Protein Family IF13155
Metagenome
Isolate
373
Members
283
Samples
122
Scaffolds
290.96
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2971189173|2971191126|
- Length
- 310 aa
- Sequence
- MYQEIVCIRRLHVSGERMKGIILAGGSGSRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIGEAFIDNEPCCLVLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVVEFDDNFRALSIEEKPSQPKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYLDRGELTVELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDDGVKRAATALAKTGYGKYLLDLLHARPRQY
Sample Types
Isolate
67.3%
Metagenome
32.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
25.9%
Unclassified
16.8%
Drosophilidae
13.9%
Anthocoridae
4.7%
Termitidae
4.0%
Muscidae
3.3%
Formicidae
3.3%
Kalotermitidae
2.9%
Culicidae
2.6%
Calliphoridae
2.6%
Tenebrionidae
2.2%
Armadillidiidae
1.5%
Curculionidae
1.5%
Elmidae
1.5%
Aphididae
1.5%
Cambaridae
1.1%
Pteromalidae
1.1%
Cerambycidae
1.1%
Passalidae
0.7%
Sarcophagidae
0.7%
Tephritidae
0.7%
Daphniidae
0.4%
Hodotermitidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Siricidae
0.4%
Crambidae
0.4%
Palinuridae
0.4%
Termopsidae
0.4%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Nephropidae
0.4%
Reduviidae
0.4%
Pentatomidae
0.4%
Nymphalidae
0.4%
Glossinidae
0.4%
Cicadellidae
0.4%
Aleyrodidae
0.4%
Rhinotermitidae
0.4%
Taxonomy
Archaea
0
Bacteria
364
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 3 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 4 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 5 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 6 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 7 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 8 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 9 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 10 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 11 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 12 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 13 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 14 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 15 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 16 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 17 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 18 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 19 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 20 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 21 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 22 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 25 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 26 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 27 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 30 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 31 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 32 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 33 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 34 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 40 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 41 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 42 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 43 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 44 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 45 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 46 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 47 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 48 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 49 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 50 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 51 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 52 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 53 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 54 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 55 | 2958255616 | Serratia marcescens TM | Isolate | |
| 56 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 57 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 58 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 59 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 60 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 61 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 62 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 63 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 64 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 65 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 66 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 67 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 68 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 69 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 70 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 71 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 76 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 77 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 78 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 79 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 80 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 81 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 82 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 83 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 84 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 85 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 86 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 87 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 88 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 89 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 90 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 91 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 92 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 93 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 94 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 95 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 96 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 97 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 98 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 99 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 100 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 101 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 102 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 103 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 104 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 105 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 106 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 107 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 108 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 109 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 110 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 111 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 112 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 113 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 114 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 115 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 116 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 117 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 118 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 119 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 120 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 121 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 122 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 123 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 124 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 125 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 126 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 127 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 128 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 129 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 130 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 131 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 132 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 