 iso_pr_bacteria 2965197371 2965202501 338
178 iso_pr_bacteria 2967915117 2967915130 338
179 iso_pr_bacteria 2967924226 2967926035 338
180 iso_pr_bacteria 2970322301 2970325995 338
181 iso_pr_bacteria 2970791725 2970795037 338
182 iso_pr_bacteria 2971189173 2971189819 338
183 iso_pr_bacteria 2977691992 2977693912 338
184 iso_pr_bacteria 2977727922 2977730136 338
185 iso_pr_bacteria 2977745872 2977745939 338
186 iso_pr_bacteria 2978102237 2978106452 338
187 iso_pr_bacteria 2978161719 2978162576 338
188 iso_pr_bacteria 2979682021 2979684341 338
189 iso_pr_bacteria 2984883310 2984883533 338
190 iso_pr_bacteria 2989793055 2989794205 338
191 iso_pr_bacteria 2996406003 2996406016 338
192 iso_pr_bacteria 2996467878 2996472678 338
193 iso_pr_bacteria 3004010258 3004011787 338
194 iso_pr_bacteria 3004364956 3004366001 338
195 iso_pr_bacteria 3006225627 3006229293 338
196 iso_pr_bacteria 3006242587 3006245376 338
197 iso_pr_bacteria 3007994558 3007995458 338
198 iso_pr_bacteria 651285005 651303538 338
199 iso_pr_bacteria 8001059720 8001063082 338
200 iso_pr_bacteria 8004118532 8004119650 338
201 iso_pr_bacteria 8004285568 8004288546 338
202 iso_pr_bacteria 8004307473 8004310467 338
203 iso_pr_bacteria 8004541719 8004542104 338
204 iso_pr_bacteria 8004571736 8004571760 338
205 iso_pr_bacteria 8004582426 8004584649 338
206 iso_pr_bacteria 8006199443 8006201582 338
207 iso_pr_bacteria 8018312681 8018312959 338
208 iso_pr_bacteria 8021535516 8021539552 338
209 iso_pr_bacteria 8022116796 8022117787 338
210 iso_pr_bacteria 8022345672 8022348292 338
211 iso_pr_bacteria 8028002147 8028004042 338
212 iso_pr_bacteria 8033364368 8033367164 338
213 iso_pr_bacteria 8033368880 8033373428 338
214 iso_pr_bacteria 8062647588 8062648318 338
215 iso_pr_bacteria 8071322446 8071327377 338
216 iso_pr_bacteria 8071333649 8071338384 338
217 iso_pr_bacteria 8071338694 8071338778 338
218 iso_pr_bacteria 8071343737 8071345932 338
219 iso_pr_bacteria 8073124432 8073126960 338
220 iso_pr_bacteria 8100171289 8100172819 338
221 iso_pr_bacteria 8100176769 8100178314 338
222 iso_pr_bacteria 8100181737 8100183294 338
223 iso_pr_bacteria 8110023836 8110026427 338
224 3300000333 HBC_ctgsDRAFT_1004349 HBC_ctgsDRAFT_10043492 339
225 3300002464 Meta3P_1001421 Meta3P_10014215 339
226 3300002932 CVPL010L_1000723 CVPL010L_10007238 339
227 3300003973 Ga0063521_1000056 Ga0063521_100005687 339
228 3300007767 Ga0105553_1042061 Ga0105553_10420613 339
229 3300009456 Ga0127523_100016 Ga0127523_100016563 339
230 3300009477 Ga0127522_100011 Ga0127522_100011528 339
231 3300012824 Ga0160469_100029 Ga0160469_100029139 339
232 3300012846 Ga0160433_102243 Ga0160433_1022432 339
233 3300024582 Ga0265387_1000060 Ga0265387_100006012 339
234 3300042598 Ga0466701_026127 Ga0466701_026127_10178_11197 339
235 3300042602 Ga0466713_099611 Ga0466713_099611_2743_3762 339
236 3300042649 Ga0466724_30696 Ga0466724_30696_7550_8569 339
237 iso_pr_bacteria 2518285522 2518346060 339
238 iso_pr_bacteria 2529292851 2530233494 339
239 iso_pr_bacteria 2588253732 2588528880 339
240 iso_pr_bacteria 2597489902 2597921584 339
241 iso_pr_bacteria 2841260384 2841261366 339
242 iso_pr_bacteria 2850131454 2850132809 339