133 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 134 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 135 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 136 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 137 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 138 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 139 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 140 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 141 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 142 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 143 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 144 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 145 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 146 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 147 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 148 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 149 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 150 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 151 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 152 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 153 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 154 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 155 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 156 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 157 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 158 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 159 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 160 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 161 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 162 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 163 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 164 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 165 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 166 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 167 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 168 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 169 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 170 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 171 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 172 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 173 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 174 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 175 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 176 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 177 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 178 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 179 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 180 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 181 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 182 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 183 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 184 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 185 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 186 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 187 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 188 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 189 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 190 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 191 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 192 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 193 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 194 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 195 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 196 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 197 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 198 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 199 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 200 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 201 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 202 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 203 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 204 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 205 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 206 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 207 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 208 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 209 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 210 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 211 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 212 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 213 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 214 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 215 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 216 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 217 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 218 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 219 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 220 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 221 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 222 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 223 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 224 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 225 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 226 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 227 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 228 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 229 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 230 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 231 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 232 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 233 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 234 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 235 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 236 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 237 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 238 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 239 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 240 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 241 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 242 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 243 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 244 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 245 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 246 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 247 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 248 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 249 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 250 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 251 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 252 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 253 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 254 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 255 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 256 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 257 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 258 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 259 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 260 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 261 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 262 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 263 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 264 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 265 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 266 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 267 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 268 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 269 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 270 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 271 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 272 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 273 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 274 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 275 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 276 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 277 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 278 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 279 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 280 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 281 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 282 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 283 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_114675 | 3300042659 | Bacteria | 2132 |
| 2 | FGTW_contig17484 | 2065487013 | Bacteria | 14146 |
| 3 | 2227480175 | 2225789004 | Bacteria | 87862 |
| 4 | HBC_ctgsDRAFT_1012829 | 3300000333 | Bacteria | 2012 |
| 5 | SCG598L16_135311 | 3300000490 | Bacteria | 19856 |
| 6 | CVPL010W_10000354 | 3300002931 | Bacteria | 62072 |
| 7 | Ga0074188_1039494 | 3300005318 | Bacteria | 6541 |
| 8 | Ga0074278_108740 | 3300005721 | Unclassified | 1286 |
| 9 | Ga0102739_1008496 | 3300007095 | Bacteria | 1352 |
| 10 | Ga0103268_1004407 | 3300007192 | Bacteria | 2862 |
| 11 | Ga0466715_166956 | 3300042616 | Bacteria | 103860 |
| 12 | Ga0466723_233345 | 3300042618 | Bacteria | 21765 |
| 13 | Ga0466726_034973 | 3300042619 | Bacteria | 6518 |
| 14 | Ga0466724_33766 | 3300042649 | Unclassified | 1244 |
| 15 | Ga0466724_36978 | 3300042649 | Bacteria | 4527 |
| 16 | Ga0562377_0066 | 3300056842 | Bacteria | 455762 |
| 17 | Ga0562375_3176 | 3300056856 | Bacteria | 16196 |
| 18 | Ga0160459_100025 | 3300012831 | Bacteria | 346491 |
| 19 | Ga0265387_1000057 | 3300024582 | Bacteria | 35018 |
| 20 | Ga0466695_179474 | 3300042595 | Bacteria | 3277 |
| 21 | Ga0466701_004948 | 3300042598 | Bacteria | 111014 |
| 22 | Ga0123357_10191800 | 3300009784 | Bacteria | 2352 |
| 23 | Ga0160464_104600 | 3300012805 | Bacteria | 1714 |
| 24 | gam1t_NODE_138742_length=1895_GC=41_2_Contigs=1 | 2189573031 | Bacteria | 1895 |
| 25 | SCG598I20_12761 | 3300000473 | Bacteria | 87981 |
| 26 | Meta3P_1000389 | 3300002464 | Bacteria | 14707 |
| 27 | Meta3P_1000930 | 3300002464 | Unclassified | 16371 |
| 28 | Ga0074278_107487 | 3300005721 | Unclassified | 1895 |
| 29 | Ga0102734_1000249 | 3300007129 | Bacteria | 27773 |
| 30 | Ga0102734_1000672 | 3300007129 | Bacteria | 12497 |
| 31 | Ga0103268_1012930 | 3300007192 | Bacteria | 1787 |
| 32 | Ga0466715_228024 | 3300042616 | Bacteria | 6680 |
| 33 | Ga0466730_091849 | 3300042625 | Bacteria | 17953 |
| 34 | Ga0466705_341745 | 3300042612 | Bacteria | 5312 |
| 35 | Ga0160433_100797 | 3300012846 | Bacteria | 11343 |
| 36 | Ga0160445_100666 | 3300012847 | Bacteria | 14135 |
| 37 | Ga0123355_10082525 | 3300009826 | Bacteria | 5127 |
| 38 | gam1t_NODE_340152_length=2447_GC=41_4_Contigs=3 | 2189573031 | Bacteria | 2467 |
| 39 | Ga0466710_187215 | 3300042613 | Bacteria | 3657 |
| 40 | Ga0466726_349613 | 3300042619 | Bacteria | 17660 |
| 41 | Ga0466730_008893 | 3300042625 | Bacteria | 3462 |
| 42 | Ga0466704_149843 | 3300042643 | Bacteria | 2529 |
| 43 | Ga0466724_27864 | 3300042649 | Bacteria | 2262 |
| 44 | Ga0466733_173142 | 3300042659 | Bacteria | 2050 |
| 45 | Ga0562378_0317 | 3300056814 | Bacteria | 99082 |
| 46 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 47 | Ga0562375_4118 | 3300056856 | Bacteria | 11808 |
| 48 | Ga0316159_10002 | 3300030930 | Bacteria | 247683 |
| 49 | Ga0466690_246904 | 3300042590 | Bacteria | 17763 |
| 50 | Ga0466719_034409 | 3300042606 | Bacteria | 46165 |
| 51 | DPOL_contig07764 | 2035918003 | Bacteria | 12480 |
| 52 | gam1t_NODE_212049_length=21417_GC=30_1_Contigs=7 | 2189573031 | Bacteria | 21477 |
| 53 | HBC_ctgsDRAFT_1000243 | 3300000333 | Bacteria | 12595 |
| 54 | HBC_ctgsDRAFT_1012512 | 3300000333 | Bacteria | 2035 |
| 55 | SCG598L16_135269 | 3300000490 | Bacteria | 4732 |
| 56 | CVPL010L_1000109 | 3300002932 | Bacteria | 25280 |
| 57 | Ga0074278_136559 | 3300005721 | Bacteria | 6112 |
| 58 | Ga0103264_1001058 | 3300007188 | Bacteria | 23595 |
| 59 | Ga0466730_072747 | 3300042625 | Bacteria | 5188 |
| 60 | Ga0466704_184216 | 3300042643 | Bacteria | 15562 |
| 61 | Ga0466724_42161 | 3300042649 | Bacteria | 12024 |
| 62 | Ga0466733_018244 | 3300042659 | Bacteria | 41571 |
| 63 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 64 | Ga0466690_230992 | 3300042590 | Bacteria | 3031 |
| 65 | Ga0466707_017957 | 3300042601 | Bacteria | 42757 |
| 66 | Ga0466714_032634 | 3300042603 | Bacteria | 9420 |
| 67 | FGTW_contig05509 | 2065487013 | Bacteria | 6420 |
| 68 | FGTW_contig11312 | 2065487013 | Bacteria | 7974 |
| 69 | IMNBL1DRAFT_c0000884 | 3300000062 | Bacteria | 23341 |
| 70 | HBC_ctgsDRAFT_1013961 | 3300000333 | Bacteria | 1936 |
| 71 | CVPL010W_10000069 | 3300002931 | Bacteria | 98272 |
| 72 | Ga0063521_1000270 | 3300003973 | Bacteria | 33830 |
| 73 | Ga0063521_1001830 | 3300003973 | Bacteria | 5461 |
| 74 | Ga0074303_1000185 | 3300005306 | Bacteria | 12906 |
| 75 | Ga0074278_114366 | 3300005721 | Bacteria | 21477 |
| 76 | Ga0074278_118005 | 3300005721 | Unclassified | 2467 |
| 77 | Ga0104040_1000215 | 3300007149 | Bacteria | 1876 |
| 78 | Ga0103267_1066967 | 3300007190 | Bacteria | 1728 |
| 79 | Ga0105004_1030201 | 3300007763 | Bacteria | 22575 |
| 80 | Ga0466711_048450 | 3300042615 | Bacteria | 15905 |
| 81 | Ga0466715_393620 | 3300042616 | Bacteria | 23952 |
| 82 | Ga0466730_099882 | 3300042625 | Bacteria | 5032 |
| 83 | Ga0466724_32065 | 3300042649 | Bacteria | 32042 |
| 84 | Ga0530661_000654 | 3300056564 | Bacteria | 23485 |
| 85 | Ga0160441_109951 | 3300012825 | Bacteria | 1164 |
| 86 | Ga0160459_109890 | 3300012831 | Bacteria | 1151 |
| 87 | Ga0160460_100192 | 3300012845 | Bacteria | 64905 |
| 88 | Ga0160443_100228 | 3300012848 | Bacteria | 63267 |
| 89 | Ga0466691_135341 | 3300042593 | Bacteria | 5838 |
| 90 | gam1t_NODE_350232_length=4091_GC=30_0_Contigs=1 | 2189573031 | Bacteria | 4091 |
| 91 | CVPL010L_1000207 | 3300002932 | Bacteria | 35085 |
| 92 | CVPL005W_1009979 | 3300002934 | Unclassified | 3049 |
| 93 | Ga0074278_107171 | 3300005721 | Bacteria | 4091 |
| 94 | Ga0104040_1000196 | 3300007149 | Bacteria | 4183 |
| 95 | Ga0104040_1000586 | 3300007149 | Bacteria | 4928 |
| 96 | Ga0103264_1000041 | 3300007188 | Bacteria | 73656 |
| 97 | Ga0466710_065886 | 3300042613 | Bacteria | 1553 |
| 98 | Ga0466715_190989 | 3300042616 | Bacteria | 5915 |
| 99 | Ga0466723_068881 | 3300042618 | Bacteria | 39250 |
| 100 | Ga0466730_084933 | 3300042625 | Bacteria | 3685 |
| 101 | Ga0466730_096093 | 3300042625 | Bacteria | 4909 |
| 102 | Ga0466724_08722 | 3300042649 | Bacteria | 23991 |
| 103 | Ga0160445_109839 | 3300012847 | Bacteria | 1427 |
| 104 | Ga0466699_302290 | 3300042597 | Bacteria | 1848 |
| 105 | Ga0466706_132449 | 3300042599 | Bacteria | 3238 |
| 106 | Ga0466713_069199 | 3300042602 | Bacteria | 17366 |
| 107 | Ga0466714_003636 | 3300042603 | Bacteria | 2206 |
| 108 | HBC_ctgsDRAFT_1014267 | 3300000333 | Unclassified | 1918 |
| 109 | JGI24695J34938_10041251 | 3300002450 | Unclassified | 2073 |
| 110 | Ga0063521_1000121 | 3300003973 | Bacteria | 59608 |
| 111 | Ga0063521_1000449 | 3300003973 | Bacteria | 20660 |
| 112 | Ga0074278_109724 | 3300005721 | Bacteria | 13944 |
| 113 | Ga0074278_142739 | 3300005721 | Unclassified | 26512 |
| 114 | Ga0103268_1006598 | 3300007192 | Bacteria | 2361 |
| 115 | Ga0466711_064936 | 3300042615 | Bacteria | 8251 |
| 116 | Ga0466723_264015 | 3300042618 | Bacteria | 1678 |
| 117 | Ga0160469_100282 | 3300012824 | Bacteria | 35499 |
| 118 | Ga0466691_061511 | 3300042593 | Bacteria | 6315 |
| 119 | Ga0123355_10327989 | 3300009826 | Bacteria | 2054 |
| 120 | Ga0466706_198822 | 3300042599 | Bacteria | 16157 |
| 121 | Ga0466713_055223 | 3300042602 | Bacteria | 3982 |
| 122 | SWWA_contig19544__length_13380___numreads_267 | 2100351016 | Bacteria | 13380 |
Family Sequences
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.92 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.