243 iso_pr_bacteria 2896187957 2896190912 339
244 iso_pr_bacteria 8021540981 8021543989 339
245 iso_pr_bacteria 8021546568 8021551161 339
246 iso_pr_bacteria 8101676404 8101677390 339
247 iso_pr_bacteria 8101680043 8101681257 339
248 iso_pr_bacteria 8101683685 8101687000 339
249 2035918003 DPOL_contig03311 DPOLB_1278180 340
250 3300002932 CVPL010L_1000548 CVPL010L_10005486 340
251 3300003973 Ga0063521_1000017 Ga0063521_1000017145 340
252 3300003973 Ga0063521_1000032 Ga0063521_100003278 340
253 3300005318 Ga0074188_1000294 Ga0074188_100029412 340
254 3300009533 Ga0127528_1000015 Ga0127528_1000015545 340
255 iso_pr_bacteria 2510065002 2510071339 340
256 iso_pr_bacteria 2510065003 2510075236 340
257 iso_pr_bacteria 2524614872 2526111690 340
258 iso_pr_bacteria 2703719239 2706052106 340
259 iso_pr_bacteria 2703719240 2706057592 340
260 iso_pr_bacteria 2718217944 2719463257 340
261 iso_pr_bacteria 2731957969 2734001692 340
262 iso_pr_bacteria 2744054871 2745948659 340
263 iso_pr_bacteria 2836755666 2836757771 340
264 iso_pr_bacteria 2961206375 2961208279 340
265 iso_pr_bacteria 2961247850 2961249877 340
266 iso_pr_bacteria 8076031980 8076032003 340
267 iso_pr_bacteria 8076033509 8076033528 340
268 iso_pr_bacteria 8099192374 8099194257 340
269 3300002464 Meta3P_1000267 Meta3P_10002679 341
270 3300007224 Ga0104147_1013055 Ga0104147_10130558 341
271 3300007505 Ga0105005_1003412 Ga0105005_10034122 341
272 3300009461 Ga0127645_101788 Ga0127645_1017884 341
273 3300009535 Ga0127526_1000110 Ga0127526_1000110562 341
274 3300042601 Ga0466707_096100 Ga0466707_096100_87028_88053 341
275 iso_pr_bacteria 2751185823 2753468557 341
276 iso_pr_bacteria 8001394582 8001398263 341
277 iso_pr_bacteria 8076029720 8076029738 341
278 iso_pr_bacteria 8076047169 8076047188 341
279 3300009458 Ga0127646_100058 Ga0127646_100058266 342
280 3300009461 Ga0127645_100025 Ga0127645_100025300 342
281 3300056790 Ga0562379_0001 Ga0562379_0001_3085937_3086965 342
282 iso_pr_bacteria 2574179716 2574245448 342
283 iso_pr_bacteria 8022439116 8022442434 342
284 3300056842 Ga0562377_0066 Ga0562377_0066_278118_279149 343
285 iso_pr_bacteria 8076030444 8076030469 343
286 iso_pr_bacteria 8076029003 8076029022 345
287 iso_pr_bacteria 8076031238 8076031258 345
288 iso_pr_bacteria 8076032775 8076032794 347
289 3300042602 Ga0466713_112824 Ga0466713_112824_2289_3350 353
290 3300002932 CVPL010L_1002213 CVPL010L_10022132 366
291 iso_pr_bacteria 2551306516 2553380314 368
292 iso_pr_bacteria 2551306531 2553451271 368
293 iso_pr_bacteria 2551306507 2553348367 379
294 iso_pr_bacteria 2663763317 2666536998 379
295 iso_pr_bacteria 2667527830 2669649919 379
296 iso_pr_bacteria 2693429575 2693742518 379
297 iso_pr_bacteria 2700989396 2702440125 379
298 iso_pr_bacteria 2785510762 2785801349 379
299 iso_pr_bacteria 2997380424 2997381594 379
300 iso_pr_bacteria 8022087107 8022090907 379
301 iso_pr_bacteria 8022096067 8022096301 379
302 iso_pr_bacteria 8076028257 8076028275 379

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 256 368 0.97
PF00710 Asparaginase Asparaginase, N-terminal 47 233 0.9

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.